Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AFR292W5.708ON54154129250.0
Ecym_40135.708ON54254226700.0
SAKL0E15048g5.708ON54254225540.0
KLLA0A00484g5.708ON54354324970.0
TDEL0B021205.708ON54854824740.0
NCAS0A031605.708ON55255224420.0
NDAI0E050805.708ON55155124340.0
YKR097W (PCK1)5.708ON54954824220.0
Smik_11.3615.708ON54954824180.0
ZYRO0B16456g5.708ON54854824170.0
KLTH0E00902g5.708ON54454424140.0
CAGL0H06633g5.708ON54453224060.0
Skud_11.3375.708ON54954824040.0
KNAG0C066405.708ON54753024020.0
Suva_11.3345.708ON54854824010.0
Kwal_55.196635.708ON54454423650.0
KAFR0H001605.708ON54955023520.0
Kpol_1043.755.708ON55851822340.0
TPHA0E001705.708ON57851722210.0
TBLA0E017005.708ON57652521800.0
Suva_7.275singletonON961131563e-12
TPHA0O006001.380ON137284790.66
Kwal_56.242656.259ON21759741.2
KLTH0F02024g1.67ON73490751.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR292W
         (541 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR292W Chr6 (965578..967203) [1626 bp, 541 aa] {ON} Syntenic ho...  1131   0.0  
Ecym_4013 Chr4 complement(31078..32706) [1629 bp, 542 aa] {ON} s...  1033   0.0  
SAKL0E15048g Chr5 (1251927..1253555) [1629 bp, 542 aa] {ON} high...   988   0.0  
KLLA0A00484g Chr1 complement(40330..41961) [1632 bp, 543 aa] {ON...   966   0.0  
TDEL0B02120 Chr2 complement(377690..379336) [1647 bp, 548 aa] {O...   957   0.0  
NCAS0A03160 Chr1 complement(619303..620961) [1659 bp, 552 aa] {O...   945   0.0  
NDAI0E05080 Chr5 (1165969..1167624) [1656 bp, 551 aa] {ON} Anc_5...   942   0.0  
YKR097W Chr11 (631152..632801) [1650 bp, 549 aa] {ON}  PCK1Phosp...   937   0.0  
Smik_11.361 Chr11 (621197..622846) [1650 bp, 549 aa] {ON} YKR097...   936   0.0  
ZYRO0B16456g Chr2 (1334967..1336613) [1647 bp, 548 aa] {ON} high...   935   0.0  
KLTH0E00902g Chr5 complement(88552..90186) [1635 bp, 544 aa] {ON...   934   0.0  
CAGL0H06633g Chr8 (659326..660960) [1635 bp, 544 aa] {ON} highly...   931   0.0  
Skud_11.337 Chr11 (612752..614401) [1650 bp, 549 aa] {ON} YKR097...   930   0.0  
KNAG0C06640 Chr3 (1288896..1290539) [1644 bp, 547 aa] {ON} Anc_5...   929   0.0  
Suva_11.334 Chr11 (615967..617613) [1647 bp, 548 aa] {ON} YKR097...   929   0.0  
Kwal_55.19663 s55 complement(70935..72569) [1635 bp, 544 aa] {ON...   915   0.0  
KAFR0H00160 Chr8 complement(16235..17884) [1650 bp, 549 aa] {ON}...   910   0.0  
Kpol_1043.75 s1043 (162051..163727) [1677 bp, 558 aa] {ON} (1620...   865   0.0  
TPHA0E00170 Chr5 complement(16873..18609) [1737 bp, 578 aa] {ON}...   860   0.0  
TBLA0E01700 Chr5 complement(408779..410509) [1731 bp, 576 aa] {O...   844   0.0  
Suva_7.275 Chr7 complement(476201..476281,476285..476410,476414....    65   3e-12
TPHA0O00600 Chr15 complement(107944..112062) [4119 bp, 1372 aa] ...    35   0.66 
Kwal_56.24265 s56 complement(928206..928859) [654 bp, 217 aa] {O...    33   1.2  
KLTH0F02024g Chr6 (161423..163627) [2205 bp, 734 aa] {ON} simila...    33   1.5  

>AFR292W Chr6 (965578..967203) [1626 bp, 541 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKR097W (PCK1)
          Length = 541

 Score = 1131 bits (2925), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 541/541 (100%), Positives = 541/541 (100%)

Query: 1   MSPSKVYQTPEEKIRAELGLSSGVLTIRRNAPAAVLYEDALAERKTAISSTGALIAYSGE 60
           MSPSKVYQTPEEKIRAELGLSSGVLTIRRNAPAAVLYEDALAERKTAISSTGALIAYSGE
Sbjct: 1   MSPSKVYQTPEEKIRAELGLSSGVLTIRRNAPAAVLYEDALAERKTAISSTGALIAYSGE 60

Query: 61  KTGRSPKDKRIVDEPTSSDNIWWGPVNRKASEKTWLINRERAADFLRTREHLYIVDAYAG 120
           KTGRSPKDKRIVDEPTSSDNIWWGPVNRKASEKTWLINRERAADFLRTREHLYIVDAYAG
Sbjct: 61  KTGRSPKDKRIVDEPTSSDNIWWGPVNRKASEKTWLINRERAADFLRTREHLYIVDAYAG 120

Query: 121 WDPRYRIKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPANTHTEGMS 180
           WDPRYRIKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPANTHTEGMS
Sbjct: 121 WDPRYRIKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPANTHTEGMS 180

Query: 181 SKTTVEINFRAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQGPNNDVTL 240
           SKTTVEINFRAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQGPNNDVTL
Sbjct: 181 SKTTVEINFRAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQGPNNDVTL 240

Query: 241 FFGLSGTGKTTLSADQHRKLIGDDEHCWSDYGVFNIEGGCYAKCIGLSGEKEPEIFNAIK 300
           FFGLSGTGKTTLSADQHRKLIGDDEHCWSDYGVFNIEGGCYAKCIGLSGEKEPEIFNAIK
Sbjct: 241 FFGLSGTGKTTLSADQHRKLIGDDEHCWSDYGVFNIEGGCYAKCIGLSGEKEPEIFNAIK 300

Query: 301 YGSVLENVVYDPVTRVVDYEDSSITENTRCAYPIEYIPSAQIPCLSENHPSNIVLLTCDA 360
           YGSVLENVVYDPVTRVVDYEDSSITENTRCAYPIEYIPSAQIPCLSENHPSNIVLLTCDA
Sbjct: 301 YGSVLENVVYDPVTRVVDYEDSSITENTRCAYPIEYIPSAQIPCLSENHPSNIVLLTCDA 360

Query: 361 SGVLPPVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYATM 420
           SGVLPPVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYATM
Sbjct: 361 SGVLPPVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYATM 420

Query: 421 LAEKMSQHNASAWLINTGWTGSSYTAGGKRCPLKYTRAILDSIHDGTLAQAEYETLPVFG 480
           LAEKMSQHNASAWLINTGWTGSSYTAGGKRCPLKYTRAILDSIHDGTLAQAEYETLPVFG
Sbjct: 421 LAEKMSQHNASAWLINTGWTGSSYTAGGKRCPLKYTRAILDSIHDGTLAQAEYETLPVFG 480

Query: 481 LSIPKAVEGVPAELLNPAKNWVEGEGKYASAVSALASKFTENFKIYQDQATEEVVRAGPQ 540
           LSIPKAVEGVPAELLNPAKNWVEGEGKYASAVSALASKFTENFKIYQDQATEEVVRAGPQ
Sbjct: 481 LSIPKAVEGVPAELLNPAKNWVEGEGKYASAVSALASKFTENFKIYQDQATEEVVRAGPQ 540

Query: 541 I 541
           I
Sbjct: 541 I 541

>Ecym_4013 Chr4 complement(31078..32706) [1629 bp, 542 aa] {ON}
           similar to Ashbya gossypii AFR292W
          Length = 542

 Score = 1033 bits (2670), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 484/542 (89%), Positives = 520/542 (95%), Gaps = 1/542 (0%)

