Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AFR293C5.709ON36536518410.0
Ecym_40125.709ON39534012121e-166
SAKL0E15070g5.709ON38532510741e-145
KLTH0E00880g5.709ON3713179991e-134
TDEL0B021105.709ON3893279841e-132
Kwal_55.196615.709ON3713269821e-131
Kpol_2001.775.709ON4133279381e-124
NCAS0G002005.709ON4383409331e-123
CAGL0H06655g5.709ON4243239291e-123
ZYRO0B16478g5.709ON3913189211e-122
KLLA0A00462g5.709ON3533309101e-121
Suva_9.355.709ON3933249051e-119
YIL153W (RRD1)5.709ON3933178921e-118
NDAI0F002405.709ON4643288971e-117
Skud_9.155.709ON4023278861e-116
Smik_9.165.709ON3933178741e-115
TPHA0D046505.709ON4213248531e-111
TBLA0E016905.709ON4883418461e-109
KAFR0D021905.709ON4263228341e-108
KNAG0L021705.709ON3963317981e-103
ACR139C8.674ON3593204436e-51
Kpol_1013.48.674ON3582954437e-51
KLTH0D11176g8.674ON3533174236e-48
CAGL0M02255g8.674ON3582954211e-47
ZYRO0F07326g8.674ON3522414201e-47
TPHA0D012408.674ON3593024192e-47
TDEL0A062008.674ON3552994141e-46
NCAS0C016908.674ON3592954089e-46
Kwal_26.87838.674ON3553154071e-45
Suva_16.1588.674ON3583144071e-45
Skud_16.1308.674ON3583034062e-45
Ecym_23998.674ON3512604034e-45
SAKL0H06622g8.674ON3552953982e-44
YPL152W (RRD2)8.674ON3583153965e-44
Smik_6.3498.674ON3583003966e-44
KAFR0H024408.674ON3532903948e-44
KLLA0F11187g8.674ON3602283871e-42
NDAI0E024108.674ON3592953861e-42
KNAG0J016908.674ON3633023827e-42
TBLA0C018608.674ON3562593679e-40
KNAG0E032808.44ON42993810.17
TBLA0H025105.165ON49848703.1
Suva_8.164.6ON159968695.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR293C
         (365 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR293C Chr6 complement(967308..968405) [1098 bp, 365 aa] {ON} S...   713   0.0  
Ecym_4012 Chr4 (29674..30861) [1188 bp, 395 aa] {ON} similar to ...   471   e-166
SAKL0E15070g Chr5 complement(1253760..1254917) [1158 bp, 385 aa]...   418   e-145
KLTH0E00880g Chr5 (87353..88468) [1116 bp, 371 aa] {ON} similar ...   389   e-134
TDEL0B02110 Chr2 (376429..377598) [1170 bp, 389 aa] {ON} Anc_5.7...   383   e-132
Kwal_55.19661 s55 (69740..70855) [1116 bp, 371 aa] {ON} YIL153W ...   382   e-131
Kpol_2001.77 s2001 complement(211870..213111) [1242 bp, 413 aa] ...   365   e-124
NCAS0G00200 Chr7 (29159..30475) [1317 bp, 438 aa] {ON} Anc_5.709      363   e-123
CAGL0H06655g Chr8 complement(661713..662987) [1275 bp, 424 aa] {...   362   e-123
ZYRO0B16478g Chr2 complement(1336755..1337930) [1176 bp, 391 aa]...   359   e-122
KLLA0A00462g Chr1 (38766..39827) [1062 bp, 353 aa] {ON} similar ...   355   e-121
Suva_9.35 Chr9 (49860..51041) [1182 bp, 393 aa] {ON} YIL153W (REAL)   353   e-119
YIL153W Chr9 (55198..56379) [1182 bp, 393 aa] {ON}  RRD1Peptidyl...   348   e-118
NDAI0F00240 Chr6 (46047..47441) [1395 bp, 464 aa] {ON} Anc_5.709      350   e-117
Skud_9.15 Chr9 (32255..33463) [1209 bp, 402 aa] {ON} YIL153W (REAL)   345   e-116
Smik_9.16 Chr9 (32798..33979) [1182 bp, 393 aa] {ON} YIL153W (REAL)   341   e-115
TPHA0D04650 Chr4 complement(1015658..1016923) [1266 bp, 421 aa] ...   333   e-111
TBLA0E01690 Chr5 (406884..408350) [1467 bp, 488 aa] {ON} Anc_5.7...   330   e-109
KAFR0D02190 Chr4 (439664..440944) [1281 bp, 426 aa] {ON} Anc_5.7...   325   e-108
KNAG0L02170 Chr12 complement(388956..390146) [1191 bp, 396 aa] {...   311   e-103
ACR139C Chr3 complement(592864..593943) [1080 bp, 359 aa] {ON} S...   175   6e-51
Kpol_1013.4 s1013 complement(5948..7024) [1077 bp, 358 aa] {ON} ...   175   7e-51
KLTH0D11176g Chr4 complement(913077..914138) [1062 bp, 353 aa] {...   167   6e-48
CAGL0M02255g Chr13 (270614..271690) [1077 bp, 358 aa] {ON} highl...   166   1e-47
ZYRO0F07326g Chr6 complement(592906..593964) [1059 bp, 352 aa] {...   166   1e-47
TPHA0D01240 Chr4 complement(259089..260168) [1080 bp, 359 aa] {O...   166   2e-47
TDEL0A06200 Chr1 complement(1085066..1086133) [1068 bp, 355 aa] ...   164   1e-46
NCAS0C01690 Chr3 complement(311102..312181) [1080 bp, 359 aa] {O...   161   9e-46
Kwal_26.8783 s26 complement(941317..942384) [1068 bp, 355 aa] {O...   161   1e-45
Suva_16.158 Chr16 (274228..275304) [1077 bp, 358 aa] {ON} YPL152...   161   1e-45
Skud_16.130 Chr16 (236660..237736) [1077 bp, 358 aa] {ON} YPL152...   160   2e-45
Ecym_2399 Chr2 (778448..779503) [1056 bp, 351 aa] {ON} similar t...   159   4e-45
SAKL0H06622g Chr8 (583484..584551) [1068 bp, 355 aa] {ON} simila...   157   2e-44
YPL152W Chr16 (265028..266104) [1077 bp, 358 aa] {ON}  RRD2Activ...   157   5e-44
Smik_6.349 Chr6 complement(558150..559226) [1077 bp, 358 aa] {ON...   157   6e-44
KAFR0H02440 Chr8 (467656..468717) [1062 bp, 353 aa] {ON} Anc_8.6...   156   8e-44
KLLA0F11187g Chr6 (1031839..1032921) [1083 bp, 360 aa] {ON} simi...   153   1e-42
NDAI0E02410 Chr5 complement(500623..501702) [1080 bp, 359 aa] {O...   153   1e-42
KNAG0J01690 Chr10 complement(308576..309667) [1092 bp, 363 aa] {...   151   7e-42
TBLA0C01860 Chr3 complement(437987..439057) [1071 bp, 356 aa] {O...   145   9e-40
KNAG0E03280 Chr5 complement(656486..657775) [1290 bp, 429 aa] {O...    36   0.17 
TBLA0H02510 Chr8 complement(593502..594998) [1497 bp, 498 aa] {O...    32   3.1  
Suva_8.16 Chr8 complement(29573..34372) [4800 bp, 1599 aa] {ON} ...    31   5.6  

>AFR293C Chr6 complement(967308..968405) [1098 bp, 365 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL153W
           (RRD1)
          Length = 365

 Score =  713 bits (1841), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/365 (94%), Positives = 345/365 (94%)

Query: 1   MEFSVEGTQFSPPVKRIFDTAGTHDFQKSLTMYRLQSHLERYLKLVQGQKIPKSSQNRAV 60
           MEFSVEGTQFSPPVKRIFDTAGTHDFQKSLTMYRLQSHLERYLKLVQGQKIPKSSQNRAV
Sbjct: 1   MEFSVEGTQFSPPVKRIFDTAGTHDFQKSLTMYRLQSHLERYLKLVQGQKIPKSSQNRAV 60

Query: 61  VRFVCILERLDALMDETPPRTGSARRFGDLACRDWHDRMQGELDGLLETLLPEAARRSAA 120
           VRFVCILERLDALMDETPPRTGSARRFGDLACRDWHDRMQGELDGLLETLLPEAARRSAA
Sbjct: 61  VRFVCILERLDALMDETPPRTGSARRFGDLACRDWHDRMQGELDGLLETLLPEAARRSAA 120

Query: 121 ELRYYLGSAFGSRERLDYGTGHELAFLAVVVALDMLGLWTEDKFTGEDMLYVWARYYALV 180
           ELRYYLGSAFGSRERLDYGTGHELAFLAVVVALDMLGLWTEDKFTGEDMLYVWARYYALV
Sbjct: 121 ELRYYLGSAFGSRERLDYGTGHELAFLAVVVALDMLGLWTEDKFTGEDMLYVWARYYALV 180

Query: 181 HRLILTYNLEPAGSHGVWGLDDHLHLAYILGASQWAQDRNVPMQPSDILDPKAVARYSET 240
           HRLILTYNLEPAGSHGVWGLDDHLHLAYILGASQWAQDRNVPMQPSDILDPKAVARYSET
Sbjct: 181 HRLILTYNLEPAGSHGVWGLDDHLHLAYILGASQWAQDRNVPMQPSDILDPKAVARYSET 240

Query: 241 NLYCNSIAFLLRVKTGHFAQHSPMLHDIAQTVPTWSKVTTGLIKMYRVEVLNKFPVVQHF 300
           NLYCNSIAFLLRVKTGHFAQHSPMLHDIAQTVPTWSKVTTGLIKMYRVEVLNKFPVVQHF
Sbjct: 241 NLYCNSIAFLLRVKTGHFAQHSPMLHDIAQTVPTWSKVTTGLIKMYRVEVLNKFPVVQHF 300

Query: 301 WFGTGFFPWVDMAHGMSLPNYEAPSETSEKXXXXXXXXXXXXXXXXXXXXNCGYGPLGRL 360
           WFGTGFFPWVDMAHGMSLPNYEAPSETSEK                    NCGYGPLGRL
Sbjct: 301 WFGTGFFPWVDMAHGMSLPNYEAPSETSEKPAAGTAHTTTTTMPPPRMTANCGYGPLGRL 360

Query: 361 VTPRR 365
           VTPRR
Sbjct: 361 VTPRR 365

>Ecym_4012 Chr4 (29674..30861) [1188 bp, 395 aa] {ON} similar to
           Ashbya gossypii AFR293C
          Length = 395

 Score =  471 bits (1212), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 226/340 (66%), Positives = 273/340 (80%), Gaps = 10/340 (2%)

Query: 1   MEFSVEGTQFSPPVKRIFDTAGTHDFQKSLTMYRLQSHLERYLKLVQGQKIPKSSQNRAV 60
           M   +  T+FS PVKRIFD+ GTHDFQ+SLTMYRLQSHLERYL LV  Q++PK S N +V
Sbjct: 1   MTVELRKTKFSAPVKRIFDSHGTHDFQRSLTMYRLQSHLERYLGLVHNQEVPKVSTNGSV 60

Query: 61  VRFVCI-LERLDALMDETPPRTGSARRFGDLACRDWHDRMQGELDGLLETLLP----EAA 115
             FV I L+R   L+DETPP T + RRFG++ACRDWH ++Q E+D L    LP     A 
Sbjct: 61  SSFVSIFLDRFLELIDETPPTTNTPRRFGNMACRDWHAKVQEEMDSLWRRFLPIERDAAY 120

Query: 116 RRSAAELRYYLGSAFGSRERLDYGTGHELAFLAVVVALDMLGLWTEDK----FTGEDMLY 171
                ELRYYLG+AFGS ERLDYGTGHEL+FLAVVVA+DMLGLW   +     TG D+LY
Sbjct: 121 ENCIIELRYYLGNAFGSPERLDYGTGHELSFLAVVVAVDMLGLWETSESGHGLTGTDLLY 180

Query: 172 VWARYYALVHRLILTYNLEPAGSHGVWGLDDHLHLAYILGASQWA-QDRNVPMQPSDILD 230
           +W +YY++VH+LILTY LEPAGSHGVWGLDDH+HLAYI+GASQW+ +D+N P+Q SDILD
Sbjct: 181 LWNKYYSIVHKLILTYTLEPAGSHGVWGLDDHIHLAYIIGASQWSDKDQNAPIQLSDILD 240

Query: 231 PKAVARYSETNLYCNSIAFLLRVKTGHFAQHSPMLHDIAQTVPTWSKVTTGLIKMYRVEV 290
            K++ +Y +TNLYCNSIAF+++VK+G F+QHSPML+DI++TVPTWSK T+GLIKMY+VEV
Sbjct: 241 MKSLYQYEDTNLYCNSIAFVMKVKSGPFSQHSPMLYDISRTVPTWSKATSGLIKMYQVEV 300

Query: 291 LNKFPVVQHFWFGTGFFPWVDMAHGMSLPNYEAPSETSEK 330
           LNKFPVVQHFWFGTGFFPWVDM  GMSLPNYE  S+ + K
Sbjct: 301 LNKFPVVQHFWFGTGFFPWVDMKKGMSLPNYELYSKGACK 340

>SAKL0E15070g Chr5 complement(1253760..1254917) [1158 bp, 385 aa]
           {ON} similar to uniprot|P40454 Saccharomyces cerevisiae
           YIL153W RRD1 Resistant to Rapamycin Deletion
          Length = 385

 Score =  418 bits (1074), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 198/325 (60%), Positives = 245/325 (75%), Gaps = 2/325 (0%)

Query: 2   EFSVEGTQFSPPVKRIFDTAGTHDFQKSLTMYRLQSHLERYLKLVQGQKIPKSSQNRAVV 61
           +  V  T+F+ PVK+IFDT GT DFQ S+TMYRLQS+L +Y+ LV  + IP +S N AV 
Sbjct: 9   KIDVSHTKFTEPVKKIFDTQGTQDFQSSVTMYRLQSYLHKYITLVGTKNIPSTSNNDAVN 68