Query: 1   MSPSKVYQTPEEKIRAELGLSSGVLTIRRNAPAAVLYEDALAERKTAISSTGALIAYSGE 60
           MSPSKV+Q+PEEKIR+ELGLSSGVL IRRNAPAA+LYEDAL ER TAISSTGALIAYSGE
Sbjct: 1   MSPSKVFQSPEEKIRSELGLSSGVLIIRRNAPAALLYEDALLERNTAISSTGALIAYSGE 60

Query: 61  KTGRSPKDKRIVDEPTSSDNIWWGPVNRKASEKTWLINRERAADFLRTREHLYIVDAYAG 120
           KTGRSPKDKRIVDEPTS++ +WWGPVNRK SE+TW INRERA D+LRTREHLYIVDA+AG
Sbjct: 61  KTGRSPKDKRIVDEPTSANKVWWGPVNRKVSERTWDINRERAVDYLRTREHLYIVDAFAG 120

Query: 121 WDPRYRIKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPANTHTEGMS 180
           WDPRYRIKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPANTHTEGMS
Sbjct: 121 WDPRYRIKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPANTHTEGMS 180

Query: 181 SKTTVEINFRAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQG-PNNDVT 239
           SKTTVEINF+AMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQG    DVT
Sbjct: 181 SKTTVEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQGIAKGDVT 240

Query: 240 LFFGLSGTGKTTLSADQHRKLIGDDEHCWSDYGVFNIEGGCYAKCIGLSGEKEPEIFNAI 299
           LFFGLSGTGKTTLSADQHR LIGDDEHCWSDYGVFNIEGGCYAKCIGLS EKEPEIFNAI
Sbjct: 241 LFFGLSGTGKTTLSADQHRLLIGDDEHCWSDYGVFNIEGGCYAKCIGLSAEKEPEIFNAI 300

Query: 300 KYGSVLENVVYDPVTRVVDYEDSSITENTRCAYPIEYIPSAQIPCLSENHPSNIVLLTCD 359
           +YGSVLENVVY+PV+RVVDY+DSSITENTRCAYPIEYIPSA+IPCLS +HPSNIVLLTCD
Sbjct: 301 RYGSVLENVVYEPVSRVVDYDDSSITENTRCAYPIEYIPSAKIPCLSNSHPSNIVLLTCD 360

Query: 360 ASGVLPPVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYAT 419
           ASGVLPPVS+LTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYAT
Sbjct: 361 ASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYAT 420

Query: 420 MLAEKMSQHNASAWLINTGWTGSSYTAGGKRCPLKYTRAILDSIHDGTLAQAEYETLPVF 479
           MLAEKMSQHNA+AWLINTGWTG+SY +GGKRCPLKYTRAILD+IH G+LA A+YETLPVF
Sbjct: 421 MLAEKMSQHNANAWLINTGWTGASYVSGGKRCPLKYTRAILDAIHGGSLANADYETLPVF 480

Query: 480 GLSIPKAVEGVPAELLNPAKNWVEGEGKYASAVSALASKFTENFKIYQDQATEEVVRAGP 539
           GLSIP+AVEGVP+ELLNP++NWVEGE KY+ AV++LA+ F +NFKIYQDQAT+EV+ AGP
Sbjct: 481 GLSIPRAVEGVPSELLNPSRNWVEGEEKYSKAVTSLANLFVQNFKIYQDQATKEVLYAGP 540

Query: 540 QI 541
           Q+
Sbjct: 541 QL 542

>SAKL0E15048g Chr5 (1251927..1253555) [1629 bp, 542 aa] {ON} highly
           similar to uniprot|P10963 Saccharomyces cerevisiae
           YKR097W PCK1 Phosphoenolpyruvate carboxykinase key
           enzyme in gluconeogenesis catalyzes early reaction in
           carbohydrate biosynthesis glucose represses
           transcription and accelerates mRNA degradation regulated
           by Mcm1p and Cat8p located in the cytosol
          Length = 542

 Score =  988 bits (2554), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/542 (84%), Positives = 501/542 (92%), Gaps = 1/542 (0%)

Query: 1   MSPSKVYQTPEEKIRAELGLSSGVLTIRRNAPAAVLYEDALAERKTAISSTGALIAYSGE 60
           MSPSK Y + E++IR EL LS  V+TIRRNAPAA+LYEDAL ERKT ISS+GALIAYSGE
Sbjct: 1   MSPSKTYASAEQRIRNELDLSDEVVTIRRNAPAALLYEDALKERKTTISSSGALIAYSGE 60

Query: 61  KTGRSPKDKRIVDEPTSSDNIWWGPVNRKASEKTWLINRERAADFLRTREHLYIVDAYAG 120
           KTGRSP+DKRIVDE TS+DN+WWGPVN+K SE+TW INRERAAD+LRTR+HLYIVDAYAG
Sbjct: 61  KTGRSPRDKRIVDESTSTDNVWWGPVNKKCSERTWQINRERAADYLRTRDHLYIVDAYAG 120

Query: 121 WDPRYRIKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPANTHTEGMS 180
           WDPRYRIK+R+VC RAYHALFMTNMLIRPTE+ELAEFGEPDFTVWNAGQFPANTHT GM+
Sbjct: 121 WDPRYRIKVRVVCARAYHALFMTNMLIRPTEQELAEFGEPDFTVWNAGQFPANTHTTGMT 180

Query: 181 SKTTVEINFRAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQG-PNNDVT 239
           SKTTVEINF+ MEM+ILGTEYAGEMKKGIFTVMFYLMP+NHNVLTLHSSANQG  +NDVT
Sbjct: 181 SKTTVEINFKEMEMIILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIADNDVT 240

Query: 240 LFFGLSGTGKTTLSADQHRKLIGDDEHCWSDYGVFNIEGGCYAKCIGLSGEKEPEIFNAI 299
           LFFGLSGTGKTTLSAD HR LIGDDEHCWSD+GVFNIEGGCYAKCIGLS EKEPEI+NAI
Sbjct: 241 LFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCIGLSAEKEPEIYNAI 300

Query: 300 KYGSVLENVVYDPVTRVVDYEDSSITENTRCAYPIEYIPSAQIPCLSENHPSNIVLLTCD 359
           K+GSVLENV+Y+P TR VDYEDSSITENTRCAYPI+YIPSA+IPCL++NHPSNIVLLTCD
Sbjct: 301 KFGSVLENVIYNPQTREVDYEDSSITENTRCAYPIDYIPSAKIPCLADNHPSNIVLLTCD 360

Query: 360 ASGVLPPVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYAT 419
           ASGVLPPVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYAT
Sbjct: 361 ASGVLPPVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYAT 420

Query: 420 MLAEKMSQHNASAWLINTGWTGSSYTAGGKRCPLKYTRAILDSIHDGTLAQAEYETLPVF 479
           MLAEKM++HNA+AWLINTGWTGSSY +GGKRCPLKYTRAILDSIHDG+LA+ +YETLP F
Sbjct: 421 MLAEKMAKHNANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAKEKYETLPTF 480

Query: 480 GLSIPKAVEGVPAELLNPAKNWVEGEGKYASAVSALASKFTENFKIYQDQATEEVVRAGP 539
            L IP  V  VP+ELLNPAKNW+EGE KY SAV  LA  F ENFK YQD+AT +V+ AGP
Sbjct: 481 NLEIPTRVNNVPSELLNPAKNWIEGEAKYTSAVQNLAQLFVENFKTYQDRATSQVLSAGP 540

Query: 540 QI 541
           Q+
Sbjct: 541 QL 542

>KLLA0A00484g Chr1 complement(40330..41961) [1632 bp, 543 aa] {ON}
           highly similar to uniprot|P10963 Saccharomyces
           cerevisiae YKR097W PCK1 Phosphoenolpyruvate
           carboxykinase key enzyme in gluconeogenesis catalyzes
           early reaction in carbohydrate biosynthesis glucose
           represses transcription and accelerates mRNA degradation
           regulated by Mcm1p and Cat8p located in the cytosol
          Length = 543

 Score =  966 bits (2497), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/543 (82%), Positives = 499/543 (91%), Gaps = 2/543 (0%)

Query: 1   MSPSKVYQTPEEKIRAELGLSSGVLTIRRNAPAAVLYEDALAERKTAISSTGALIAYSGE 60
           MSP+K   + EE IRAELGLS+ V+TIRRNAPAA+LYEDAL ER TAIS+ GALIAYSG+
Sbjct: 1   MSPTKTQNSAEENIRAELGLSAEVVTIRRNAPAALLYEDALKERDTAISNAGALIAYSGD 60

Query: 61  KTGRSPKDKRIVDEPTSSDNIWWGPVNRKASEKTWLINRERAADFLRTREHLYIVDAYAG 120
           KTGRSP+DKRIV+E TS DN+WWGPVN+  SE+TW INRERAAD+LRTR+H+YIVDAYAG
Sbjct: 61  KTGRSPRDKRIVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHIYIVDAYAG 120

Query: 121 WDPRYRIKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPANTHTEGMS 180
           WDPRYRIK+R+VC RAYHALFMTNMLIRP++EEL  FGEPDFTVWNAGQFPANTHT GM+
Sbjct: 121 WDPRYRIKVRVVCARAYHALFMTNMLIRPSKEELENFGEPDFTVWNAGQFPANTHTSGMT 180

Query: 181 SKTTVEINFRAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQG-PNNDVT 239
           SKTTVEINF+ MEMVILGTEYAGEMKKGIFTVMFYLMP+NHNVLTLHSSANQG  +NDVT
Sbjct: 181 SKTTVEINFKQMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIQDNDVT 240

Query: 240 LFFGLSGTGKTTLSADQHRKLIGDDEHCWSDYGVFNIEGGCYAKCIGLSGEKEPEIFNAI 299
           LFFGLSGTGKTTLSAD HR LIGDDEHCWSD+GVFNIEGGCYAKC+GLS EKEPEIFNAI
Sbjct: 241 LFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCLGLSAEKEPEIFNAI 300

Query: 300 KYGSVLENVVYDPVTRVVDYEDSSITENTRCAYPIEYIPSAQIPCLSENHPSNIVLLTCD 359
           K+GSVLEN++YDP TR VDYEDS+ITENTRCAYPIEYIPSA+IPCL+++HP NIVLLTCD
Sbjct: 301 KFGSVLENIIYDPNTREVDYEDSTITENTRCAYPIEYIPSAKIPCLADHHPKNIVLLTCD 360

Query: 360 ASGVLPPVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYAT 419
           ASGVLPPVS+LTP+QVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFL+LHPMKYAT
Sbjct: 361 ASGVLPPVSKLTPDQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLSLHPMKYAT 420

Query: 420 MLAEKMSQHNASAWLINTGWTGSSYTAGGKRCPLKYTRAILDSIHDGTLAQAEYETLPVF 479
           MLAEKM++HNA+AWLINTGWTGSSY AGGKRCPLKYTRAILD+IHDG+LA+ EYE LP+F
Sbjct: 421 MLAEKMAEHNANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKEEYEVLPIF 480

Query: 480 GLSIPKAV-EGVPAELLNPAKNWVEGEGKYASAVSALASKFTENFKIYQDQATEEVVRAG 538
            L IPKAV + VPA LLNP+KNW EGE KY S V +LA+ F ENFK YQD+ATE+V+ AG
Sbjct: 481 NLQIPKAVGDKVPASLLNPSKNWAEGEAKYTSNVKSLANLFVENFKTYQDKATEQVLAAG 540

Query: 539 PQI 541
           PQ+
Sbjct: 541 PQL 543

>TDEL0B02120 Chr2 complement(377690..379336) [1647 bp, 548 aa] {ON}
           Anc_5.708 YKR097W
          Length = 548

 Score =  957 bits (2474), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/548 (81%), Positives = 498/548 (90%), Gaps = 7/548 (1%)

Query: 1   MSPSKVYQTP------EEKIRAELGLSSGVLTIRRNAPAAVLYEDALAERKTAISSTGAL 54
           MSPSK+ ++       E+KIR EL LS+ V+TIRRNAPAA+LYEDAL E+KT I+S+GAL
Sbjct: 1   MSPSKMNRSVTDVSEVEQKIRDELSLSNEVITIRRNAPAAILYEDALNEKKTTIASSGAL 60

Query: 55  IAYSGEKTGRSPKDKRIVDEPTSSDNIWWGPVNRKASEKTWLINRERAADFLRTREHLYI 114
           IAYSG+KTGRSPKDKRI++E TS DNIWWGPVN+   EKTW INRERAAD+LRTR HLYI
Sbjct: 61  IAYSGDKTGRSPKDKRIIEEETSKDNIWWGPVNKPLPEKTWSINRERAADYLRTRTHLYI 120

Query: 115 VDAYAGWDPRYRIKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPANT 174
           VDA+AGWDPRYRIK+R+VC RAYHALFMTNMLIRPT+EELA FGEPDFTVWNAGQFPAN 
Sbjct: 121 VDAFAGWDPRYRIKVRVVCARAYHALFMTNMLIRPTDEELAHFGEPDFTVWNAGQFPANY 180

Query: 175 HTEGMSSKTTVEINFRAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQG- 233
           HT+GMSSKTTVEINF+AMEM+ILGTEYAGEMKKGIFTVMFYLMP++HNVLTLHSSANQG 
Sbjct: 181 HTQGMSSKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240

Query: 234 PNNDVTLFFGLSGTGKTTLSADQHRKLIGDDEHCWSDYGVFNIEGGCYAKCIGLSGEKEP 293
             NDVTLFFGLSGTGKTTLSAD HRKLIGDDEHCWSD+GVFNIEGGCYAKCIGL+ EKEP
Sbjct: 241 QKNDVTLFFGLSGTGKTTLSADPHRKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTAEKEP 300

Query: 294 EIFNAIKYGSVLENVVYDPVTRVVDYEDSSITENTRCAYPIEYIPSAQIPCLSENHPSNI 353
           EI+NAIK+GS+LENVVYDP TR VDYEDSSITENTRCAYPIE+IPSA+IPCL+++HP N+
Sbjct: 301 EIYNAIKFGSILENVVYDPKTRDVDYEDSSITENTRCAYPIEHIPSAKIPCLADSHPQNL 360

Query: 354 VLLTCDASGVLPPVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALH 413
           VLLTCDASGVLPP+S+LTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALH
Sbjct: 361 VLLTCDASGVLPPISKLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALH 420

Query: 414 PMKYATMLAEKMSQHNASAWLINTGWTGSSYTAGGKRCPLKYTRAILDSIHDGTLAQAEY 473
           P++YATMLA+KMS+H A+AWLINTGWTGSSY AGGKRCPLKYTRAILD+IHDG+LA+  Y
Sbjct: 421 PIRYATMLAKKMSEHRANAWLINTGWTGSSYVAGGKRCPLKYTRAILDAIHDGSLAKESY 480

Query: 474 ETLPVFGLSIPKAVEGVPAELLNPAKNWVEGEGKYASAVSALASKFTENFKIYQDQATEE 533
           ETLP F L IP  V GVP ELLNP+KNWVEGE KY +AV+ LA  F ENFKIYQD+AT E
Sbjct: 481 ETLPTFNLHIPTKVNGVPKELLNPSKNWVEGEAKYNTAVNNLAKLFVENFKIYQDRATPE 540

Query: 534 VVRAGPQI 541
           V+ AGPQ+
Sbjct: 541 VLAAGPQV 548

>NCAS0A03160 Chr1 complement(619303..620961) [1659 bp, 552 aa] {ON}
           Anc_5.708 YKR097W
          Length = 552

 Score =  945 bits (2442), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/552 (79%), Positives = 490/552 (88%), Gaps = 11/552 (1%)

Query: 1   MSPSKVY----------QTPEEKIRAELGLSSGVLTIRRNAPAAVLYEDALAERKTAISS 50
           MSP KV           Q  E+ IR ELGLS  V TIRRNAPAAVLYEDAL ERKT I+S
Sbjct: 1   MSPIKVSSSKPIDISDSQIVEQSIRKELGLSEDVTTIRRNAPAAVLYEDALHERKTVIAS 60