Query: 62  RFVCILERLDALMDETPPRTGSARRFGDLACRDWHDRMQGELDGLLETLLPEAARRSAAE 121
           RF  I++ L   +DETPP  G  RRFG+ ACR WH +M+G LD LL+  +PE       E
Sbjct: 69  RFTQIIDALSRTIDETPPLPG-PRRFGNFACRTWHVKMRGSLDALLQAFIPEKYHVCIVE 127

Query: 122 LRYYLGSAFGSRERLDYGTGHELAFLAVVVALDMLGLWTEDKFTGEDMLYVWARYYALVH 181
           +RYYLG+AFGS+ERLDYGTGHEL+FLAVV A+DML LW  +  +GED+L+++  YY LV 
Sbjct: 128 IRYYLGNAFGSKERLDYGTGHELSFLAVVSAIDMLDLWGSNP-SGEDILFLFNGYYTLVK 186

Query: 182 RLILTYNLEPAGSHGVWGLDDHLHLAYILGASQWAQDRNVPMQPSDILDPKAVARYSETN 241
           +LI TY LEPAGSHGVWGLDDH HLAYILG+SQ A   + P++PSDILD   V  Y++TN
Sbjct: 187 KLIATYTLEPAGSHGVWGLDDHFHLAYILGSSQLAPISHNPLRPSDILDRHTVEDYAKTN 246

Query: 242 LYCNSIAFLLRVKTGHFAQHSPMLHDIAQTVPTWSKVTTGLIKMYRVEVLNKFPVVQHFW 301
           LY  +IAF+ +VK+G F++HSPML+DIA+TV TWSKV  GL+KMY  EVLNKFPVVQHFW
Sbjct: 247 LYFQAIAFIDKVKSGSFSEHSPMLYDIAKTVSTWSKVQRGLLKMYSAEVLNKFPVVQHFW 306

Query: 302 FGTGFFPWVDMAHGMSLPNYEAPSE 326
           FGTGFFPWV++  G  LP YEA  E
Sbjct: 307 FGTGFFPWVNVKSGAILPTYEANQE 331

>KLTH0E00880g Chr5 (87353..88468) [1116 bp, 371 aa] {ON} similar to
           uniprot|P40454 Saccharomyces cerevisiae YIL153W RRD1
           Resistant to Rapamycin Deletion
          Length = 371

 Score =  389 bits (999), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 179/317 (56%), Positives = 230/317 (72%), Gaps = 2/317 (0%)

Query: 10  FSPPVKRIFDTAGTHDFQKSLTMYRLQSHLERYLKLVQGQKIPKSSQNRAVVRFVCILER 69
           F+ P KRIFD+ G+H FQ S+ M RL+S+L +Y+  + G KIP++S N  V  F  +L+ 
Sbjct: 13  FTEPTKRIFDSRGSHVFQSSVAMGRLKSYLHKYVSSMSGVKIPETSTNHEVRSFAELLKT 72

Query: 70  LDALMDETPPRTGSARRFGDLACRDWHDRMQGELDGLLETLLPEAARRSAAELRYYLGSA 129
           L  L+D TP   G  RR+G+LACR WHD++   L+ LL   LPE   +S  EL+YYLG+A
Sbjct: 73  LSELVDSTPALPG-PRRYGNLACRTWHDKVDESLEALLHKFLPEPCHKSIVELQYYLGNA 131

Query: 130 FGSRERLDYGTGHELAFLAVVVALDMLGLWTEDKFTGEDMLYVWARYYALVHRLILTYNL 189
           FGSRERLDYGTGHEL+F A + ALDMLG+W  D F   D+L+++ +YYALV +L+LTY L
Sbjct: 132 FGSRERLDYGTGHELSFFAEICALDMLGVWGAD-FQASDVLFLFDKYYALVRKLVLTYTL 190

Query: 190 EPAGSHGVWGLDDHLHLAYILGASQWAQDRNVPMQPSDILDPKAVARYSETNLYCNSIAF 249
           EPAGSHGVWGLDDH HL YI GASQW   +  P+ P ++ D   V  Y++TN YC +I+F
Sbjct: 191 EPAGSHGVWGLDDHFHLIYIFGASQWVDGKCAPIAPREVQDKLIVDEYTKTNFYCQAISF 250

Query: 250 LLRVKTGHFAQHSPMLHDIAQTVPTWSKVTTGLIKMYRVEVLNKFPVVQHFWFGTGFFPW 309
           + +VK+G F++HSPML DI+++VPTWSKV  GL+KMY  EVLNKFPVVQHFWFGTG FPW
Sbjct: 251 IFQVKSGPFSEHSPMLFDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQHFWFGTGLFPW 310

Query: 310 VDMAHGMSLPNYEAPSE 326
             +  G +LP YEA  E
Sbjct: 311 TSLGDGYALPTYEASQE 327

>TDEL0B02110 Chr2 (376429..377598) [1170 bp, 389 aa] {ON} Anc_5.709
           YIL153W
          Length = 389

 Score =  383 bits (984), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 185/327 (56%), Positives = 237/327 (72%), Gaps = 4/327 (1%)

Query: 5   VEGTQFSPPVKRIFDTAGTHDFQKSLTMYRLQSHLERYLKLVQGQKIPKSSQNRAVV-RF 63
           +  T+F  PVK IFD+ G  DFQ+S+ + RL+ HLE+Y +++ GQ I        VV R 
Sbjct: 9   ISQTKFESPVKCIFDSQGASDFQQSVAIDRLKYHLEKYARMIHGQPIVHEPSGIEVVNRV 68

Query: 64  VCILERLDALMDETPPRTGSARRFGDLACRDWHDRMQGELDGLLETLLPEAARRSAAELR 123
           V +L RL  L+DETPP +G  RR+G+LACRDWHD++   L  LL+ +LP+   +   EL 
Sbjct: 69  VSLLSRLSELVDETPPFSG-PRRYGNLACRDWHDKLDANLTELLQQVLPQDYHKCIPELS 127

Query: 124 YYLGSAFGSRERLDYGTGHELAFLAVVVALDMLGLWTEDKFTGEDMLYVWARYYALVHRL 183
           YYLG++FGS  RLDYGTGHEL+FLAV+ ALDMLGLWT + F+G+D+L ++  YY LV +L
Sbjct: 128 YYLGNSFGSSTRLDYGTGHELSFLAVLGALDMLGLWTSE-FSGKDVLLLFDTYYKLVRKL 186

Query: 184 ILTYNLEPAGSHGVWGLDDHLHLAYILGASQWAQDRNVPMQPSDILDPKAVARYSETNLY 243
           ILTY LEPAGSHGVWGLDDH H+ YILG+SQW+ D  VPM P D+ +   V  Y++TNLY
Sbjct: 187 ILTYTLEPAGSHGVWGLDDHFHIIYILGSSQWSSDPAVPMTPRDVKNKVLVQDYADTNLY 246

Query: 244 CNSIAFLLRVKTGHFAQHSPMLHDIAQTVPTWSKVTTGLIKMYRVEVLNKFPVVQHFWFG 303
           C +I F+  VK+G F++HS ML+DIA TV TWSKV +GL+KMY VEVL KFPVVQHFWFG
Sbjct: 247 CQAIDFIFHVKSGPFSEHSSMLYDIASTVQTWSKVQSGLLKMYYVEVLKKFPVVQHFWFG 306

Query: 304 TGFFPWVDMAHGMSLPNYE-APSETSE 329
            GF+PW+   +G  LP YE A SE  +
Sbjct: 307 PGFYPWISDRNGQKLPIYENAESEKKQ 333

>Kwal_55.19661 s55 (69740..70855) [1116 bp, 371 aa] {ON} YIL153W
           (RRD1) - Resistant to Rapamycin Deletion [contig 159]
           FULL
          Length = 371

 Score =  382 bits (982), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 179/326 (54%), Positives = 227/326 (69%), Gaps = 2/326 (0%)

Query: 2   EFSVEGTQFSPPVKRIFDTAGTHDFQKSLTMYRLQSHLERYLKLVQGQKIPKSSQNRAVV 61
           +  V  T F+ PVKRIFD+ GTH FQ S+ M RL+ HL +YL ++ GQ+IP  + N  V+
Sbjct: 5   QIDVGTTTFTEPVKRIFDSRGTHVFQSSVAMIRLKKHLHKYLGMLSGQRIPSETSNPNVI 64

Query: 62  RFVCILERLDALMDETPPRTGSARRFGDLACRDWHDRMQGELDGLLETLLPEAARRSAAE 121
               IL     L+DETP   G  RR+G+LACRDWHD+M+ ++   L+  LPE    S  E
Sbjct: 65  SLRKILHFFSKLVDETPALPG-PRRYGNLACRDWHDKMEEQIREQLQEFLPEKYYPSIVE 123

Query: 122 LRYYLGSAFGSRERLDYGTGHELAFLAVVVALDMLGLWTEDKFTGEDMLYVWARYYALVH 181
           L YYLG+AFGSRERLDYGTGHEL+F +V+ ALDMLG+W    F  +D+LY++  YY+LV 
Sbjct: 124 LAYYLGNAFGSRERLDYGTGHELSFFSVICALDMLGIWGSG-FQAKDLLYLFNEYYSLVR 182

Query: 182 RLILTYNLEPAGSHGVWGLDDHLHLAYILGASQWAQDRNVPMQPSDILDPKAVARYSETN 241
           +LI  Y+LEPAGSHGVWGLDDH HL YI GASQWA  ++    P +I     V  Y+ +N
Sbjct: 183 KLITKYSLEPAGSHGVWGLDDHFHLIYIFGASQWADSKDAEASPREIQSKMIVDEYAGSN 242

Query: 242 LYCNSIAFLLRVKTGHFAQHSPMLHDIAQTVPTWSKVTTGLIKMYRVEVLNKFPVVQHFW 301
            YC +I+F+ +VK+G F++HSPML+DI+++VPTWSKV  GL+KMY  EVLNKFPVVQHFW
Sbjct: 243 FYCQAISFIFKVKSGPFSEHSPMLYDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQHFW 302

Query: 302 FGTGFFPWVDMAHGMSLPNYEAPSET 327
           FGT  FPW     G  LP YE   ET
Sbjct: 303 FGTALFPWTSTDGGDVLPTYEVSQET 328

>Kpol_2001.77 s2001 complement(211870..213111) [1242 bp, 413 aa]
           {ON} complement(211870..213111) [1242 nt, 414 aa]
          Length = 413

 Score =  365 bits (938), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 172/327 (52%), Positives = 229/327 (70%), Gaps = 12/327 (3%)

Query: 6   EGTQFSPPVKRIFDTAGTHDFQKSLTMYRLQSHLERYLKLVQGQKIPKSS---QNRAVVR 62
           E  +F  PVKRI+D+ GT  FQ S+ ++RL+  + +Y+KLV    IP  S   +   V +
Sbjct: 11  EPIEFCLPVKRIYDSQGTSLFQSSVAIFRLKYFISKYIKLVPNVDIPDESYVSEIPTVNK 70

Query: 63  FVCILERLDALMDETPPRTGSARRFGDLACRDWHDRMQGELDGLLETLLPE-------AA 115
            V ++  L  L+DETPP  G  RRFG+L+CR+WH ++   L  LL  +L +         
Sbjct: 71  LVKLISELSLLVDETPPAPG-PRRFGNLSCREWHKKVDLNLKSLLMKMLTDDKQNISSKC 129

Query: 116 RRSAAELRYYLGSAFGSRERLDYGTGHELAFLAVVVALDMLGLWTEDKFTGEDMLYVWAR 175
           + S  EL YYLG++FGS  RLDYGTGHEL+F+AV+  +DMLGLWTE+   G D+L ++  
Sbjct: 130 KDSVVELSYYLGNSFGSSTRLDYGTGHELSFIAVIAGIDMLGLWTEN-IKGGDLLIIFNE 188

Query: 176 YYALVHRLILTYNLEPAGSHGVWGLDDHLHLAYILGASQWAQDRNVPMQPSDILDPKAVA 235
           YY L+ +LILTY LEPAGSHGVWGLDDH H AYILG++QW++  N P++P DI++   V 
Sbjct: 189 YYKLMKKLILTYTLEPAGSHGVWGLDDHFHFAYILGSAQWSETNNPPLKPMDIVNKDLVC 248

Query: 236 RYSETNLYCNSIAFLLRVKTGHFAQHSPMLHDIAQTVPTWSKVTTGLIKMYRVEVLNKFP 295
            Y+ TN+YC++I F+  VK+G F++HSPML+DI+Q+V  WSKV +GL+KMY VEVLNKFP
Sbjct: 249 EYANTNMYCSAIKFIDCVKSGPFSEHSPMLYDISQSVHNWSKVESGLLKMYMVEVLNKFP 308

Query: 296 VVQHFWFGTGFFPWVDMAHGMSLPNYE 322
           VVQHFWFGTG FPW+D     SLP YE
Sbjct: 309 VVQHFWFGTGLFPWIDNNTKKSLPLYE 335

>NCAS0G00200 Chr7 (29159..30475) [1317 bp, 438 aa] {ON} Anc_5.709
          Length = 438

 Score =  363 bits (933), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 180/340 (52%), Positives = 232/340 (68%), Gaps = 17/340 (5%)

Query: 3   FSVEGTQFSPPVKRIFDTAGTHDFQKSLTMYRLQSHLERYLKLVQGQKIPKS---SQNRA 59
             ++ TQFS P KRIFD+  T DFQ S+ + RL+  L++Y+ +V   + P     S    
Sbjct: 33  LDLKTTQFSLPAKRIFDSQTTQDFQSSIALNRLRFFLQKYISMVTNVQTPPEGTLSSVTL 92

Query: 60  VVRFVCILERLDALMDETPPRTGSARRFGDLACRDWHDRMQGELDGLLETLL----PEAA 115
           V   V +L  L  L+DETPP  G  RR+G+LACRDWH +M+ +L  LL  +L    P+ +
Sbjct: 93  VNSIVQLLNHLSTLIDETPPLVG-PRRYGNLACRDWHTKMEAQLPALLNEILDPYLPKVS 151

Query: 116 RRSAA------ELRYYLGSAFGSRERLDYGTGHELAFLAVVVALDMLGLWTEDKFTGEDM 169
             S++      EL YY+ +AFGS  RLD+GTGHEL+F+A + A+DMLGLWT D   G D+
Sbjct: 152 GESSSMHPCIQELNYYISNAFGSSTRLDFGTGHELSFMAFIAAIDMLGLWT-DGMQGTDI 210

Query: 170 LYVWARYYALVHRLILTYNLEPAGSHGVWGLDDHLHLAYILGASQWAQDRNVPMQPSDIL 229
           L ++  YYALV +LILTY LEPAGSHGVWGLDDH HLAYILG+SQW   RN PM+P D+ 
Sbjct: 211 LLLFNTYYALVRKLILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWI--RNAPMRPRDVK 268

Query: 230 DPKAVARYSETNLYCNSIAFLLRVKTGHFAQHSPMLHDIAQTVPTWSKVTTGLIKMYRVE 289
           D   V +Y+++NLYC  IAF+ +VK+G F++HSP+L+DIA +V TWSKV  GLIKMY  E
Sbjct: 269 DISLVKQYAKSNLYCQCIAFIFQVKSGPFSEHSPILYDIATSVTTWSKVQRGLIKMYMDE 328

Query: 290 VLNKFPVVQHFWFGTGFFPWVDMAHGMSLPNYEAPSETSE 329
           VL KFPVVQHFWFG GF+PW++   G  LP YE   E  E
Sbjct: 329 VLKKFPVVQHFWFGDGFYPWINQHTGKPLPIYEHSPEDDE 368

>CAGL0H06655g Chr8 complement(661713..662987) [1275 bp, 424 aa] {ON}
           similar to uniprot|P40454 Saccharomyces cerevisiae
           YIL153w RRD1
          Length = 424

 Score =  362 bits (929), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 173/323 (53%), Positives = 231/323 (71%), Gaps = 8/323 (2%)

Query: 10  FSPPVKRIFDTAGTHDFQKSLTMYRLQSHLERYLKLVQGQKIPKSSQNRAVVRFVCILER 69
           FS PVKRI+D+ G + FQ S  + RL+  + +Y  LV+ + +     +  V   V +L+R
Sbjct: 2   FSEPVKRIYDSQGAYYFQSSEAIRRLEGAIVKYTDLVESRDVADLELSGVVGGVVKVLDR 61

Query: 70  LDALMDETPPRTGSARRFGDLACRDWHDRMQGELDGLLETLLPE---AARRSAAELRYYL 126
           LD L+ ETPP  G  RR+G++ACRDWH++++ E+ GLLE L+     +  +   ELRYYL
Sbjct: 62  LDQLVSETPPIPG-PRRYGNMACRDWHEKIEREIPGLLEDLISSHFPSELQCVVELRYYL 120

Query: 127 GSAFGSRERLDYGTGHELAFLAVVVALDMLGLWTEDKFTGEDMLYVWARYYALVHRLILT 186
            ++FGS  RLD+GTGHEL+FLA V ALDMLG      F G+ +LY++ RYY+LVHRLIL+
Sbjct: 121 ANSFGSATRLDFGTGHELSFLATVAALDMLGA----SFDGDQVLYIFDRYYSLVHRLILS 176

Query: 187 YNLEPAGSHGVWGLDDHLHLAYILGASQWAQDRNVPMQPSDILDPKAVARYSETNLYCNS 246
           Y LEPAGSHGVWGLDDH HLAYILG+SQW   + + M+P+D+ DP  V +YS TN++C +
Sbjct: 177 YTLEPAGSHGVWGLDDHFHLAYILGSSQWCNRKKLAMEPNDLSDPVLVEQYSRTNIFCKT 236

Query: 247 IAFLLRVKTGHFAQHSPMLHDIAQTVPTWSKVTTGLIKMYRVEVLNKFPVVQHFWFGTGF 306
           + F+  VK+G F +HSPML DI+++V TW+KV  GL KMY+ EVLNKFPV+QHFWFGTGF
Sbjct: 237 LNFVFTVKSGAFREHSPMLFDISRSVRTWAKVRKGLWKMYKDEVLNKFPVIQHFWFGTGF 296

Query: 307 FPWVDMAHGMSLPNYEAPSETSE 329
           +PWVD  +G  LPNYE   +  E
Sbjct: 297 YPWVDYKNGKPLPNYENSPDIDE 319

>ZYRO0B16478g Chr2 complement(1336755..1337930) [1176 bp, 391 aa]
           {ON} similar to uniprot|P40454 Saccharomyces cerevisiae
           YIL153W RRD1 Resistant to Rapamycin Deletion
          Length = 391

 Score =  359 bits (921), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 172/318 (54%), Positives = 227/318 (71%), Gaps = 3/318 (0%)

Query: 6   EGTQFSPPVKRIFDTAGTHDFQKSLTMYRLQSHLERYLKLVQGQKIPKSSQNRAVVR-FV 64
           E TQF+ PVKRIFD+  T +FQ S+ + RL+  +++Y K++    IP+     +VV  FV
Sbjct: 7   ENTQFNTPVKRIFDSQCTLEFQASVAIVRLKYFIQKYAKIINRVNIPQGPSRISVVNEFV 66

Query: 65  CILERLDALMDETPPRTGSARRFGDLACRDWHDRMQGELDGLLETLLPEAARRSAAELRY 124
            +L  +  L+D+TPP  G  RR+G+LACRDWH ++  ++  L   +LP+       EL +
Sbjct: 67  GVLNHMSLLVDQTPPLEGP-RRYGNLACRDWHAKIDEQMPSLWRKVLPDRFHHCIVELVH 125

Query: 125 YLGSAFGSRERLDYGTGHELAFLAVVVALDMLGLWTEDKFTGEDMLYVWARYYALVHRLI 184
           YLG++FGS  RLDYGTGHEL+FLAVV A+DMLGL+T D+F GED L +   YYA+V +LI
Sbjct: 126 YLGNSFGSATRLDYGTGHELSFLAVVGAIDMLGLFT-DEFQGEDFLLIMNAYYAVVRKLI 184

Query: 185 LTYNLEPAGSHGVWGLDDHLHLAYILGASQWAQDRNVPMQPSDILDPKAVARYSETNLYC 244
           LTY LEPAGSHGVWGLDDH HLAY+ G++QWA  +  P++P DIL+   V  Y+  NLYC
Sbjct: 185 LTYTLEPAGSHGVWGLDDHFHLAYVFGSAQWANYKEAPLRPRDILNHHLVQEYAHLNLYC 244

Query: 245 NSIAFLLRVKTGHFAQHSPMLHDIAQTVPTWSKVTTGLIKMYRVEVLNKFPVVQHFWFGT 304
            +I F+ +VK G F +HS ML+D+A TV TW+K+ +GL+KMY VEVLNKFPVVQHFWFGT
Sbjct: 245 QTIGFIYQVKRGPFREHSSMLYDLATTVHTWAKLESGLMKMYAVEVLNKFPVVQHFWFGT 304

Query: 305 GFFPWVDMAHGMSLPNYE 322
           GF+PWVD   G  L  Y+
Sbjct: 305 GFYPWVDNQTGKQLLIYD 322

>KLLA0A00462g Chr1 (38766..39827) [1062 bp, 353 aa] {ON} similar to
           uniprot|P40454 Saccharomyces cerevisiae YIL153W RRD1
           Resistant to Rapamycin Deletion
          Length = 353

 Score =  355 bits (910), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 170/330 (51%), Positives = 230/330 (69%), Gaps = 7/330 (2%)

Query: 1   MEFSVEGTQFSPPVKRIFDTAGTHDFQKSLTMYRLQSHLERYLKLVQGQKIPKSSQNRAV 60
           M+F  E  +FS P KRIFD+ GT DFQ S+ M R+Q HL++Y+ L +GQ+IP + +    
Sbjct: 1   MDFDYENAKFSMPEKRIFDSQGTLDFQNSVAMVRIQYHLQKYITLCKGQQIPDTIKESFF 60

Query: 61  VRFVC-ILERLDALMDETPPRTGSARRFGDLACRDWHDRMQGELDGLLETLLPEAARRSA 119
              V  +L+RL AL+DETPP    +R +G+L+ RDW  + Q +L+  L  LLPE    S 
Sbjct: 61  TNIVVELLKRLSALIDETPPERMHSR-YGNLSYRDWQTKFQNQLENWLHELLPEKYNNSI 119

Query: 120 AELRYYLGSAFGSRERLDYGTGHELAFLAVVVALDMLGLWTEDKFTGEDMLYVWARYYAL 179
            EL YY+ +AFGS+ER+DYGTGHEL+FLAV++ LDML + T     G  +LY +  YY +
Sbjct: 120 IELSYYISNAFGSKERIDYGTGHELSFLAVIICLDMLKIET---IKGPALLYCFNSYYDV 176

Query: 180 VHRLILTYNLEPAGSHGVWGLDDHLHLAYILGASQWAQDRNVPMQPSDILDPKAVARYSE 239
           + +LILTY LEPAGSHGVWGLDDH H +YILGA+Q   D N  + P DI + + + + S 
Sbjct: 177 IQKLILTYKLEPAGSHGVWGLDDHFHFSYILGATQLL-DVNTSLIPKDISNTRLMEQNSS 235

Query: 240 TNLYCNSIAFLLRVKTGHFAQHSPMLHDIAQTVPTWSKVTTGLIKMYRVEVLNKFPVVQH 299
           +NL+C SI F+  VK+G F+ HSP+L++I+++V TW K+  GLIKMY+VEVLNKFPVVQH
Sbjct: 236 SNLFCKSIRFINVVKSGPFSNHSPLLYNISRSVHTWHKMQQGLIKMYKVEVLNKFPVVQH 295

Query: 300 FWFGTGFFPWVDMAHGMSLPNYEAPSETSE 329
           FWFGT FFPW    +  SLP Y+ P+E ++
Sbjct: 296 FWFGTAFFPWTSYGNNHSLPIYQ-PAENND 324

>Suva_9.35 Chr9 (49860..51041) [1182 bp, 393 aa] {ON} YIL153W (REAL)
          Length = 393

 Score =  353 bits (905), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 172/324 (53%), Positives = 219/324 (67%), Gaps = 8/324 (2%)

Query: 10  FSPPVKRIFDTAGTHDFQKSLTMYRLQSHLERYLKLVQGQKIPKSSQNRAVVRFV----C 65
           FS PVKRIFDT  T DFQ SL ++R++ HL +Y  L+     P      + +  V     
Sbjct: 13  FSTPVKRIFDTQTTQDFQSSLAIHRIKYHLHKYTTLMSHCADPDPHATASSIPMVNGLMA 72

Query: 66  ILERLDALMDETPPRTGSARRFGDLACRDWHDRMQGELDGLLETLLPEAARRSAAELRYY 125
           +L+R   L+D+TPP  G  RR+G+LACR+WH ++   L   L  +LP        EL+YY
Sbjct: 73  VLDRFAQLIDDTPPLPG-PRRYGNLACREWHYKLDAHLAQWLREVLPAQYHAVVPELQYY 131

Query: 126 LGSAFGSRERLDYGTGHELAFLAVVVALDMLGLWTEDKFTGEDMLYVWARYYALVHRLIL 185
           LG++FGS  RLDYGTGHEL+F+A V ALD+LGL+      G D+  ++++YYA++ RLIL
Sbjct: 132 LGNSFGSSTRLDYGTGHELSFMATVAALDLLGLFPH--LRGTDVFLLFSKYYAIMRRLIL 189

Query: 186 TYNLEPAGSHGVWGLDDHLHLAYILGASQWAQ-DRNVPMQPSDILDPKAVARYSETNLYC 244
           TY LEPAGSHGVWGLDDH HL YILG+SQW   D   P+QP D+LD   V  Y +TN YC
Sbjct: 190 TYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPRDVLDKSLVREYQDTNFYC 249

Query: 245 NSIAFLLRVKTGHFAQHSPMLHDIAQTVPTWSKVTTGLIKMYRVEVLNKFPVVQHFWFGT 304
             I F+ +VK G F +HSP+L+DIA TVP WSKV  GL+KMY VEVL KFPVVQHFWFGT
Sbjct: 250 QGINFINQVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLQKFPVVQHFWFGT 309

Query: 305 GFFPWVDMAHGMSLPNYEAPSETS 328
           GFFPW+++ +G  LP +E   E S
Sbjct: 310 GFFPWINVQNGTDLPVFEEKEEES 333

>YIL153W Chr9 (55198..56379) [1182 bp, 393 aa] {ON}
           RRD1Peptidyl-prolyl cis/trans-isomerase; activator of
           the phosphotyrosyl phosphatase activity of PP2A;
           involved in G1 phase progression, microtubule dynamics,
           bud morphogenesis and DNA repair; required for rapid
           reduction of Sgs1p levels in response to rapamycin;
           subunit of the Tap42p-Sit4p-Rrd1p complex
          Length = 393

 Score =  348 bits (892), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 170/317 (53%), Positives = 216/317 (68%), Gaps = 8/317 (2%)

Query: 10  FSPPVKRIFDTAGTHDFQKSLTMYRLQSHLERYLKLVQGQKIPKSSQNRAVVRFVC---- 65
           FS PVKRIFDT  T DFQ SL ++R++ HL +Y  L+     P      + +  V     
Sbjct: 13  FSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLISHCSDPDPHATASSIAMVNGLMG 72

Query: 66  ILERLDALMDETPPRTGSARRFGDLACRDWHDRMQGELDGLLETLLPEAARRSAAELRYY 125
           +L++L  L+DETPP  G  RR+G+LACR+WH ++   L   L+ +LP        EL+YY
Sbjct: 73  VLDKLAHLIDETPPLPG-PRRYGNLACREWHHKLDERLPQWLQEMLPSEYHEVVPELQYY 131