Query: 51  TGALIAYSGEKTGRSPKDKRIVDEPTSSDNIWWGPVNRKASEKTWLINRERAADFLRTRE 110
           +GALIAYSG KTGRSP+DKRIV+E TS DN+WWGPVN+  SEKTW INRERAAD+LRTR+
Sbjct: 61  SGALIAYSGSKTGRSPRDKRIVEEETSKDNVWWGPVNKPCSEKTWTINRERAADYLRTRD 120

Query: 111 HLYIVDAYAGWDPRYRIKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQF 170
           HLYIVDA+AGWDP+YRIK+R+VC RAYHA+FMTNMLIRPT+EELA FGEPDFT+WNAGQF
Sbjct: 121 HLYIVDAFAGWDPKYRIKVRVVCARAYHAIFMTNMLIRPTQEELATFGEPDFTIWNAGQF 180

Query: 171 PANTHTEGMSSKTTVEINFRAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSA 230
           PAN +T+ MSSKTT+EINF+AMEM+ILGTEYAGEMKKGIFTVMFYLMP+ HN+LTLHSSA
Sbjct: 181 PANKNTQDMSSKTTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVYHNILTLHSSA 240

Query: 231 NQG-PNNDVTLFFGLSGTGKTTLSADQHRKLIGDDEHCWSDYGVFNIEGGCYAKCIGLSG 289
           NQG  N DVTLFFGLSGTGKTTLSAD HR LIGDDEHCWSD GVFNIEGGCYAKCI LS 
Sbjct: 241 NQGIQNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSA 300

Query: 290 EKEPEIFNAIKYGSVLENVVYDPVTRVVDYEDSSITENTRCAYPIEYIPSAQIPCLSENH 349
           EKEPEIFNAIKYGS+LENV+YD  TRVVDY+D+SITENTRCAYPIEYIPSA+IPCL+++H
Sbjct: 301 EKEPEIFNAIKYGSILENVIYDKNTRVVDYDDTSITENTRCAYPIEYIPSAKIPCLADSH 360

Query: 350 PSNIVLLTCDASGVLPPVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPF 409
           P NI+LLTCDASGVLPPVS+LTPEQVMYHFISGYTSKMAGTE+GVTEPE+TFSSCFGQPF
Sbjct: 361 PKNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEEGVTEPESTFSSCFGQPF 420

Query: 410 LALHPMKYATMLAEKMSQHNASAWLINTGWTGSSYTAGGKRCPLKYTRAILDSIHDGTLA 469
           LALHP++YATMLAEK+S H+A AWLINTGWTGSSY  GGKRCPLKYTRAILDSIHDG+LA
Sbjct: 421 LALHPIRYATMLAEKISHHSADAWLINTGWTGSSYVNGGKRCPLKYTRAILDSIHDGSLA 480

Query: 470 QAEYETLPVFGLSIPKAVEGVPAELLNPAKNWVEGEGKYASAVSALASKFTENFKIYQDQ 529
           +  YETLP+F LS+P AV GVP E+LNPAKNW EGE KY++AVS L S F ENFK YQD+
Sbjct: 481 KQSYETLPIFNLSVPTAVNGVPKEILNPAKNWSEGEAKYSTAVSKLGSLFVENFKTYQDR 540

Query: 530 ATEEVVRAGPQI 541
           AT +V+ AGPQI
Sbjct: 541 ATPDVLAAGPQI 552

>NDAI0E05080 Chr5 (1165969..1167624) [1656 bp, 551 aa] {ON}
           Anc_5.708 YKR097W
          Length = 551

 Score =  942 bits (2434), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/551 (80%), Positives = 490/551 (88%), Gaps = 10/551 (1%)

Query: 1   MSPSKVYQTP---------EEKIRAELGLSSGVLTIRRNAPAAVLYEDALAERKTAISST 51
           MSP K   TP         E+KIR EL LS  V TIRRNAPAA+LYEDAL ER T ISST
Sbjct: 1   MSPIKASNTPIDPTDSNQVEQKIRQELDLSKDVTTIRRNAPAAILYEDALHERNTIISST 60

Query: 52  GALIAYSGEKTGRSPKDKRIVDEPTSSDNIWWGPVNRKASEKTWLINRERAADFLRTREH 111
           GAL+AYSGEKTGRSP+DKRIV+E TS D+IWWGPVN+  SE+TW INRERAAD+LRTR+H
Sbjct: 61  GALVAYSGEKTGRSPRDKRIVEEETSKDDIWWGPVNKPCSERTWSINRERAADYLRTRDH 120

Query: 112 LYIVDAYAGWDPRYRIKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFP 171
           LYIVDA+AGWDP YRIK+R+VC RAYHALFMTNMLIRPT+EELAEFGEPDFTVWNAGQFP
Sbjct: 121 LYIVDAFAGWDPEYRIKVRVVCARAYHALFMTNMLIRPTQEELAEFGEPDFTVWNAGQFP 180

Query: 172 ANTHTEGMSSKTTVEINFRAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSAN 231
           AN HT+ MSSKTT+EINF+AMEMVILGTEYAGEMKKGIFTVMFYLMP++HN+LTLHSSAN
Sbjct: 181 ANFHTQDMSSKTTIEINFKAMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSAN 240

Query: 232 QG-PNNDVTLFFGLSGTGKTTLSADQHRKLIGDDEHCWSDYGVFNIEGGCYAKCIGLSGE 290
           QG  N DVTLFFGLSGTGKTTLSAD HR LIGDDEHCWSD GVFNIEGGCYAKCI LS E
Sbjct: 241 QGIRNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDKGVFNIEGGCYAKCINLSHE 300

Query: 291 KEPEIFNAIKYGSVLENVVYDPVTRVVDYEDSSITENTRCAYPIEYIPSAQIPCLSENHP 350
           KEPEIF AIKYGS+LENV+YDP TRVV Y+DS++TENTRCAYPIE+IPSA+IPCL++ HP
Sbjct: 301 KEPEIFEAIKYGSILENVIYDPKTRVVHYDDSTLTENTRCAYPIEFIPSAKIPCLADTHP 360

Query: 351 SNIVLLTCDASGVLPPVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFL 410
           SNI+LLTCDASGVLPPVS+LTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFL
Sbjct: 361 SNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFL 420

Query: 411 ALHPMKYATMLAEKMSQHNASAWLINTGWTGSSYTAGGKRCPLKYTRAILDSIHDGTLAQ 470
           ALHP++YATMLA+K+S+H+A+AWLINTGWTGSSY +GGKRCPLKYTRAILDSIHDG+LA+
Sbjct: 421 ALHPIRYATMLAKKISKHSANAWLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLAK 480

Query: 471 AEYETLPVFGLSIPKAVEGVPAELLNPAKNWVEGEGKYASAVSALASKFTENFKIYQDQA 530
            E+ETLPVF L +P  V  VP ELLNPAKNW +GE KY +AVS LAS F ENFKIYQD+A
Sbjct: 481 QEFETLPVFNLQVPTNVNNVPKELLNPAKNWAQGEAKYNAAVSNLASLFVENFKIYQDKA 540

Query: 531 TEEVVRAGPQI 541
           T EV+ A P+I
Sbjct: 541 TPEVLAAAPRI 551

>YKR097W Chr11 (631152..632801) [1650 bp, 549 aa] {ON}
           PCK1Phosphoenolpyruvate carboxykinase, key enzyme in
           gluconeogenesis, catalyzes early reaction in
           carbohydrate biosynthesis, glucose represses
           transcription and accelerates mRNA degradation,
           regulated by Mcm1p and Cat8p, located in the cytosol
          Length = 549

 Score =  937 bits (2422), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/548 (80%), Positives = 487/548 (88%), Gaps = 7/548 (1%)

Query: 1   MSPSKVYQTP------EEKIRAELGLSSGVLTIRRNAPAAVLYEDALAERKTAISSTGAL 54
           MSPSK+  T       E+KIR EL LS  V TIRRNAPAAVLYED L E KT ISS+GAL
Sbjct: 1   MSPSKMNATVGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKENKTVISSSGAL 60

Query: 55  IAYSGEKTGRSPKDKRIVDEPTSSDNIWWGPVNRKASEKTWLINRERAADFLRTREHLYI 114
           IAYSG KTGRSPKDKRIV+EPTS D IWWGPVN+  SE+TW INRERAAD+LRTR+H+YI
Sbjct: 61  IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 120

Query: 115 VDAYAGWDPRYRIKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPANT 174
           VDA+AGWDP+YRIK+R+VC RAYHALFMTNMLIRPTEEELA FGEPDFTVWNAGQFPAN 
Sbjct: 121 VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 180

Query: 175 HTEGMSSKTTVEINFRAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQG- 233
           HT+ MSSK+T+EINF+AMEM+ILGTEYAGEMKKGIFTVMFYLMP++HNVLTLHSSANQG 
Sbjct: 181 HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240

Query: 234 PNNDVTLFFGLSGTGKTTLSADQHRKLIGDDEHCWSDYGVFNIEGGCYAKCIGLSGEKEP 293
            N DVTLFFGLSGTGKTTLSAD HR LIGDDEHCWSD+GVFNIEGGCYAKCI LS EKEP
Sbjct: 241 QNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEP 300

Query: 294 EIFNAIKYGSVLENVVYDPVTRVVDYEDSSITENTRCAYPIEYIPSAQIPCLSENHPSNI 353
           EIF+AIK+GSVLENV+YD  + VVDY+DSSITENTRCAYPI+YIPSA+IPCL+++HP NI
Sbjct: 301 EIFDAIKFGSVLENVIYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 360

Query: 354 VLLTCDASGVLPPVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALH 413
           +LLTCDASGVLPPVS+LTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFLALH
Sbjct: 361 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 420

Query: 414 PMKYATMLAEKMSQHNASAWLINTGWTGSSYTAGGKRCPLKYTRAILDSIHDGTLAQAEY 473
           P++YATMLA KMSQH A+A+LINTGWTGSSY +GGKRCPLKYTRAILDSIHDG+LA   Y
Sbjct: 421 PIRYATMLATKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETY 480

Query: 474 ETLPVFGLSIPKAVEGVPAELLNPAKNWVEGEGKYASAVSALASKFTENFKIYQDQATEE 533
           ETLP+F L +P  V GVPAELLNPAKNW +GE KY  AV+ LA+ F +NFKIYQD+AT +
Sbjct: 481 ETLPIFNLQVPTKVNGVPAELLNPAKNWSQGESKYRGAVTNLANLFVQNFKIYQDRATPD 540

Query: 534 VVRAGPQI 541
           V+ AGPQ 
Sbjct: 541 VLAAGPQF 548

>Smik_11.361 Chr11 (621197..622846) [1650 bp, 549 aa] {ON} YKR097W
           (REAL)
          Length = 549

 Score =  936 bits (2418), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/548 (79%), Positives = 489/548 (89%), Gaps = 7/548 (1%)

Query: 1   MSPSKVYQTP------EEKIRAELGLSSGVLTIRRNAPAAVLYEDALAERKTAISSTGAL 54
           MSPSK+  T       E+KIR EL LS  V TIRRNAPAAVLYED L E+KT ISS+GAL
Sbjct: 1   MSPSKMNCTVGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSSGAL 60

Query: 55  IAYSGEKTGRSPKDKRIVDEPTSSDNIWWGPVNRKASEKTWLINRERAADFLRTREHLYI 114
           IAYSG KTGRSPKDKRIV+EPTS D IWWGPVN+  SE+TW INRERAAD+LRTR+H+YI
Sbjct: 61  IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 120

Query: 115 VDAYAGWDPRYRIKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPANT 174
           VDA+AGWDP+YRIK+R+VC RAYHALFMTNMLIRPTEEELA FGEPDFTVWNAGQFPAN 
Sbjct: 121 VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 180

Query: 175 HTEGMSSKTTVEINFRAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQG- 233
           HT+ MSSK+T+EINF+AMEM+ILGTEYAGEMKKGIFTVMFYLMP++HNVLTLHSSANQG 
Sbjct: 181 HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240

Query: 234 PNNDVTLFFGLSGTGKTTLSADQHRKLIGDDEHCWSDYGVFNIEGGCYAKCIGLSGEKEP 293
            N DVTLFFGLSGTGKTTLSAD HR LIGDDEHCWSD+GVFNIEGGCYAKCI LS EKEP
Sbjct: 241 QNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEP 300

Query: 294 EIFNAIKYGSVLENVVYDPVTRVVDYEDSSITENTRCAYPIEYIPSAQIPCLSENHPSNI 353
           EIF+AIK+G+VLENV YD  + VVDY+DSSITENTRCAYPI+YIPSA+IPCL+++HP NI
Sbjct: 301 EIFDAIKFGAVLENVKYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 360

Query: 354 VLLTCDASGVLPPVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALH 413
           +LLTCDASGVLPPVS+LTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFLALH
Sbjct: 361 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 420

Query: 414 PMKYATMLAEKMSQHNASAWLINTGWTGSSYTAGGKRCPLKYTRAILDSIHDGTLAQAEY 473
           P++YATMLA KMSQH A+A+LINTGWTGSSY +GGKRCPLKYTRAILDSIHDG+LA   Y
Sbjct: 421 PIRYATMLAAKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETY 480

Query: 474 ETLPVFGLSIPKAVEGVPAELLNPAKNWVEGEGKYASAVSALASKFTENFKIYQDQATEE 533
           E+LP+F L +P  V+GVPAELLNPAKNW +GE KY  AV++LA+ F ENFKIYQD+AT +
Sbjct: 481 ESLPIFNLQVPTKVKGVPAELLNPAKNWSQGETKYKGAVTSLATLFVENFKIYQDRATPD 540

Query: 534 VVRAGPQI 541
           V+ AGPQ 
Sbjct: 541 VLAAGPQF 548

>ZYRO0B16456g Chr2 (1334967..1336613) [1647 bp, 548 aa] {ON} highly
           similar to uniprot|P10963 Saccharomyces cerevisiae
           YKR097W PCK1 Phosphoenolpyruvate carboxykinase key
           enzyme in gluconeogenesis catalyzes early reaction in
           carbohydrate biosynthesis glucose represses
           transcription and accelerates mRNA degradation regulated
           by Mcm1p and Cat8p located in the cytosol
          Length = 548

 Score =  935 bits (2417), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/548 (80%), Positives = 486/548 (88%), Gaps = 7/548 (1%)

Query: 1   MSPSKV------YQTPEEKIRAELGLSSGVLTIRRNAPAAVLYEDALAERKTAISSTGAL 54
           MSPSKV          EE+IR EL L S V+TIR NAPAA LYED L E+KTA+ S+GAL
Sbjct: 1   MSPSKVPVPITDTAEVEEQIRKELALGSEVVTIRHNAPAATLYEDGLKEKKTAVVSSGAL 60

Query: 55  IAYSGEKTGRSPKDKRIVDEPTSSDNIWWGPVNRKASEKTWLINRERAADFLRTREHLYI 114
            AYSG KTGRSPKDKRI++E TS + +WWGPVN+ ASEKTW INRERAAD+LRTR+HLYI
Sbjct: 61  AAYSGSKTGRSPKDKRIIEEETSKNEVWWGPVNKPASEKTWSINRERAADYLRTRDHLYI 120

Query: 115 VDAYAGWDPRYRIKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPANT 174
           +DAYAGWDPRYRIK+R++C RAYHALFMTNMLIRP+ EELA FGEPDFTVWNAGQFPAN 
Sbjct: 121 IDAYAGWDPRYRIKVRVICARAYHALFMTNMLIRPSPEELANFGEPDFTVWNAGQFPANR 180

Query: 175 HTEGMSSKTTVEINFRAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQG- 233
           +TEGM+SKTTVEINF+AMEM+ILGTEYAGEMKKGIFTVMFYLMP++HNVLTLHSSANQG 
Sbjct: 181 NTEGMTSKTTVEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240

Query: 234 PNNDVTLFFGLSGTGKTTLSADQHRKLIGDDEHCWSDYGVFNIEGGCYAKCIGLSGEKEP 293
              DVTLFFGLSGTGKTTLSAD HR LIGDDEHCWSD+GVFNIEGGCYAKCI L+ EKEP
Sbjct: 241 ERGDVTLFFGLSGTGKTTLSADPHRALIGDDEHCWSDHGVFNIEGGCYAKCIDLTAEKEP 300