Query: 126 LGSAFGSRERLDYGTGHELAFLAVVVALDMLGLWTEDKFTGEDMLYVWARYYALVHRLIL 185
           LG++FGS  RLDYGTGHEL+F+A V ALDMLG++   +  G D+  ++ +YY ++ RLIL
Sbjct: 132 LGNSFGSSTRLDYGTGHELSFMATVAALDMLGMFPHMR--GADVFLLFNKYYTIMRRLIL 189

Query: 186 TYNLEPAGSHGVWGLDDHLHLAYILGASQWAQ-DRNVPMQPSDILDPKAVARYSETNLYC 244
           TY LEPAGSHGVWGLDDH HL YILG+SQW   D   P+QP +ILD   V  Y +TN YC
Sbjct: 190 TYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVREYKDTNFYC 249

Query: 245 NSIAFLLRVKTGHFAQHSPMLHDIAQTVPTWSKVTTGLIKMYRVEVLNKFPVVQHFWFGT 304
             I F+  VK G F +HSP+L+DIA TVP WSKV  GL+KMY VEVL KFPVVQHFWFGT
Sbjct: 250 QGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPVVQHFWFGT 309

Query: 305 GFFPWVDMAHGMSLPNY 321
           GFFPWV++ +G  LP +
Sbjct: 310 GFFPWVNIQNGTDLPVF 326

>NDAI0F00240 Chr6 (46047..47441) [1395 bp, 464 aa] {ON} Anc_5.709
          Length = 464

 Score =  350 bits (897), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 173/328 (52%), Positives = 224/328 (68%), Gaps = 11/328 (3%)

Query: 5   VEGTQFSPPVKRIFDTAGTHDFQKSLTMYRLQSHLERYLKLVQGQKIPKS-----SQNRA 59
           ++ T FS PVKRIFD+  T DFQ S+ + RL+  L+RY++LV   +IP       S+   
Sbjct: 16  LKATNFSLPVKRIFDSQTTQDFQSSIALQRLRFFLQRYIELVANVEIPPHPDSYVSEILM 75

Query: 60  VVRFVCILERLDALMDETPPRTGSARRFGDLACRDWHDRMQGELDGLLETLLPEA-ARRS 118
           V   + +L  L  ++ +TPP  G  RR+G+LACRDWH +++ EL  LLE  +P    + S
Sbjct: 76  VNSIIHLLNELSTIVQDTPPLKG-PRRYGNLACRDWHSKIEVELPKLLEKAIPSPDLQPS 134

Query: 119 AAELRYYLGSAFGSRERLDYGTGHELAFLAVVVALDMLGLWTEDKFTGEDMLYVWARYYA 178
             EL YY+ ++FGS  RLDYGTGHEL+F+A + ALDMLGL+ +   TG+D+L ++  YY+
Sbjct: 135 IIELNYYIANSFGSSTRLDYGTGHELSFMAFIAALDMLGLFPD--LTGKDLLIMFNAYYS 192

Query: 179 LVHRLILTYNLEPAGSHGVWGLDDHLHLAYILGASQWAQDRNVPMQPSDILDPKAVARYS 238
           LV  LILTY LEPAGSHGVWGLDDH HLAYILG+SQW    N P+ P +I + + V  YS
Sbjct: 193 LVRELILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWLN--NAPLTPKEITNSRLVKDYS 250

Query: 239 ETNLYCNSIAFLLRVKTGHFAQHSPMLHDIAQTVPTWSKVTTGLIKMYRVEVLNKFPVVQ 298
             NLYC  I F+L VK+G FA+HSP+L+DI+ +V  W KV  GLIKMY  EVLNKFPVVQ
Sbjct: 251 TKNLYCQCIEFVLTVKSGPFAEHSPILYDISTSVSAWRKVQRGLIKMYMDEVLNKFPVVQ 310

Query: 299 HFWFGTGFFPWVDMAHGMSLPNYEAPSE 326
           HFWFGTGF+PW++      LP YE   E
Sbjct: 311 HFWFGTGFYPWINFQTLRELPVYEHSPE 338

>Skud_9.15 Chr9 (32255..33463) [1209 bp, 402 aa] {ON} YIL153W (REAL)
          Length = 402

 Score =  345 bits (886), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 174/327 (53%), Positives = 221/327 (67%), Gaps = 9/327 (2%)

Query: 10  FSPPVKRIFDTAGTHDFQKSLTMYRLQSHLERYLKLVQGQKIPK----SSQNRAVVRFVC 65
           FS PVKRIFDT  T DFQ SL ++R++ HL +Y  L+     P     SS    V   + 
Sbjct: 22  FSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCPDPDAHAASSSIAMVNGLMG 81

Query: 66  ILERLDALMDETPPRTGSARRFGDLACRDWHDRMQGELDGLLETLLPEAARRSAAELRYY 125
           +L++L  L+DETPP  G  RR+G+LACR+WH ++   L   L+ +LP        EL+YY
Sbjct: 82  VLDKLAQLIDETPPLPG-PRRYGNLACREWHYKLDEHLSQWLQEMLPAEYHVVVPELQYY 140

Query: 126 LGSAFGSRERLDYGTGHELAFLAVVVALDMLGLWTEDKFTGEDMLYVWARYYALVHRLIL 185
           LG++FGS  RLDYGTGHEL+F+A V ALD+LG++      G D+  ++ +YY ++ RLIL
Sbjct: 141 LGNSFGSSTRLDYGTGHELSFMATVAALDLLGVFPH--LRGNDVFLLFNKYYTIMRRLIL 198

Query: 186 TYNLEPAGSHGVWGLDDHLHLAYILGASQWAQ-DRNVPMQPSDILDPKAVARYSETNLYC 244
           TY LEPAGSHGVWGLDDH HL YILG+SQW   D   P+QP ++LD   V  Y +TN YC
Sbjct: 199 TYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDARAPLQPREVLDKSLVHDYKDTNFYC 258

Query: 245 NSIAFLLRVKTGHFAQHSPMLHDIAQTVPTWSKVTTGLIKMYRVEVLNKFPVVQHFWFGT 304
             I F+  VK G F +HSP+L+DIA TVP WSKV  GL+KMY VEVL KFPVVQHFWFGT
Sbjct: 259 QGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPVVQHFWFGT 318

Query: 305 GFFPWVDMAHGMSLPNY-EAPSETSEK 330
           GFFPWV++ +G  LP + E   ET E+
Sbjct: 319 GFFPWVNIQNGTDLPVFEEKEDETIEQ 345

>Smik_9.16 Chr9 (32798..33979) [1182 bp, 393 aa] {ON} YIL153W (REAL)
          Length = 393

 Score =  341 bits (874), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 168/317 (52%), Positives = 214/317 (67%), Gaps = 8/317 (2%)

Query: 10  FSPPVKRIFDTAGTHDFQKSLTMYRLQSHLERYLKLVQGQKIPKSSQNRAVVR----FVC 65
           FS PVKRIFDT  T DFQ SL ++R++ HL +Y  L+     P      + +      + 
Sbjct: 13  FSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCADPDPQAVASSIPMDNGLMQ 72

Query: 66  ILERLDALMDETPPRTGSARRFGDLACRDWHDRMQGELDGLLETLLPEAARRSAAELRYY 125
           +L++L  L+DETPP  G  RR+G+LACR+WH ++   L   L  +LP        EL+YY
Sbjct: 73  VLDKLAHLIDETPPLPG-PRRYGNLACREWHHKLDERLPQWLREMLPPEYHVVVPELQYY 131

Query: 126 LGSAFGSRERLDYGTGHELAFLAVVVALDMLGLWTEDKFTGEDMLYVWARYYALVHRLIL 185
           LG++FGS  RLDYGTGHEL+F+A V ALD+LG++      G D+  ++ +YY ++ RLIL
Sbjct: 132 LGNSFGSSTRLDYGTGHELSFMATVTALDLLGMFPH--LRGTDVFLLFNKYYTIMRRLIL 189

Query: 186 TYNLEPAGSHGVWGLDDHLHLAYILGASQWAQ-DRNVPMQPSDILDPKAVARYSETNLYC 244
           TY LEPAGSHGVWGLDDH HL YILG+SQW   D   P+QP +ILD   V  Y  TN YC
Sbjct: 190 TYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVREYKNTNFYC 249

Query: 245 NSIAFLLRVKTGHFAQHSPMLHDIAQTVPTWSKVTTGLIKMYRVEVLNKFPVVQHFWFGT 304
             I F+  VK G F +HSP+L+DIA TVP WSKV  GL+KMY VEVL KFPVVQHFWFGT
Sbjct: 250 QGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPVVQHFWFGT 309

Query: 305 GFFPWVDMAHGMSLPNY 321
           GFFPWV++ +G +LP +
Sbjct: 310 GFFPWVNIQNGTNLPVF 326

>TPHA0D04650 Chr4 complement(1015658..1016923) [1266 bp, 421 aa]
           {ON} Anc_5.709 YIL153W
          Length = 421

 Score =  333 bits (853), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 160/324 (49%), Positives = 219/324 (67%), Gaps = 16/324 (4%)

Query: 3   FSVEGTQFSPPVKRIFDTAGTHDFQKSLTMYRLQSHLERYLKLVQGQKIPK---SSQNRA 59
            +++   FS P+KRI+D+  T  FQ S+ +YRL+ +L +Y+ +V   +IP     S+   
Sbjct: 7   INIKEQSFSLPLKRIYDSQSTFTFQSSIAIYRLKYYLHKYINMVHNVEIPDLTYVSEITI 66

Query: 60  VVRFVCILERLDALMDETPPRTGSARRFGDLACRDWHDRMQGELDGLLETLLP------- 112
           V     +L  L   +D  PP  G  RR+G+LACR+WH  +  ++  LLE +L        
Sbjct: 67  VNEMSSLLTELSNDIDTIPPFEG-PRRYGNLACRNWHSLIDSKVPLLLEKVLGCSNHATE 125

Query: 113 ----EAARRSAAELRYYLGSAFGSRERLDYGTGHELAFLAVVVALDMLGLWTEDKFTGED 168
               E  +    EL YYL ++ GS  RLDYGTGHEL+FLAV+ A+DMLGLWTE+ F G D
Sbjct: 126 KGEFEKLKGCIIELNYYLCNSLGSATRLDYGTGHELSFLAVIAAMDMLGLWTEN-FKGVD 184

Query: 169 MLYVWARYYALVHRLILTYNLEPAGSHGVWGLDDHLHLAYILGASQWAQDRNVPMQPSDI 228
           +L+++  YY LV +LI+TY LEPAGSHGVWGLDDH HL+YILG+SQ +++ N P  PSDI
Sbjct: 185 LLHMFHCYYELVKKLIVTYTLEPAGSHGVWGLDDHFHLSYILGSSQLSENPNPPFSPSDI 244

Query: 229 LDPKAVARYSETNLYCNSIAFLLRVKTGHFAQHSPMLHDIAQTVPTWSKVTTGLIKMYRV 288
           ++ K V  Y   N YC +I F+ +VK+G F++HSP+L+DI+ TV +W KV +GL+KMY V
Sbjct: 245 INKKIVTEYMHKNFYCYTIDFIYKVKSGPFSEHSPILYDISTTVNSWLKVNSGLVKMYMV 304

Query: 289 EVLNKFPVVQHFWFGTGFFPWVDM 312
           EVLNKFPVVQHFWFG GF+PW ++
Sbjct: 305 EVLNKFPVVQHFWFGEGFYPWKNV 328

>TBLA0E01690 Chr5 (406884..408350) [1467 bp, 488 aa] {ON} Anc_5.709
           YIL153W
          Length = 488

 Score =  330 bits (846), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 160/341 (46%), Positives = 217/341 (63%), Gaps = 25/341 (7%)

Query: 10  FSPPVKRIFDTAGTHDFQKSLTMYRLQSHLERYLKLVQGQKIPKS---SQNRAVVRFVCI 66
           FS P K+IFD+ GT  F +S+  +R+Q  + +Y +L+Q + IP +   S N  +     I
Sbjct: 15  FSAPTKQIFDSQGTQYFNRSIAFHRIQYFISKYTQLIQEENIPPTDYTSSNDTISGVSKI 74

Query: 67  LERLDALMDETPPRTGSARRFGDLACRDWHDRMQGELDGLLETLLPEAARRSAA-----E 121
           +  L  L++ETPP  G  RR+G+L+CR WH R+   ++ L E  L  +  +        E
Sbjct: 75  INDLIKLVEETPPLPG-PRRYGNLSCRQWHKRVDDNINELFEKYLTISNTKFNKDQLFLE 133

Query: 122 LRYYLGSAFGSRERLDYGTGHELAFLAVVVALDMLGLWTEDKFTGEDMLYVWARYYALVH 181
           L YY  ++ GS  RLDYGTGHEL+FLA + ALDML L T+   +G D+L+++  YY L+ 
Sbjct: 134 LIYYFNASLGSPTRLDYGTGHELSFLAFIGALDMLNLLTD--ISGTDILFIFNEYYRLIR 191

Query: 182 RLILTYNLEPAGSHGVWGLDDHLHLAYILGASQWAQDR-------------NVPMQPSDI 228
           +LIL Y LEPAGSHGVWGLDDH HL YI G+SQW  +                P++P DI
Sbjct: 192 KLILNYTLEPAGSHGVWGLDDHFHLIYIFGSSQWCPENADMTEPSISEPKFKAPIKPVDI 251

Query: 229 LDPKAVARYSETNLYCNSIAFLLRVKTGHFAQHSPMLHDIAQTVPTWSKVTTGLIKMYRV 288
           L+   + ++  +N YC SI F+L VKTG F +HSP+L DIA+ V  W KV +GL+KMY V
Sbjct: 252 LNKNLIEKFKSSNFYCQSILFILTVKTGPFPEHSPILFDIAKNVHNWKKVRSGLLKMYMV 311

Query: 289 EVLNKFPVVQHFWFGTGFFPWVDMAHGMSLPNYE-APSETS 328
           EVLNKFPVVQHFWFGTGF+PW++ +  M LP YE AP + +
Sbjct: 312 EVLNKFPVVQHFWFGTGFYPWINSSTLMKLPTYELAPDDNN 352

>KAFR0D02190 Chr4 (439664..440944) [1281 bp, 426 aa] {ON} Anc_5.709
           YIL153W
          Length = 426

 Score =  325 bits (834), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 159/322 (49%), Positives = 209/322 (64%), Gaps = 10/322 (3%)

Query: 7   GTQFSPPVKRIFDTAGTHDFQKSLTMYRLQSHLERYLKLVQGQKIPKSSQ-NRAVVRFVC 65
            ++FS P KRIFD+  T  FQ S+  YRL+    +Y+ LV+G  +P S      + R++ 
Sbjct: 14  ASKFSIPAKRIFDSQTTQYFQHSVANYRLKYFTNKYINLVRGVPLPVSRNITMTITRYIL 73

Query: 66  -ILERLDALMDETPPRTGSARRFGDLACRDWHDRMQGELDGLLETLLPEAA----RRSAA 120
            +L++    +DETPP     RRFG+L+CR WHD++   L G L+T++   +         
Sbjct: 74  DLLDKCSQFIDETPPLI-EPRRFGNLSCRTWHDKINSYLPGELKTIIDNFSTIENENMFN 132

Query: 121 ELRYYLGSAFGSRERLDYGTGHELAFLAVVVALDMLGLWTEDKFTGEDMLYVWARYYALV 180
           EL YYL ++FGS+ RLDYGTGHEL+FLA +  +DM+ +  +   T +D L +W  YY L 
Sbjct: 133 ELNYYLLNSFGSKTRLDYGTGHELSFLAFISCIDMIRMLQD--MTADDFLLIWQSYYNLT 190

Query: 181 HRLILTYNLEPAGSHGVWGLDDHLHLAYILGASQWAQDRNVPMQPSDILDPKAVARYSET 240
            +LILTY LEPAGSHGVWGLDDH HLAYI G+SQ   D +  + P DIL    VA + E 
Sbjct: 191 RKLILTYTLEPAGSHGVWGLDDHFHLAYIFGSSQLISDISH-LAPKDILKKDVVAEHKEN 249

Query: 241 NLYCNSIAFLLRVKTGHFAQHSPMLHDIAQTVPTWSKVTTGLIKMYRVEVLNKFPVVQHF 300
           NLYC +I F+  VK G F +HSP+L+DI++ V +WSKV  GL+KMY  EVLNKFPVVQHF
Sbjct: 250 NLYCQAINFIFTVKKGPFNEHSPILYDISKNVKSWSKVLKGLLKMYNDEVLNKFPVVQHF 309

Query: 301 WFGTGFFPWVDMAHGMSLPNYE 322
           WFG GFFPW D   G  LP +E
Sbjct: 310 WFGDGFFPWKDNNSGKDLPVFE 331

>KNAG0L02170 Chr12 complement(388956..390146) [1191 bp, 396 aa] {ON}
           Anc_5.709 YIL153W
          Length = 396

 Score =  311 bits (798), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 161/331 (48%), Positives = 214/331 (64%), Gaps = 7/331 (2%)

Query: 1   MEFSVEGTQFSPPVKRIFDTAGTHDFQKSLTMYRLQSHLERYLKLVQGQKIPKSSQNRAV 60
           +   VE   F  P KRIFD+  T  FQ+S+ + R++ H+E+Y+++++G        + +V
Sbjct: 14  LPLDVEHAVFRQPQKRIFDSQTTATFQESVALARIRFHIEKYMRMMRGDT--SGGISASV 71

Query: 61  VRFVCILERLDALMDETPPRTGSARRFGDLACRDWHDRMQGELDGLLETLLPEAARRSAA 120
            R + IL+RLDAL+DETPP  G  RR+G+LACRDWHD++   L GL   +   A   +  
Sbjct: 72  ARMLQILDRLDALVDETPPLVG-PRRYGNLACRDWHDKVDSSLPGLTSQVDCLAGGGACI 130

Query: 121 ELRYYLGSAFGSRERLDYGTGHELAFLAVVVALDMLGLWTEDKFTGEDMLYVWARYYALV 180
           E  YYL ++FGS+ RLDYGTGHEL+FLA V ALDM+        T  ++  +W RYY LV
Sbjct: 131 EAEYYLRNSFGSKIRLDYGTGHELSFLAFVAALDMMS--QPRGITPVELSRLWDRYYRLV 188

Query: 181 HRLILTYNLEPAGSHGVWGLDDHLHLAYILGASQWAQDRNVPMQPSDILDPKAVARY-SE 239
            RLI+ YNLEPAGSHGVWGLDDH HLAY+ GASQ+A +  V +QP D+L      R  + 
Sbjct: 189 RRLIVDYNLEPAGSHGVWGLDDHFHLAYLWGASQFANN-PVGVQPRDVLSGVIPGRDDAP 247

Query: 240 TNLYCNSIAFLLRVKTGHFAQHSPMLHDIAQTVPTWSKVTTGLIKMYRVEVLNKFPVVQH 299
            N    +I F+  VK G F ++SPML+DI   V +W K+  GL +MY  EVLNKFPVVQH
Sbjct: 248 ANFLVEAIGFVKSVKHGPFWENSPMLNDILSGVSSWRKIQRGLFRMYNAEVLNKFPVVQH 307

Query: 300 FWFGTGFFPWVDMAHGMSLPNYEAPSETSEK 330
           FWFGT FFPW  +  G  LP YE  ++T ++
Sbjct: 308 FWFGTAFFPWTSVRDGTPLPVYEQSADTEQE 338

>ACR139C Chr3 complement(592864..593943) [1080 bp, 359 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL152W
           (RRD2)
          Length = 359

 Score =  175 bits (443), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 110/320 (34%), Positives = 175/320 (54%), Gaps = 18/320 (5%)

Query: 15  KRIFDTAGTHDFQKSLTMYRLQSHLERYLKLVQGQKIPKSSQ--NRAVVRFVCILERLDA 72
           KR+   +    ++ S T   L   +    + V+G++  + ++  + A+     +LE +  
Sbjct: 13  KRLLTGSDLDKWKASKTFEELLRFVSSLAQSVRGRENSEHAEPVSPAIEALEALLEEMQG 72

Query: 73  LMDETPP-RTGSARRFGDLACRDWHDRMQGELDGLLETLLPEAARRSAAELRYYLGSAFG 131
           +    P  +  +  RFG +  RD+H  +Q   + L+  + P      A EL  YLG+A+G
Sbjct: 73  IAAHHPVLQDAATSRFGKVEFRDFHKEVQARAEALVLQVDPSLTDEQAQELAVYLGNAWG 132

Query: 132 SRERLDYGTGHELAFLAVVVALDMLGLWTEDKFTGEDMLYVWARYYALVHRLILTYNLEP 191
             +R+DYG+GHEL F+  +  L   G+ +E  FT   +L V+ +Y  ++  L   Y LEP
Sbjct: 133 DCKRIDYGSGHELNFVCFLYGLWKYGVLSEHDFTNA-VLRVFVKYMDVMRVLETKYWLEP 191

Query: 192 AGSHGVWGLDDHLHLAYILGASQWAQDRNVPMQPSDILDPKAVARYSETNLYCNSIAFLL 251
           AGSHGVWGLDD+  L ++ GA Q A  ++  ++P  I +P+ V  +    LY   IAF+ 
Sbjct: 192 AGSHGVWGLDDYHFLPFLFGAFQLATHKH--LKPKSIHNPEVVELFENRYLYFGCIAFIN 249

Query: 252 RVKT-GHFAQHSPMLHDIAQTVPTWSKVTTGLIKMYRVEVLNKFPVVQHFWFGTGFFPWV 310
           RVKT      HSPML DI+  V +W+KV+ G++KMY+ EVL K P++QHF+F + F P  
Sbjct: 250 RVKTTASLRWHSPMLDDIS-GVRSWTKVSEGMVKMYKAEVLGKLPIMQHFFF-SRFLP-- 305

Query: 311 DMAHGMSLPNYEAPSETSEK 330
                  +P+  +P  TSE+
Sbjct: 306 -------VPDGVSPPRTSEE 318

>Kpol_1013.4 s1013 complement(5948..7024) [1077 bp, 358 aa] {ON}
           complement(5948..7024) [1077 nt, 359 aa]
          Length = 358

 Score =  175 bits (443), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 101/295 (34%), Positives = 165/295 (55%), Gaps = 7/295 (2%)

Query: 13  PVKRIFDTAGTHDFQKSLTMYRLQSHLERYLKLVQGQKIPKSSQ--NRAVVRFVCILERL 70
           P KR+        + KS T + L   +E+  K V+G +  +  +     +  F+ +L+ +
Sbjct: 3   PEKRLLTPEDLELWDKSQTKHDLLEFIEKLAKSVEGHENKQYQEPITPQIESFMGLLKSV 62

Query: 71  DALMDETPP-RTGSARRFGDLACRDWHDRMQGELDGLLETLLPEAARRSAAELRYYLGSA 129
           + ++D+ P  +   + RFG +  RD++D +  +   L+    P        +L  YL  +
Sbjct: 63  NNIIDKHPVVQDAKSSRFGKIEFRDFYDELTSQSKTLISNAYPSLTEDQLDQLYVYLDES 122

Query: 130 FGSRERLDYGTGHELAFLAVVVALDMLGLWTEDKFTGEDMLYVWARYYALVHRLILTYNL 189
           +G+++R+DYG+GHEL FL ++  L    ++ E K     +L ++  Y  ++  L   Y L
Sbjct: 123 WGNKQRIDYGSGHELNFLCLLYGLHKYKIFDESKDFTNMVLKIFIEYLRVMRILETKYWL 182

Query: 190 EPAGSHGVWGLDDHLHLAYILGASQWAQDRNVPMQPSDILDPKAVARYSETNLYCNSIAF 249
           EPAGSHGVWGLDD+  L ++ GA Q A  ++  ++P  I + + V  + +  LY + +AF
Sbjct: 183 EPAGSHGVWGLDDYHFLPFLFGAFQLATHKH--LKPLSIHNEELVEMFQDKYLYFSCVAF 240

Query: 250 LLRVKTGHFAQ-HSPMLHDIAQTVPTWSKVTTGLIKMYRVEVLNKFPVVQHFWFG 303
           +  VKT    + HSPML DI+  V  WSKV  G+IKMYR EVL+K P++QHF+FG
Sbjct: 241 INSVKTSTSLRFHSPMLDDIS-GVKKWSKVAEGMIKMYRAEVLSKLPIMQHFYFG 294

>KLTH0D11176g Chr4 complement(913077..914138) [1062 bp, 353 aa] {ON}
           similar to uniprot|Q12461 Saccharomyces cerevisiae
           YPL152W RRD2 Resistant to Rapamycin
          Length = 353

 Score =  167 bits (423), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 105/317 (33%), Positives = 164/317 (51%), Gaps = 11/317 (3%)

Query: 13  PVKRIFDTAGTHDFQKSLTMYRLQSHLERYLKLVQG-QKIPKSSQNRAVVRFVC-ILERL 70
           P KR+        +  S T   L S L    + V+G +         + +   C +LE +
Sbjct: 3   PQKRLLTQDDMDIWSHSETFNNLISFLSGLAESVKGLENNEYQKPTGSSIESCCQLLEEV 62

Query: 71  DALMDETPPRT-GSARRFGDLACRDWHDRMQGELDGLLETLLPEAARRSAAELRYYLGSA 129
            +L ++ P +      RFG +  R ++D ++ +  GL++            EL  Y   +
Sbjct: 63  ASLAEQYPVKQDAETSRFGKVEFRYFYDDLKSKSQGLIQRAFDALDGTQCEELSVYFAES 122

Query: 130 FGSRERLDYGTGHELAFLAVVVALDMLGLWTEDKFTGEDMLYVWARYYALVHRLILTYNL 189
           +G R R+DYG+GHEL FL  +  L   G++ E       +L ++ +Y  ++  L   Y L
Sbjct: 123 WGDRSRIDYGSGHELNFLCFLYGLKEFGVFKEPADYRNMVLKLFIKYLGVMRTLETKYWL 182

Query: 190 EPAGSHGVWGLDDHLHLAYILGASQWAQDRNVPMQPSDILDPKAVARYSETNLYCNSIAF 249
           EPAGSHGVWGLDD+  L ++ GA Q +  ++  ++P  I + + V  + +  LY   I F
Sbjct: 183 EPAGSHGVWGLDDYHFLPFLFGAFQLSTHKH--LKPKSIHNSEVVEMFGKRYLYFGCIDF 240

Query: 250 LLRVK-TGHFAQHSPMLHDIAQTVPTWSKVTTGLIKMYRVEVLNKFPVVQHFWFGTGFFP 308
           + +VK T     HSPML DI+  V TW+KV  G+IKMY+ EVLNK P++QHF+FG+    
Sbjct: 241 INKVKTTASLRWHSPMLDDIS-GVKTWAKVAEGMIKMYKAEVLNKLPIMQHFFFGS---- 295

Query: 309 WVDMAHGMSLPNYEAPS 325
           ++    G+S P   A S
Sbjct: 296 FLQCPEGISPPGTHAES 312

>CAGL0M02255g Chr13 (270614..271690) [1077 bp, 358 aa] {ON} highly
           similar to uniprot|Q12461 Saccharomyces cerevisiae
           YPL152w RRD2
          Length = 358

 Score =  166 bits (421), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 100/295 (33%), Positives = 160/295 (54%), Gaps = 7/295 (2%)

Query: 13  PVKRIFDTAGTHDFQKSLTMYRLQSHLERYLKLVQGQKIPKSSQ--NRAVVRFVCILERL 70
           P KRI        +++S T   + S +E   K V+G +  + S+  + +V   + +L  +
Sbjct: 3   PSKRILTDKDVKIWEESETREDILSFIESLAKAVEGFENDQVSEPVSDSVQSTIAVLTEI 62

Query: 71  DALMDETPP-RTGSARRFGDLACRDWHDRMQGELDGLLETLLPEAARRSAAELRYYLGSA 129
           D L+   P  +  +  RFG +  RD++D +  + D LL +  P        +L  YL  +
Sbjct: 63  DKLIKLHPVIQDKNTSRFGKVEFRDFYDDVCEKADDLLSSHFPALTSEQIEQLSIYLQES 122