Query: 294 EIFNAIKYGSVLENVVYDPVTRVVDYEDSSITENTRCAYPIEYIPSAQIPCLSENHPSNI 353
           EI+NAIK+GSVLENVV+D   R VDY D+SITENTRCAYPI+YIPSA+IPCL++ HPSNI
Sbjct: 301 EIYNAIKFGSVLENVVFDASNREVDYTDNSITENTRCAYPIDYIPSAKIPCLADKHPSNI 360

Query: 354 VLLTCDASGVLPPVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALH 413
           VLLTCDASGVLPPVS+LTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFLALH
Sbjct: 361 VLLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPETTFSSCFGQPFLALH 420

Query: 414 PMKYATMLAEKMSQHNASAWLINTGWTGSSYTAGGKRCPLKYTRAILDSIHDGTLAQAEY 473
           PM+YATMLA+KM QHNA+AWL+NTGWTGSSYTAGGKRCPLKYTRAILDSIHDG+L++A+Y
Sbjct: 421 PMRYATMLAKKMHQHNANAWLVNTGWTGSSYTAGGKRCPLKYTRAILDSIHDGSLSKADY 480

Query: 474 ETLPVFGLSIPKAVEGVPAELLNPAKNWVEGEGKYASAVSALASKFTENFKIYQDQATEE 533
           ETLP+F L  P  V GVP  LLNPAK+WVEG  KY SAV  LA+KFTENFKIYQDQAT +
Sbjct: 481 ETLPIFNLHTPAKVNGVPDSLLNPAKSWVEGPTKYNSAVKTLATKFTENFKIYQDQATPD 540

Query: 534 VVRAGPQI 541
           V+ AGPQ 
Sbjct: 541 VLAAGPQF 548

>KLTH0E00902g Chr5 complement(88552..90186) [1635 bp, 544 aa] {ON}
           highly similar to uniprot|P10963 Saccharomyces
           cerevisiae YKR097W PCK1 Phosphoenolpyruvate
           carboxykinase key enzyme in gluconeogenesis catalyzes
           early reaction in carbohydrate biosynthesis glucose
           represses transcription and accelerates mRNA degradation
           regulated by Mcm1p and Cat8p located in the cytosol
          Length = 544

 Score =  934 bits (2414), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/544 (80%), Positives = 485/544 (89%), Gaps = 3/544 (0%)

Query: 1   MSPSKV--YQTPEEKIRAELGLSSGVLTIRRNAPAAVLYEDALAERKTAISSTGALIAYS 58
           MSP+K   + + ++ IR EL L   V+TIRRNAPAA+LYEDAL E KT I+S+GALIA+S
Sbjct: 1   MSPTKTRNHVSAKDHIRQELALGEEVVTIRRNAPAALLYEDALKENKTTIASSGALIAFS 60

Query: 59  GEKTGRSPKDKRIVDEPTSSDNIWWGPVNRKASEKTWLINRERAADFLRTREHLYIVDAY 118
           G KTGRSPKDKRIVDEPTS+ NIWWGPVN+K SEKTWL+NRERAAD+LRTR+HLYIVDAY
Sbjct: 61  GSKTGRSPKDKRIVDEPTSTHNIWWGPVNKKCSEKTWLVNRERAADYLRTRDHLYIVDAY 120

Query: 119 AGWDPRYRIKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPANTHTEG 178
           AGWDPRYRIKIR+VC RAYHALFMTNMLIRPT+EEL  FGEPDFTVWNAGQFPANTHT+G
Sbjct: 121 AGWDPRYRIKIRVVCARAYHALFMTNMLIRPTKEELENFGEPDFTVWNAGQFPANTHTDG 180

Query: 179 MSSKTTVEINFRAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQG-PNND 237
           M+SKTTVEINF+ MEMVILGTEYAGEMKKGIFTVMFYLMP+NHNVLTLHSSANQG  + D
Sbjct: 181 MTSKTTVEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGIRDQD 240

Query: 238 VTLFFGLSGTGKTTLSADQHRKLIGDDEHCWSDYGVFNIEGGCYAKCIGLSGEKEPEIFN 297
           VTLFFGLSGTGKTTLSAD  RKLIGDDEHCWSD+GVFNIEGGCYAKCIGL+  KEPEIFN
Sbjct: 241 VTLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEPEIFN 300

Query: 298 AIKYGSVLENVVYDPVTRVVDYEDSSITENTRCAYPIEYIPSAQIPCLSENHPSNIVLLT 357
           AIK+GSVLENV YDP+TRVVDYED  ITENTRCAYPIEYIPSA+IPCL+ +HP NIVLLT
Sbjct: 301 AIKFGSVLENVAYDPLTRVVDYEDCEITENTRCAYPIEYIPSAKIPCLANSHPKNIVLLT 360

Query: 358 CDASGVLPPVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKY 417
           CDASGVLPPVS+LTP QVMYHFISGYTSK+AGTE+GVTEPEATFSSCFGQPFLALHP+KY
Sbjct: 361 CDASGVLPPVSKLTPAQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALHPLKY 420

Query: 418 ATMLAEKMSQHNASAWLINTGWTGSSYTAGGKRCPLKYTRAILDSIHDGTLAQAEYETLP 477
           ATMLAEKMSQH A+AWLINTGWTG+S+  GG RCPLKYTRAILD++HDG+LAQ ++ETLP
Sbjct: 421 ATMLAEKMSQHRANAWLINTGWTGASFVDGGNRCPLKYTRAILDAVHDGSLAQEDFETLP 480

Query: 478 VFGLSIPKAVEGVPAELLNPAKNWVEGEGKYASAVSALASKFTENFKIYQDQATEEVVRA 537
            F L +P+ V  VP  +LNPAKNW EGE KY   V ALA  FTENFK YQD+A+ +V+ A
Sbjct: 481 TFRLHVPRHVNNVPEHILNPAKNWFEGETKYKHRVGALAKLFTENFKKYQDRASADVISA 540

Query: 538 GPQI 541
           GP +
Sbjct: 541 GPVL 544

>CAGL0H06633g Chr8 (659326..660960) [1635 bp, 544 aa] {ON} highly
           similar to uniprot|P10963 Saccharomyces cerevisiae
           YKR097w PCK1
          Length = 544

 Score =  931 bits (2406), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/532 (81%), Positives = 482/532 (90%), Gaps = 1/532 (0%)

Query: 11  EEKIRAELGLSSGVLTIRRNAPAAVLYEDALAERKTAISSTGALIAYSGEKTGRSPKDKR 70
           EE+IR+ELGLS  V  IRRNAPAAVLY+DAL E+KT ISS GALIAYSGEKTGRSPKDKR
Sbjct: 13  EERIRSELGLSKEVTLIRRNAPAAVLYQDALKEKKTVISSAGALIAYSGEKTGRSPKDKR 72

Query: 71  IVDEPTSSDNIWWGPVNRKASEKTWLINRERAADFLRTREHLYIVDAYAGWDPRYRIKIR 130
           IV+E TS DN+WWGPVN+  SE+TW INRERAAD+LRTRE LY+VDA+AGWDP+YRIK+R
Sbjct: 73  IVEEETSRDNVWWGPVNKPCSERTWAINRERAADYLRTRETLYVVDAFAGWDPKYRIKVR 132

Query: 131 IVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPANTHTEGMSSKTTVEINFR 190
           +VC RAYHALFMTNMLIRPTEEELA FGEPDFTVWNAGQFPAN  T+ M+SKTT+EINF+
Sbjct: 133 VVCARAYHALFMTNMLIRPTEEELANFGEPDFTVWNAGQFPANARTQDMTSKTTIEINFK 192

Query: 191 AMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQG-PNNDVTLFFGLSGTGK 249
           AMEMVILGTEYAGEMKKGIFTVMFYLMP++HNVLTLHSS NQG  N DVTLFFGLSGTGK
Sbjct: 193 AMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSCNQGIKNGDVTLFFGLSGTGK 252