Query: 130 FGSRERLDYGTGHELAFLAVVVALDMLGLWTEDKFTGEDMLYVWARYYALVHRLILTYNL 189
           +G++ R+DYG+GHEL F+  +  L    ++   +     +L ++  Y  ++  +   Y L
Sbjct: 123 WGNKRRIDYGSGHELNFICFLYGLTHYKIFDLQRDARNLVLVLFIEYLKIMREIETLYWL 182

Query: 190 EPAGSHGVWGLDDHLHLAYILGASQWAQDRNVPMQPSDILDPKAVARYSETNLYCNSIAF 249
           EPAGSHGVWGLDD+  L ++ GA Q A  ++  ++P  I + + V  +++  LY   IAF
Sbjct: 183 EPAGSHGVWGLDDYHFLPFLFGAFQLAPHKH--LKPKSIHNEELVEMFADKYLYFGCIAF 240

Query: 250 LLRVKTG-HFAQHSPMLHDIAQTVPTWSKVTTGLIKMYRVEVLNKFPVVQHFWFG 303
           +  VKT      HSPML DI+  V  WSKV  G+IKMY+ EVL K P++QHF+F 
Sbjct: 241 INSVKTSTSLRWHSPMLDDIS-GVKKWSKVAEGMIKMYKAEVLGKLPIMQHFYFS 294

>ZYRO0F07326g Chr6 complement(592906..593964) [1059 bp, 352 aa] {ON}
           highly similar to uniprot|Q12461 Saccharomyces
           cerevisiae YPL152W
          Length = 352

 Score =  166 bits (420), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 90/241 (37%), Positives = 144/241 (59%), Gaps = 5/241 (2%)

Query: 66  ILERLDALMDETPP-RTGSARRFGDLACRDWHDRMQGELDGLLETLLPEAARRSAAELRY 124
           +L++++ L+D+ P  +  +  RFG +  RD++D +Q   + L+ T  P   +    EL  
Sbjct: 58  LLKKVNDLIDKYPVIQDANTSRFGKVEFRDFYDDLQTHAEELVATTYPSLNKDQVEELAV 117

Query: 125 YLGSAFGSRERLDYGTGHELAFLAVVVALDMLGLWTEDKFTGEDMLYVWARYYALVHRLI 184
           YL  ++G++ R+DYG+GHEL F+  +  L +  ++  ++   + +L V+  Y  ++  L 
Sbjct: 118 YLYESWGNKRRIDYGSGHELNFVCFIYGLYVYKVFDLERDAADLVLKVFVEYLRIMRILE 177

Query: 185 LTYNLEPAGSHGVWGLDDHLHLAYILGASQWAQDRNVPMQPSDILDPKAVARYSETNLYC 244
             Y LEPAGSHGVWGLDD+  L ++ GA Q A   +  ++P  I + + V  + +  +Y 
Sbjct: 178 TKYWLEPAGSHGVWGLDDYHFLPFLFGAHQLATHPH--LRPKSIHNEEVVEMFMDKYIYF 235

Query: 245 NSIAFLLRVK-TGHFAQHSPMLHDIAQTVPTWSKVTTGLIKMYRVEVLNKFPVVQHFWFG 303
             IAF+  VK T     HSPML DI+  V TW+KV  G+IKMY+ EVL+K P++QHF+FG
Sbjct: 236 GCIAFINSVKSTASLRWHSPMLDDIS-GVKTWAKVAEGMIKMYKAEVLSKLPIMQHFYFG 294

Query: 304 T 304
            
Sbjct: 295 N 295

>TPHA0D01240 Chr4 complement(259089..260168) [1080 bp, 359 aa] {ON}
           Anc_8.674 YPL152W
          Length = 359

 Score =  166 bits (419), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 97/302 (32%), Positives = 166/302 (54%), Gaps = 13/302 (4%)

Query: 13  PVKRIFDTAGTHDFQKSLTMYRLQSHLERYLKLVQGQK-----IPKSSQNRAVVRFVCIL 67
           P KR+   A    + +S T   L + L++  K V+G++     +P S    ++++   +L
Sbjct: 3   PQKRLLTNADMEIWDRSQTQADLLNFLKQLAKSVEGKENTDYTLPISQPVESMMK---LL 59

Query: 68  ERLDALMDETPP-RTGSARRFGDLACRDWHDRMQGELDGLLETLLPEAARRSAAELRYYL 126
            ++ +++ + P  +   + RFG +  RD++D +  +   LL+   P        +L  Y+
Sbjct: 60  HKVQSILFKHPVVKDAHSSRFGKVEFRDFYDDLTSQSKTLLKECFPSLTDSQIEQLYVYV 119

Query: 127 GSAFGSRERLDYGTGHELAFLAVVVALDMLGLWTEDKFTGEDMLYVWARYYALVHRLILT 186
             ++G+++R+DYG+GHEL F+  +  L    ++  ++     +L V+ +Y  L+  L L 
Sbjct: 120 DESWGNKQRIDYGSGHELNFMCFIYGLTSFKIFDLERDATNLVLKVFIQYLKLMRVLELQ 179

Query: 187 YNLEPAGSHGVWGLDDHLHLAYILGASQWAQDRNVPMQPSDILDPKAVARYSETNLYCNS 246
           Y LEPAGSHGVWGLDD+  L ++ GA Q +  ++  ++PS I +   +  +++  LY   
Sbjct: 180 YWLEPAGSHGVWGLDDYHFLPFLFGAYQLSTHKH--LKPSSIHNDDLIEMFADKYLYFGC 237

Query: 247 IAFLLRVKTGHFAQ-HSPMLHDIAQTVPTWSKVTTGLIKMYRVEVLNKFPVVQHFWFGTG 305
           I F+  VKT    + HSPML DI+  V  WSKV  G+ KMY  EV+ K P++QHF+F   
Sbjct: 238 IEFINSVKTTTTLRWHSPMLDDIS-GVKKWSKVAEGMFKMYEAEVIKKLPIMQHFYFNDM 296

Query: 306 FF 307
           F 
Sbjct: 297 FL 298

>TDEL0A06200 Chr1 complement(1085066..1086133) [1068 bp, 355 aa]
           {ON} Anc_8.674 YPL152W
          Length = 355

 Score =  164 bits (414), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 102/299 (34%), Positives = 152/299 (50%), Gaps = 7/299 (2%)

Query: 13  PVKRIFDTAGTHDFQKSLTMYRLQSHLERYLKLVQGQKIPKSSQ--NRAVVRFVCILERL 70
           P KR+        +Q   T   L   L      V+G +  + SQ    ++     ++E +
Sbjct: 4   PEKRLLTKDDMQLWQNCQTKSDLLKFLCELADAVKGLENSQYSQPIGGSIQSVEALIECV 63

Query: 71  DALMDETPPRTGSARRFGDLACRDWHDRMQGELDGLLETLLPEAARRSAAELRYYLGSAF 130
           D  ++  P  +    RFG    RD +D + G    L++           A+L  Y   ++
Sbjct: 64  DQCIENHPVESTGPSRFGKGEFRDLYDDISGRSSVLIKEKFGSLTDEQVAQLSVYFNESW 123

Query: 131 GSRERLDYGTGHELAFLAVVVALDMLGLWTEDKFTGEDMLYVWARYYALVHRLILTYNLE 190
           G + R+DYG+GHEL FL  +  L   G++   K     +L V+ +Y   +  +   Y LE
Sbjct: 124 GDKSRIDYGSGHELNFLCFLYGLYRCGVFDLAKDNRNLVLIVFMKYLKTMRVIETVYWLE 183

Query: 191 PAGSHGVWGLDDHLHLAYILGASQWAQDRNVPMQPSDILDPKAVARYSETNLYCNSIAFL 250
           PAGSHGVWGLDD+  L ++ GASQ +  R+  ++P  I +P+ V  +SE  LY   I F+
Sbjct: 184 PAGSHGVWGLDDYHFLPFLFGASQLSTHRH--LKPKSIHNPEVVEMFSEKYLYFGCIDFI 241

Query: 251 LRVK-TGHFAQHSPMLHDIAQTVPTWSKVTTGLIKMYRVEVLNKFPVVQHFWFGTGFFP 308
             VK T     HSPML DI+  V  W+KV  G++KMY  EVL K P++QHF+F + F P
Sbjct: 242 NSVKTTASLRWHSPMLDDIS-GVKEWAKVYQGMVKMYDAEVLCKLPIMQHFYF-SEFLP 298

>NCAS0C01690 Chr3 complement(311102..312181) [1080 bp, 359 aa] {ON}
           Anc_8.674
          Length = 359

 Score =  161 bits (408), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 97/295 (32%), Positives = 158/295 (53%), Gaps = 7/295 (2%)

Query: 13  PVKRIFDTAGTHDFQKSLTMYRLQSHLERYLKLVQGQKIPKSSQ--NRAVVRFVCILERL 70
           P KRI        ++ S T   L + +    + V+G +  +  +  + ++     +L+ +
Sbjct: 3   PEKRILTENDMEVWKNSATRKDLLNFISTLAESVEGHENSQIVEPISPSIASLSSLLDEV 62

Query: 71  DALMDETPP-RTGSARRFGDLACRDWHDRMQGELDGLLETLLPEAARRSAAELRYYLGSA 129
           + L+D+ P  +     RFG +  RD++D +  +   L++T     +     +L  YL  +
Sbjct: 63  NKLVDKHPVIKEAKVSRFGKVEFRDFYDELNEKSSSLIKTRFSTLSDEQLEQLSIYLDES 122

Query: 130 FGSRERLDYGTGHELAFLAVVVALDMLGLWTEDKFTGEDMLYVWARYYALVHRLILTYNL 189
           +G++ R+DYG+GHEL F+  +  L   GL+  +K     +L V+ +Y  ++  L   Y L
Sbjct: 123 WGNKRRIDYGSGHELNFICFLFGLYSYGLFDLEKDAINLVLVVFLKYLNIMRVLETKYWL 182

Query: 190 EPAGSHGVWGLDDHLHLAYILGASQWAQDRNVPMQPSDILDPKAVARYSETNLYCNSIAF 249
           EPAGSHGVWGLDD+  L ++ GA Q    ++  ++P  I + + V  + +  LY   I+F
Sbjct: 183 EPAGSHGVWGLDDYHFLPFLFGAFQLVPHKH--LKPMSIHNEELVELFKDKFLYFGCISF 240

Query: 250 LLRVK-TGHFAQHSPMLHDIAQTVPTWSKVTTGLIKMYRVEVLNKFPVVQHFWFG 303
           +  VK T     HSPML DI+  V  WSKV  G+IKMY  EVL K P++QHF+F 
Sbjct: 241 INSVKTTTSLRWHSPMLDDIS-GVKKWSKVAEGMIKMYTAEVLGKLPIMQHFYFS 294

>Kwal_26.8783 s26 complement(941317..942384) [1068 bp, 355 aa] {ON}
           YPL152W (RRD2) - similar to hosphotyrosyl phosphatase
           activator (PTPA) from several organisms [contig 67] FULL
          Length = 355

 Score =  161 bits (407), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 103/315 (32%), Positives = 165/315 (52%), Gaps = 11/315 (3%)

Query: 13  PVKRIFDTAGTHDFQKSLTMYRLQSHLERYLKLVQGQKIPKSSQ--NRAVVRFVCILERL 70
           P KR+  +     +    T  +L   +    + V+G +  +  +    ++ +   +L+ +
Sbjct: 3   PQKRLLTSQDIETWVDCATFDQLIEFISELAESVKGLENNQYQEPIGASIDKCCSLLDEV 62

Query: 71  DALMDETPPRT-GSARRFGDLACRDWHDRMQGELDGLLETLLPEAARRSAAELRYYLGSA 129
            ++  + P +      RFG +  R ++D ++ +   L+     + ++  A EL  Y   +
Sbjct: 63  FSIAKQHPVKEDAETSRFGKIEFRHFYDDLRIKAQDLISKEFDQLSQDQAEELVAYFVES 122

Query: 130 FGSRERLDYGTGHELAFLAVVVALDMLGLWTEDKFTGEDMLYVWARYYALVHRLILTYNL 189
           +G RER+DYG+GHEL F+  +  L   GL+   +     +L V+  Y  L+  L  TY L
Sbjct: 123 WGDRERIDYGSGHELNFICFLYGLKDCGLFERSRDYRNLVLKVFIHYLELMRVLETTYWL 182

Query: 190 EPAGSHGVWGLDDHLHLAYILGASQWAQDRNVPMQPSDILDPKAVARYSETNLYCNSIAF 249
           EPAGSHGVWGLDD+  L ++ GASQ A  ++  ++P  I + + V  ++   LY   I F
Sbjct: 183 EPAGSHGVWGLDDYHFLPFLFGASQLAPHKH--LKPKSIHNNELVDMFASRYLYFGCIDF 240

Query: 250 LLRVK-TGHFAQHSPMLHDIAQTVPTWSKVTTGLIKMYRVEVLNKFPVVQHFWFGTGFFP 308
           + RVK T     HSPML DI+    +WSKV  G+IKMYR EVL K P++QHF FG+    
Sbjct: 241 INRVKTTASLRWHSPMLDDIS-GAKSWSKVAEGMIKMYRKEVLAKLPIMQHFLFGS---- 295

Query: 309 WVDMAHGMSLPNYEA 323
           ++    G+S P   A
Sbjct: 296 FLKCPEGVSPPGAHA 310

>Suva_16.158 Chr16 (274228..275304) [1077 bp, 358 aa] {ON} YPL152W
           (REAL)
          Length = 358

 Score =  161 bits (407), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 106/314 (33%), Positives = 165/314 (52%), Gaps = 17/314 (5%)

Query: 13  PVKRIFDTAGTHDFQKSLTMYRLQSHLERYLKLVQGQ-----KIPKSSQNRAVVRFVCIL 67
           P KR+        ++KS T       +    K V+G      K P S Q   + R + +L
Sbjct: 3   PEKRLLTAEDMKLWEKSQTRADFTKFVIDLAKSVEGHENSQYKEPVSEQ---ITRMLSLL 59

Query: 68  ERLDALMDETPP-RTGSARRFGDLACRDWHDRMQGELDGLLETLLPEAARRSAAELRYYL 126
            R+  ++++ P      + RFG +  RD++D +      LL++           +L  YL
Sbjct: 60  SRVRDIIEKHPVVHDVDSSRFGKVEFRDFYDEVSQNSRKLLKSEFSLLTDEQLEQLSIYL 119

Query: 127 GSAFGSRERLDYGTGHELAFLAVVVALDMLGLWTEDKFTGEDMLYVWARYYALVHRLILT 186
             ++G++ R+DYG+GHEL F+ ++  L   G++     +   +L V+  Y  ++  L   
Sbjct: 120 DESWGNKRRIDYGSGHELNFMCLLYGLYNYGVFNLSNDSTNLILKVFIEYLDIMRVLETK 179

Query: 187 YNLEPAGSHGVWGLDDHLHLAYILGASQWAQDRNVPMQPSDILDPKAVARYSETNLYCNS 246
           Y LEPAGSHGVWGLDD+  L ++ GA Q    ++  ++P  I + + V  +S+  LY   
Sbjct: 180 YWLEPAGSHGVWGLDDYHFLPFLFGAFQLTTHKH--LKPISIHNSELVEMFSDRYLYFGC 237

Query: 247 IAFLLRVK-TGHFAQHSPMLHDIAQTVPTWSKVTTGLIKMYRVEVLNKFPVVQHFWFGTG 305
           IAF+ +VK +     HSPML DI+  V TWSKV  G+IKMY  EVL+K P++QHF+F + 
Sbjct: 238 IAFINKVKSSASLRWHSPMLDDIS-GVKTWSKVAEGMIKMYEAEVLSKLPIMQHFYF-SE 295

Query: 306 FFPWVDMAHGMSLP 319
           F P      G+S P
Sbjct: 296 FLP---CPEGVSQP 306

>Skud_16.130 Chr16 (236660..237736) [1077 bp, 358 aa] {ON} YPL152W
           (REAL)
          Length = 358

 Score =  160 bits (406), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 100/303 (33%), Positives = 161/303 (53%), Gaps = 14/303 (4%)

Query: 13  PVKRIFDTAGTHDFQKSLTMYRLQSHLERYLKLVQGQ-----KIPKSSQNRAVVRFVCIL 67
           P KR+        +++S T       +    + V+G      K P S Q   ++  + +L
Sbjct: 3   PEKRLLTAGDMKLWEESQTRADFTKFIIELAESVKGHENYQFKEPISEQ---IISMMNLL 59

Query: 68  ERLDALMDETPP-RTGSARRFGDLACRDWHDRMQGELDGLLETLLPEAARRSAAELRYYL 126
            ++  ++ + P  +   + RFG +  RD++D +      LL +  P        +L  YL
Sbjct: 60  SQIKDIIQKHPVVQDADSSRFGKVEFRDFYDEVSQNSRKLLRSEFPHLTDEQLEQLSIYL 119

Query: 127 GSAFGSRERLDYGTGHELAFLAVVVALDMLGLWTEDKFTGEDMLYVWARYYALVHRLILT 186
             ++G++ R+DYG+GHEL F+ ++  L   G++     +   +L V+  Y  ++  L   
Sbjct: 120 DESWGNKRRIDYGSGHELNFMCLLYGLYNYGIFNLSDDSTNLILKVFIEYLQIMRILETK 179

Query: 187 YNLEPAGSHGVWGLDDHLHLAYILGASQWAQDRNVPMQPSDILDPKAVARYSETNLYCNS 246
           Y LEPAGSHGVWGLDD+  L ++ GA Q    ++  ++P  I + + V  ++   LY   
Sbjct: 180 YWLEPAGSHGVWGLDDYHFLPFLFGAFQLTTHKH--LKPISIHNNELVEMFAHRYLYFGC 237

Query: 247 IAFLLRVK-TGHFAQHSPMLHDIAQTVPTWSKVTTGLIKMYRVEVLNKFPVVQHFWFGTG 305
           IAF+ +VK +     HSPML DI+  V TWSKV  G+IKMY+VEVL+K P++QHF+F   
Sbjct: 238 IAFINKVKSSASLRWHSPMLDDIS-GVKTWSKVAEGMIKMYKVEVLSKLPIMQHFYF-CE 295

Query: 306 FFP 308
           F P
Sbjct: 296 FLP 298

>Ecym_2399 Chr2 (778448..779503) [1056 bp, 351 aa] {ON} similar to
           Ashbya gossypii ACR139C
          Length = 351

 Score =  159 bits (403), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 95/260 (36%), Positives = 147/260 (56%), Gaps = 12/260 (4%)

Query: 52  PKSSQNRAVVRFVCILERLDALMDETPP-RTGSARRFGDLACRDWHDRMQGELDGLLETL 110
           P SSQ   +     +L+ +  ++D+ P  +     RFG +  RD++D ++     L+ +L
Sbjct: 47  PISSQ---IENLCALLDTVAKIVDKHPVVQDKGTSRFGKVEFRDFYDEVRETTKELISSL 103

Query: 111 LPEAARRSAAELRYYLGSAFGSRERLDYGTGHELAFLAVVVALDMLGLWTE-DKFTGEDM 169
             E       EL  Y   ++G R+R+DYG+GHEL F+  +  L    + ++ DK     +
Sbjct: 104 SSELTDEQVEELAVYFTESWGDRKRIDYGSGHELNFICFLYGLTHYSVLSDADKVNL--V 161

Query: 170 LYVWARYYALVHRLILTYNLEPAGSHGVWGLDDHLHLAYILGASQWAQDRNVPMQPSDIL 229
           L V+ +Y  ++  L   Y LEPAGSHGVWGLDD+  L ++ GA Q    ++  ++P  I 
Sbjct: 162 LKVFIKYLDVMRLLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLTTHKH--LKPKSIH 219

Query: 230 DPKAVARYSETNLYCNSIAFLLRVKT-GHFAQHSPMLHDIAQTVPTWSKVTTGLIKMYRV 288
           +P+ V  + +  +Y   +AF+ +VKT      HSPML DI+  V TWSKV  G++KMY+ 
Sbjct: 220 NPEIVEVFEKRYMYFECVAFINKVKTTASLRWHSPMLDDIS-GVRTWSKVAEGMVKMYKA 278

Query: 289 EVLNKFPVVQHFWFGTGFFP 308
           EVL K P++QHF+F T F P
Sbjct: 279 EVLGKLPIMQHFFFST-FLP 297

>SAKL0H06622g Chr8 (583484..584551) [1068 bp, 355 aa] {ON} similar
           to uniprot|Q12461 Saccharomyces cerevisiae YPL152W
          Length = 355

 Score =  157 bits (398), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 94/295 (31%), Positives = 160/295 (54%), Gaps = 7/295 (2%)

Query: 13  PVKRIFDTAGTHDFQKSLTMYRLQSHLERYLKLVQGQKIPKSSQ--NRAVVRFVCILERL 70
           P KR+        + +S T   L   + +  + V+G++  +  +  + ++     +L+++
Sbjct: 3   PQKRLLSQHDMEIWTESNTFNELTGFITKLGESVKGRENTQYVEPISSSIDELCSLLDKV 62

Query: 71  DALMDETPP-RTGSARRFGDLACRDWHDRMQGELDGLLETLLPEAARRSAAELRYYLGSA 129
           + ++   P  +  +  RFG +  RD++D +      ++ +L  + +     EL  Y   +
Sbjct: 63  NKVVSSHPVIQDANTSRFGKVEFRDFYDDLSSRSSEMISSLSDKLSTPQVDELAAYFRKS 122

Query: 130 FGSRERLDYGTGHELAFLAVVVALDMLGLWTEDKFTGEDMLYVWARYYALVHRLILTYNL 189
           +G+R R+DYG+GHEL F+  +  L+    +  +K     +L V+ +Y  ++  L   Y L
Sbjct: 123 WGNRTRIDYGSGHELNFICFLYGLNKCNFFDLEKDATNVVLRVFIKYLDVMRTLETKYWL 182

Query: 190 EPAGSHGVWGLDDHLHLAYILGASQWAQDRNVPMQPSDILDPKAVARYSETNLYCNSIAF 249
           EPAGSHGVWGLDD+  L ++ GA Q A  ++  ++P  I + + V  + +  LY   I F
Sbjct: 183 EPAGSHGVWGLDDYHFLPFLFGAFQLATHKH--LKPKSIHNKEFVEMFEKRYLYFGCIGF 240

Query: 250 LLRVKTG-HFAQHSPMLHDIAQTVPTWSKVTTGLIKMYRVEVLNKFPVVQHFWFG 303
           +  VKT      HSPML DI+  V TWSKV  G++KMY+ EVL K P++QHF+FG
Sbjct: 241 INSVKTSISLRWHSPMLDDIS-GVKTWSKVAEGMVKMYKAEVLGKLPIMQHFYFG 294

>YPL152W Chr16 (265028..266104) [1077 bp, 358 aa] {ON}
           RRD2Activator of the phosphotyrosyl phosphatase activity
           of PP2A,peptidyl-prolyl cis/trans-isomerase; regulates
           G1 phase progression, the osmoresponse, microtubule
           dynamics; subunit of the Tap42p-Pph21p-Rrd2p complex
          Length = 358

 Score =  157 bits (396), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 101/315 (32%), Positives = 170/315 (53%), Gaps = 19/315 (6%)

Query: 13  PVKRIFDTAGTHDFQKSLTMYRLQSHLERYL-KLVQGQKIPKSSQ-----NRAVVRFVCI 66
           P KR+        +++S T    ++H  +++  L +  K  ++SQ     + ++   + +
Sbjct: 3   PEKRLLTPDDMKLWEESPT----RAHFTKFIIDLAESVKGHENSQYKEPISESINSMMNL 58

Query: 67  LERLDALMDETPP-RTGSARRFGDLACRDWHDRMQGELDGLLETLLPEAARRSAAELRYY 125
           L ++  +  + P  +   + RFG +  RD++D +      +L +  P        +L  Y
Sbjct: 59  LSQIKDITQKHPVIKDADSSRFGKVEFRDFYDEVSRNSRKILRSEFPSLTDEQLEQLSIY 118

Query: 126 LGSAFGSRERLDYGTGHELAFLAVVVALDMLGLWTEDKFTGEDMLYVWARYYALVHRLIL 185
           L  ++G++ R+DYG+GHEL F+ ++  L   G++     +   +L V+  Y  ++  L  
Sbjct: 119 LDESWGNKRRIDYGSGHELNFMCLLYGLYSYGIFNLSNDSTNLVLKVFIEYLKIMRILET 178

Query: 186 TYNLEPAGSHGVWGLDDHLHLAYILGASQWAQDRNVPMQPSDILDPKAVARYSETNLYCN 245
            Y LEPAGSHGVWGLDD+  L ++ GA Q    ++  ++P  I + + V  ++   LY  
Sbjct: 179 KYWLEPAGSHGVWGLDDYHFLPFLFGAFQLTTHKH--LKPISIHNNELVEMFAHRYLYFG 236

Query: 246 SIAFLLRVK-TGHFAQHSPMLHDIAQTVPTWSKVTTGLIKMYRVEVLNKFPVVQHFWFGT 304
            IAF+ +VK +     HSPML DI+  V TWSKV  G+IKMY+ EVL+K P++QHF+F +
Sbjct: 237 CIAFINKVKSSASLRWHSPMLDDIS-GVKTWSKVAEGMIKMYKAEVLSKLPIMQHFYF-S 294

Query: 305 GFFPWVDMAHGMSLP 319
            F P  D   G+S P
Sbjct: 295 EFLPCPD---GVSPP 306

>Smik_6.349 Chr6 complement(558150..559226) [1077 bp, 358 aa] {ON}
           YPL152W (REAL)
          Length = 358

 Score =  157 bits (396), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 94/300 (31%), Positives = 159/300 (53%), Gaps = 8/300 (2%)

Query: 13  PVKRIFDTAGTHDFQKSLTMYRLQSHLERYLKLVQGQKIPKSSQ--NRAVVRFVCILERL 70
           P KR+  +     +++S T       +    + V+G +  +  +  +  + R + +L  +
Sbjct: 3   PEKRLLTSGDMKLWEESQTRANFTKFIIDLAESVKGHENSQYEEPVSEPISRMMNLLSYI 62

Query: 71  DALMDETPP-RTGSARRFGDLACRDWHDRMQGELDGLLETLLPEAARRSAAELRYYLGSA 129
             ++ + P  +  ++ RFG +  RD++D +       L +  P        +L  YL  +
Sbjct: 63  RDIIQKHPVVKDANSSRFGKIEFRDFYDEVSQSSRKFLRSEFPSLTDEQLEQLSIYLDES 122

Query: 130 FGSRERLDYGTGHELAFLAVVVALDMLGLWTEDKFTGEDMLYVWARYYALVHRLILTYNL 189
           +G++ R+DYG+GHEL F+ ++  L   G++     +   +L V+  Y  ++  L   Y L
Sbjct: 123 WGNKRRIDYGSGHELNFMCLLYGLYKYGVFNLSNDSTNLILKVFIEYLKIMRILETRYWL 182

Query: 190 EPAGSHGVWGLDDHLHLAYILGASQWAQDRNVPMQPSDILDPKAVARYSETNLYCNSIAF 249
           EPAGSHGVWGLDD+  L ++ GA Q    ++  ++P  I + + V  ++   LY   I F
Sbjct: 183 EPAGSHGVWGLDDYHFLPFLFGAFQLTSHKH--LKPISIHNNELVEMFANRYLYFGCIDF 240

Query: 250 LLRVK-TGHFAQHSPMLHDIAQTVPTWSKVTTGLIKMYRVEVLNKFPVVQHFWFGTGFFP 308
           + +VK +     HSPML DI+  V TWSKV  G+IKMY  EVL+K P++QHF+F + F P
Sbjct: 241 INKVKSSASLRWHSPMLDDIS-GVKTWSKVAEGMIKMYEAEVLSKLPIMQHFYF-SDFLP 298

>KAFR0H02440 Chr8 (467656..468717) [1062 bp, 353 aa] {ON} Anc_8.674
           YPL152W
          Length = 353

 Score =  156 bits (394), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 95/290 (32%), Positives = 151/290 (52%), Gaps = 27/290 (9%)

Query: 64  VCILERLDALMDETPPRTGSARRFGDLACRDWHDRMQGELDGLLETLLPEAARRSAAELR 123
           + +L+ + +++DE P    +  RFG    R ++  ++     LL             +L 
Sbjct: 58  LALLDSVLSVVDEHPVLNDTTSRFGKTEFRSFYQDVKSNCHNLLSKAFDTLTTNQIEQLS 117

Query: 124 YYLGSAFGSRERLDYGTGHELAFLAVVVALDMLGLWTEDKFTGEDMLYVWARYYALVHRL 183
            Y   ++G+ ER+DYG+GHEL F+  +  L    ++  ++ +   ++ V+ +Y  ++ RL
Sbjct: 118 IYFYESWGNEERIDYGSGHELNFICFLYGLYKYDVFRLERDSTNIVILVFVKYLKIMRRL 177

Query: 184 ILTYNLEPAGSHGVWGLDDHLHLAYILGASQWAQDRNVPMQPSDILDPKAVARYSETNLY 243
              Y LEPAGSHGVWGLDD+  L ++ GA Q +  ++  ++P  I + + V  + +  LY
Sbjct: 178 ETLYWLEPAGSHGVWGLDDYHFLPFLFGAFQLSNHKH--LKPKSIHNDEIVDMFKDKYLY 235

Query: 244 CNSIAFLLRVK-TGHFAQHSPMLHDIAQTVPTWSKVTTGLIKMYRVEVLNKFPVVQHFWF 302
              IAF+  VK T     HSPML DI+  V  WSKV+ G+IKMY  EVL+K PV+QHF+F
Sbjct: 236 FGCIAFINSVKTTASLRWHSPMLDDIS-GVKKWSKVSEGMIKMYVAEVLSKLPVMQHFYF 294

Query: 303 G------TGFFP----------------WVDMAHGMSLPNYEAPSETSEK 330
                  TG  P                W D   G+ +P+  A +E ++K
Sbjct: 295 SEFLACPTGISPYDERNEHLESEHVHSGWGDCC-GIKIPSAVAATEMNKK 343

>KLLA0F11187g Chr6 (1031839..1032921) [1083 bp, 360 aa] {ON} similar
           to uniprot|Q12461 Saccharomyces cerevisiae YPL152W RRD2
           Resistant to Rapamycin Deletion 2; similar to
           hosphotyrosyl phosphatase activator (PTPA) from several
           organisms
          Length = 360

 Score =  153 bits (387), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 82/228 (35%), Positives = 131/228 (57%), Gaps = 7/228 (3%)

Query: 80  RTGSARRFGDLACRDWHDRMQGELDGLLETLLPEAARRSAAELR---YYLGSAFGSRERL 136
           +  +  RFG +  RD++D +    + L+  +     +    +L     Y  +++G R R+
Sbjct: 72  KDANTSRFGKIEFRDFYDDISEHSNELISKIFEGIEKPDTGKLDDICTYFINSWGDRSRI 131

Query: 137 DYGTGHELAFLAVVVALDMLGLWTEDKFTGEDMLYVWARYYALVHRLILTYNLEPAGSHG 196
           DYG+GHEL F+  +  L    ++  +  +   +L ++ +Y  ++  L L Y LEPAGSHG
Sbjct: 132 DYGSGHELNFICFLYCLTESKVFDLENDSSNIVLMLFIKYLGIMRSLELKYWLEPAGSHG 191

Query: 197 VWGLDDHLHLAYILGASQWAQDRNVPMQPSDILDPKAVARYSETNLYCNSIAFLLRVK-T 255
           VWGLDD+  L ++ GA Q +  ++  ++P  I +P+ V  + +  LY   IAF+ +VK T
Sbjct: 192 VWGLDDYHFLPFLFGAFQLSTHKH--LKPKSIHNPEVVEMFQDRYLYFGCIAFINKVKTT 249

Query: 256 GHFAQHSPMLHDIAQTVPTWSKVTTGLIKMYRVEVLNKFPVVQHFWFG 303
                HSPML DI+  V  WSKV  G++KMY+ EVL K P++QHF+FG
Sbjct: 250 ASLRWHSPMLDDIS-GVKRWSKVAEGMVKMYKAEVLQKLPIMQHFYFG 296

>NDAI0E02410 Chr5 complement(500623..501702) [1080 bp, 359 aa] {ON}
           Anc_8.674
          Length = 359

 Score =  153 bits (386), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 96/295 (32%), Positives = 153/295 (51%), Gaps = 7/295 (2%)

Query: 13  PVKRIFDTAGTHDFQKSLTMYRLQSHLERYLKLVQGQKIPKSSQ--NRAVVRFVCILERL 70
           P KR+        ++ S T   L   +    + V+G +  + S+  + A+     IL  +
Sbjct: 3   PEKRLLTEDDMKLWEASSTKKELLDFISTLAEAVKGCENSQISEPISPAINTLEQILVSI 62

Query: 71  DALMDETPP-RTGSARRFGDLACRDWHDRMQGELDGLLETLLPEAARRSAAELRYYLGSA 129
           D ++D+ P        RFG    R ++D +    + L+    P        +L  YL  +
Sbjct: 63  DKIIDKHPVLEDKEISRFGKKEFRGFYDEINEVSEKLIHENFPSLTHEQLEQLTIYLDES 122

Query: 130 FGSRERLDYGTGHELAFLAVVVALDMLGLWTEDKFTGEDMLYVWARYYALVHRLILTYNL 189
           +G+++R+DYG+GHEL F+  +  L    +   D      +L ++ +Y  ++  L   Y L
Sbjct: 123 WGNKQRIDYGSGHELNFMCFLFGLYKYDVLKLDIDARNMVLIIFIKYLDIMRSLETKYWL 182

Query: 190 EPAGSHGVWGLDDHLHLAYILGASQWAQDRNVPMQPSDILDPKAVARYSETNLYCNSIAF 249
           EPAGSHGVWGLDD+  L ++ GA Q A  ++  ++P  I + + V  +++  LY   IAF
Sbjct: 183 EPAGSHGVWGLDDYHFLPFLFGAYQLATHKH--LKPLSIHNEELVEMFAKKYLYFGCIAF 240

Query: 250 LLRVKT-GHFAQHSPMLHDIAQTVPTWSKVTTGLIKMYRVEVLNKFPVVQHFWFG 303
           +  VKT      HSPML DI+  V  WSKV  G++KMY  EVL+K P++QHF+F 
Sbjct: 241 INSVKTTASLRWHSPMLDDIS-GVKRWSKVAEGMVKMYNAEVLSKLPIMQHFYFS 294

>KNAG0J01690 Chr10 complement(308576..309667) [1092 bp, 363 aa] {ON}
           Anc_8.674 YPL152W
          Length = 363

 Score =  151 bits (382), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 97/302 (32%), Positives = 162/302 (53%), Gaps = 21/302 (6%)

Query: 13  PVKRIFDTAGTHDFQKSLTMYRLQSHLERYLKLVQGQK-----IPKSSQNRAVVRFVCIL 67
           P KR+        ++ S T   L   +E+    V+G++     +P S+   A++    +L
Sbjct: 6   PCKRLLMKRDLDLWESSETRAHLVHFIEQLADAVRGRENEQYDLPISASVEALMG---LL 62

Query: 68  ERLDALMDETP--PRTGSARRFGDLACRDWHDRMQGELDGLLETLLPEAARRSAAELRYY 125
           +++  +++  P   +   A RFG +  RD++D ++ E   L+    P+  +    +L+ Y
Sbjct: 63  QQVRGVIERHPVAKKDAPASRFGKVEFRDFYDELRAESASLITGAFPQLTQNQVRQLQTY 122

Query: 126 LGSAFGSRERLDYGTGHELAFLAVVVALDMLGLWTEDKFTGED----MLYVWARYYALVH 181
           L  ++G + R+DYG+GHEL F+  +  L    ++      G D    +L  +  Y  ++ 
Sbjct: 123 LEESWGDKRRIDYGSGHELNFMCFLYGLTAYKVF---DLGGTDRANLVLKPFIEYLKIMR 179

Query: 182 RLILTYNLEPAGSHGVWGLDDHLHLAYILGASQWAQDRNVPMQPSDILDPKAVARYSETN 241
            L   Y LEPAGSHGVWGLDD+  L ++ GA Q +  ++  ++P  I + + V  +++  
Sbjct: 180 VLETEYWLEPAGSHGVWGLDDYHFLPFLFGAFQLSTHKH--LKPLSIHNEEVVELFADKY 237

Query: 242 LYCNSIAFLLRVKT-GHFAQHSPMLHDIAQTVPTWSKVTTGLIKMYRVEVLNKFPVVQHF 300
           LY   I F+  VKT      HSPML DI+  V  WSKV  G++KMY+ EVL+K P++QHF
Sbjct: 238 LYFGCIHFINSVKTTATLRWHSPMLDDIS-GVKKWSKVAEGMVKMYQAEVLSKLPIMQHF 296

Query: 301 WF 302
           +F
Sbjct: 297 YF 298

>TBLA0C01860 Chr3 complement(437987..439057) [1071 bp, 356 aa] {ON}
           Anc_8.674 YPL152W
          Length = 356

 Score =  145 bits (367), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 84/259 (32%), Positives = 144/259 (55%), Gaps = 11/259 (4%)

Query: 66  ILERLDALMDETPPRT---GSARRFGDLACRDWHDRMQGELDGLLETLLPEAARRSAAEL 122
           +L+ +  +++  P  +    +  RFG +  + ++D +    + L+++           EL
Sbjct: 57  LLQDIRDIIERYPVESDIESTKSRFGKVEFKSFYDDINQNSEKLIKSHFNGLDPNQIQEL 116

Query: 123 RYYLGSAFGSRERLDYGTGHELAFLAVVVALDMLGLWTEDKFTGEDMLYVWARYYALVHR 182
             YL  ++G+R+R+DYG+GHEL F+  +  L    ++   + +   +L ++  Y  ++  
Sbjct: 117 SIYLVESWGNRQRIDYGSGHELNFICFLYGLTKYNIFNLLEDSTNLVLKIFMEYINIMRI 176

Query: 183 LILTYNLEPAGSHGVWGLDDHLHLAYILGASQWAQDRNVPMQPSDILDPKAVARYSETNL 242
           +   Y LEPAGSHGVWGLDD+  L ++ GA Q ++ ++  ++P  I + + V  + +  +
Sbjct: 177 IETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLSKHKH--LKPISIHNEEMVEMFKDKYM 234

Query: 243 YCNSIAFLLRVK-TGHFAQHSPMLHDIAQTVPTWSKVTTGLIKMYRVEVLNKFPVVQHFW 301
           Y   I F+  +K T     HSPML DI+  V  WSKV+ G+IKMY  EVL K P++QHF+
Sbjct: 235 YFGCIDFINSIKTTATLRWHSPMLDDIS-GVKKWSKVSEGMIKMYSAEVLGKLPIMQHFY 293

Query: 302 FGTGFFPWVDMAHGMSLPN 320
           F + F P      G+SLP+
Sbjct: 294 F-SDFLP---CPQGVSLPH 308

>KNAG0E03280 Chr5 complement(656486..657775) [1290 bp, 429 aa] {ON}
           Anc_8.44 YFL027C
          Length = 429

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 42/93 (45%), Gaps = 16/93 (17%)

Query: 75  DETPPRTGSARRFGDLACRDWHDRMQGELDGLLETLLPEAARRSAAELRYYLG------- 127
           DE   +   AR FG +A  +W  R+Q       ETL+    RR+  +LRYY G       
Sbjct: 94  DENQVKLDCARSFGTVADENWRTRLQ----MFQETLICRLLRRN-HKLRYYQGYHDIVSI 148

Query: 128 --SAFGSRERLDYGTGHELAFLAVVVALDMLGL 158
             + F  RE +D    + L  LA + A  +L L
Sbjct: 149 FVNVFVDRENIDSNDHNTL--LACLEAFTLLYL 179

>TBLA0H02510 Chr8 complement(593502..594998) [1497 bp, 498 aa] {ON}
           Anc_5.165 YJL019W
          Length = 498

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 28/48 (58%), Gaps = 2/48 (4%)

Query: 9   QFSPPVKRIFDTAGTHDFQKSLTMYRLQSHLERYLKLVQGQKIPKSSQ 56
           QF   +KRI  +  TH+  + L M  LQ  L+++ ++V+ + I + S+
Sbjct: 120 QFETQIKRIVPSKDTHELDQQLDMIDLQ--LQKFNRMVENEDITQFSE 165

>Suva_8.16 Chr8 complement(29573..34372) [4800 bp, 1599 aa] {ON}
            YHL035C (REAL)
          Length = 1599

 Score = 31.2 bits (69), Expect = 5.6,   Method: Composition-based stats.
 Identities = 19/68 (27%), Positives = 33/68 (48%), Gaps = 6/68 (8%)

Query: 237  YSETNLYC----NSIAFLLRVKTGHFAQHSPMLHDIAQTVPTWSKVTTGLIKMYRVEVLN 292
            Y E  ++C     SI FL+ + T HF   + ++  +   V  W    +  +K  R++ + 
Sbjct: 1122 YLEVTMFCLIQCTSIIFLITIITPHFLIVAVVVFILYYFVGMWYLTASRELK--RIDSIT 1179

Query: 293  KFPVVQHF 300
            K P+ QHF
Sbjct: 1180 KSPIFQHF 1187

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.138    0.434 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 36,453,811
Number of extensions: 1468782
Number of successful extensions: 2656
Number of sequences better than 10.0: 43
Number of HSP's gapped: 2617
Number of HSP's successfully gapped: 43
Length of query: 365
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 254
Effective length of database: 40,753,473
Effective search space: 10351382142
Effective search space used: 10351382142
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 66 (30.0 bits)