Query: 250 TTLSADQHRKLIGDDEHCWSDYGVFNIEGGCYAKCIGLSGEKEPEIFNAIKYGSVLENVV 309
           TTLSAD HR LIGDDEHCWSD GVFNIEGGCYAKCI LS EKEPEIF+AI++GSVLENV+
Sbjct: 253 TTLSADPHRLLIGDDEHCWSDEGVFNIEGGCYAKCINLSREKEPEIFDAIRFGSVLENVI 312

Query: 310 YDPVTRVVDYEDSSITENTRCAYPIEYIPSAQIPCLSENHPSNIVLLTCDASGVLPPVSR 369
           YD  +  VDY+DSSITENTRCAYPI++IPSA+IPCL+  HP NI+LLTCDASGVLPPVS+
Sbjct: 313 YDSESHEVDYDDSSITENTRCAYPIDFIPSAKIPCLAPAHPKNIILLTCDASGVLPPVSK 372

Query: 370 LTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYATMLAEKMSQHN 429
           LTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFL+LHPM+YATMLAEKM +H+
Sbjct: 373 LTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLSLHPMRYATMLAEKMHEHS 432

Query: 430 ASAWLINTGWTGSSYTAGGKRCPLKYTRAILDSIHDGTLAQAEYETLPVFGLSIPKAVEG 489
           A+AWLINTGWTGSSY +GGKRC LKYTRAILD+IHDG+LA+AE+E+LP+F L +PKAVEG
Sbjct: 433 ANAWLINTGWTGSSYVSGGKRCALKYTRAILDAIHDGSLAKAEFESLPIFNLQVPKAVEG 492

Query: 490 VPAELLNPAKNWVEGEGKYASAVSALASKFTENFKIYQDQATEEVVRAGPQI 541
           VP+ELLNPA+NW EGE KY SAVS LA  F ENFK YQD+AT +V+ AGPQ+
Sbjct: 493 VPSELLNPARNWSEGEAKYQSAVSKLAGLFVENFKTYQDKATSDVLAAGPQL 544

>Skud_11.337 Chr11 (612752..614401) [1650 bp, 549 aa] {ON} YKR097W
           (REAL)
          Length = 549

 Score =  930 bits (2404), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/548 (79%), Positives = 487/548 (88%), Gaps = 7/548 (1%)

Query: 1   MSPSKVYQTP------EEKIRAELGLSSGVLTIRRNAPAAVLYEDALAERKTAISSTGAL 54
           MSPSK++ T       E+KIR EL LS  V TIRRNAPAAVLYED L E+KT ISS+GAL
Sbjct: 1   MSPSKMHATTGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSSGAL 60

Query: 55  IAYSGEKTGRSPKDKRIVDEPTSSDNIWWGPVNRKASEKTWLINRERAADFLRTREHLYI 114
           IAYSG KTGRSPKDKRIV+E TS D IWWGPVN+  SE+TW INRERAAD+LRTR+H+YI
Sbjct: 61  IAYSGVKTGRSPKDKRIVEESTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 120

Query: 115 VDAYAGWDPRYRIKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPANT 174
           VDA+AGWDP+YRIK+R+VC RAYHALFMTNMLIRPTEEELA FGEPDFTVWNAGQFPAN 
Sbjct: 121 VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 180

Query: 175 HTEGMSSKTTVEINFRAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQG- 233
           HT+ MSSK+T+EINF+AMEM+ILGTEYAGEMKKGIFTVMFYLMP++HNVLTLHSSANQG 
Sbjct: 181 HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI 240

Query: 234 PNNDVTLFFGLSGTGKTTLSADQHRKLIGDDEHCWSDYGVFNIEGGCYAKCIGLSGEKEP 293
            N DVTLFFGLSGTGKTTLSAD HR LIGDDEHCWSD+GVFNIEGGCYAKCI LS EKEP
Sbjct: 241 QNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEP 300

Query: 294 EIFNAIKYGSVLENVVYDPVTRVVDYEDSSITENTRCAYPIEYIPSAQIPCLSENHPSNI 353
           EIF+AIK+G+VLENV YD  + VVDY+DSSITENTRCAYPI+YIPSA+IPCL+++HP NI
Sbjct: 301 EIFDAIKFGAVLENVKYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 360

Query: 354 VLLTCDASGVLPPVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALH 413
           +LLTCDASGVLPPVS+LTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFLALH
Sbjct: 361 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 420

Query: 414 PMKYATMLAEKMSQHNASAWLINTGWTGSSYTAGGKRCPLKYTRAILDSIHDGTLAQAEY 473
           P++YATMLA KMS H ++A+LINTGW+GSSY +GGKRCPLKYTRAILDSIHDG+LA   Y
Sbjct: 421 PIRYATMLATKMSHHKSNAYLINTGWSGSSYVSGGKRCPLKYTRAILDSIHDGSLANETY 480

Query: 474 ETLPVFGLSIPKAVEGVPAELLNPAKNWVEGEGKYASAVSALASKFTENFKIYQDQATEE 533
           E+LP+F L +P  V+GVPAELLNPAKNW +GE KY  +V+ LA+ F ENFKIYQD+AT +
Sbjct: 481 ESLPIFNLQVPTKVKGVPAELLNPAKNWSQGEAKYKGSVTNLANLFVENFKIYQDRATPD 540

Query: 534 VVRAGPQI 541
           V+ AGPQ 
Sbjct: 541 VLAAGPQF 548

>KNAG0C06640 Chr3 (1288896..1290539) [1644 bp, 547 aa] {ON}
           Anc_5.708 YKR097W
          Length = 547

 Score =  929 bits (2402), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/530 (81%), Positives = 481/530 (90%), Gaps = 1/530 (0%)

Query: 11  EEKIRAELGLSSGVLTIRRNAPAAVLYEDALAERKTAISSTGALIAYSGEKTGRSPKDKR 70
           E+KIR EL LS  V+TIRRNAPAAVLYEDAL ERKT I+S+GALIAYSGEKTGRSPKDKR
Sbjct: 16  EQKIRRELNLSKEVITIRRNAPAAVLYEDALHERKTVIASSGALIAYSGEKTGRSPKDKR 75

Query: 71  IVDEPTSSDNIWWGPVNRKASEKTWLINRERAADFLRTREHLYIVDAYAGWDPRYRIKIR 130
           IV+E TS DN+WWGPVN+  SE+TW INRERAAD+LRTR+HLYIVDA+AGWDP+YRIK+R
Sbjct: 76  IVEEETSKDNVWWGPVNKPCSERTWEINRERAADYLRTRDHLYIVDAFAGWDPKYRIKVR 135

Query: 131 IVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPANTHTEGMSSKTTVEINFR 190
           +VC RAYHALFMTNMLIRP++EELA FGEPDFTVWNAGQFPAN HT+ MSSK+T+EINF+
Sbjct: 136 VVCARAYHALFMTNMLIRPSKEELANFGEPDFTVWNAGQFPANMHTQDMSSKSTIEINFK 195

Query: 191 AMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQG-PNNDVTLFFGLSGTGK 249
           AMEMVILGTEYAGEMKKGIFTVMFYLMP++HNVLTLHSSANQG  N DVTLFFGLSGTGK
Sbjct: 196 AMEMVILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGIKNGDVTLFFGLSGTGK 255

Query: 250 TTLSADQHRKLIGDDEHCWSDYGVFNIEGGCYAKCIGLSGEKEPEIFNAIKYGSVLENVV 309
           TTLSAD HR LIGDDEHCWSD GVFNIEGGCYAKCI LS EKEPEIF+AI++GSVLENV 
Sbjct: 256 TTLSADPHRLLIGDDEHCWSDQGVFNIEGGCYAKCINLSAEKEPEIFDAIRFGSVLENVA 315

Query: 310 YDPVTRVVDYEDSSITENTRCAYPIEYIPSAQIPCLSENHPSNIVLLTCDASGVLPPVSR 369
           YD  +  VDY+DS+ITENTRCAYPIEYIPSA+IPCL+++HP NI+LLTCDASGVLPPV++
Sbjct: 316 YDEKSHEVDYDDSTITENTRCAYPIEYIPSAKIPCLADSHPKNIILLTCDASGVLPPVAK 375

Query: 370 LTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYATMLAEKMSQHN 429
           L+PEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFLALHP++YA MLA KMS+H 
Sbjct: 376 LSPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALHPIRYAKMLAAKMSEHK 435

Query: 430 ASAWLINTGWTGSSYTAGGKRCPLKYTRAILDSIHDGTLAQAEYETLPVFGLSIPKAVEG 489
           A+A+LINTGWTGSSY +GGKRCPLKYTRAILD+IHDG+LAQA YE+LP+F L +P AV G
Sbjct: 436 ANAYLINTGWTGSSYVSGGKRCPLKYTRAILDAIHDGSLAQANYESLPIFNLEVPTAVNG 495

Query: 490 VPAELLNPAKNWVEGEGKYASAVSALASKFTENFKIYQDQATEEVVRAGP 539
           VP ELLNPAKNW +GE KY  AVS LAS F ENFKIYQD+AT +V+ AGP
Sbjct: 496 VPHELLNPAKNWAQGEAKYNGAVSNLASLFVENFKIYQDKATPDVLAAGP 545

>Suva_11.334 Chr11 (615967..617613) [1647 bp, 548 aa] {ON} YKR097W
           (REAL)
          Length = 548

 Score =  929 bits (2401), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/548 (79%), Positives = 485/548 (88%), Gaps = 7/548 (1%)

Query: 1   MSPSKVYQTP------EEKIRAELGLSSGVLTIRRNAPAAVLYEDALAERKTAISSTGAL 54
           MSPSK+          E+KIR EL LS  V TIRRNAPAAVLYED L E+KT ISS+GAL
Sbjct: 1   MSPSKMNAVAGTTSGVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKEKKTVISSSGAL 60

Query: 55  IAYSGEKTGRSPKDKRIVDEPTSSDNIWWGPVNRKASEKTWLINRERAADFLRTREHLYI 114
           IAYSG KTGRSPKDKRIV+EPTS D IWWGPVN+  SE+TW INRERAAD+LRTR+H+YI
Sbjct: 61  IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI 120

Query: 115 VDAYAGWDPRYRIKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPANT 174
           VDA+AGWDP+YRIK+R+VC RAYHALFMTNMLIRPTEEELA FGEPDFTVWNAGQFPAN 
Sbjct: 121 VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL 180

Query: 175 HTEGMSSKTTVEINFRAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQG- 233
           HT+ MSSK+T+EINF+AMEM+ILGTEYAGEMKKGIFTVMFYLMP++HN+LTLHSSANQG 
Sbjct: 181 HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNILTLHSSANQGI 240

Query: 234 PNNDVTLFFGLSGTGKTTLSADQHRKLIGDDEHCWSDYGVFNIEGGCYAKCIGLSGEKEP 293
            N DVTLFFGLSGTGKTTLSAD HR LIGDDEHCWSD GVFNIEGGCYAKCI LS EKEP
Sbjct: 241 KNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDNGVFNIEGGCYAKCINLSAEKEP 300

Query: 294 EIFNAIKYGSVLENVVYDPVTRVVDYEDSSITENTRCAYPIEYIPSAQIPCLSENHPSNI 353
           EIF+AI++G+VLENV YD  + VVDY+DSSITENTRCAYPI+YIPSA+IPCL+++HP NI
Sbjct: 301 EIFDAIRFGAVLENVKYDENSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI 360

Query: 354 VLLTCDASGVLPPVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALH 413
           +LLTCDASGVLPPVS+LTPEQVMYHFISGYTSKMAGTEQGVTEPE TFSSCFGQPFLALH
Sbjct: 361 ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH 420

Query: 414 PMKYATMLAEKMSQHNASAWLINTGWTGSSYTAGGKRCPLKYTRAILDSIHDGTLAQAEY 473
           P++YATMLA KMSQH A+A+LINTGWTGSSY +GG RC LKYTRAILDSIHDG+LA+A Y
Sbjct: 421 PIRYATMLATKMSQHRANAYLINTGWTGSSYVSGGSRCALKYTRAILDSIHDGSLAKASY 480

Query: 474 ETLPVFGLSIPKAVEGVPAELLNPAKNWVEGEGKYASAVSALASKFTENFKIYQDQATEE 533
           E+LP+F L +P  V GVPAELLNPAKNW +GE KY  AV+ LA+ F ENFKIYQD+AT +
Sbjct: 481 ESLPIFNLQVPTKVNGVPAELLNPAKNWSQGEAKYKGAVTNLANLFVENFKIYQDRATPD 540

Query: 534 VVRAGPQI 541
           V+ AGPQ 
Sbjct: 541 VLAAGPQF 548

>Kwal_55.19663 s55 complement(70935..72569) [1635 bp, 544 aa] {ON}
           YKR097W (PCK1) - phosphoenolpyruvate carboxylkinase
           [contig 159] FULL
          Length = 544

 Score =  915 bits (2365), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/544 (79%), Positives = 479/544 (88%), Gaps = 3/544 (0%)

Query: 1   MSPSKVYQ--TPEEKIRAELGLSSGVLTIRRNAPAAVLYEDALAERKTAISSTGALIAYS 58
           MSPSK+    + +++IR EL L   V+TIRRNAPAA+LYEDAL E KT IS++GALIA+S
Sbjct: 1   MSPSKIRNLVSVKDRIRKELALGEEVVTIRRNAPAALLYEDALKENKTRISASGALIAFS 60

Query: 59  GEKTGRSPKDKRIVDEPTSSDNIWWGPVNRKASEKTWLINRERAADFLRTREHLYIVDAY 118
           G KTGRSPKDKRIVDEPTSS NIWWGPVN+K SEKTWL+NRERAADFLRTR+HLYIVDAY
Sbjct: 61  GSKTGRSPKDKRIVDEPTSSQNIWWGPVNKKCSEKTWLVNRERAADFLRTRDHLYIVDAY 120

Query: 119 AGWDPRYRIKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPANTHTEG 178
           AGWDPRYRIKIR+VC RAYHALFMTNMLI+PT +EL EFGEPDFTVWNAGQFPANTHT+G
Sbjct: 121 AGWDPRYRIKIRVVCARAYHALFMTNMLIQPTPQELEEFGEPDFTVWNAGQFPANTHTDG 180

Query: 179 MSSKTTVEINFRAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQG-PNND 237
           M+SKTT+EINF+ MEMVILGTEYAGEMKKGIFTVMFYLMPINH VLTLHSSANQG  +ND
Sbjct: 181 MTSKTTIEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPINHGVLTLHSSANQGIRDND 240

Query: 238 VTLFFGLSGTGKTTLSADQHRKLIGDDEHCWSDYGVFNIEGGCYAKCIGLSGEKEPEIFN 297
           VTLFFGLSGTGKTTLSAD  RKLIGDDEHCWSD+GVFNIEGGCYAKCIGL+  KEPEIFN
Sbjct: 241 VTLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEGGCYAKCIGLTEAKEPEIFN 300

Query: 298 AIKYGSVLENVVYDPVTRVVDYEDSSITENTRCAYPIEYIPSAQIPCLSENHPSNIVLLT 357
           AI++GSVLENV YD  TR VD+E+  ITENTRCAYPIEYIPSA+IPCL++ HP NIVLLT
Sbjct: 301 AIRFGSVLENVAYDSFTREVDFENCEITENTRCAYPIEYIPSAKIPCLADEHPKNIVLLT 360

Query: 358 CDASGVLPPVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKY 417
           CDASGVLPPVS+LTPEQVMYHFISGYTSK+AGTE+GVTEPEATFSSCFGQPFLALHP+KY
Sbjct: 361 CDASGVLPPVSKLTPEQVMYHFISGYTSKVAGTEEGVTEPEATFSSCFGQPFLALHPLKY 420

Query: 418 ATMLAEKMSQHNASAWLINTGWTGSSYTAGGKRCPLKYTRAILDSIHDGTLAQAEYETLP 477
           ATMLA+KMS H A AWLINTGWTG S+  GG RCPLKYTRAILD+IHDGTLA+ EYETLP
Sbjct: 421 ATMLADKMSHHKADAWLINTGWTGQSFVDGGDRCPLKYTRAILDAIHDGTLAKEEYETLP 480

Query: 478 VFGLSIPKAVEGVPAELLNPAKNWVEGEGKYASAVSALASKFTENFKIYQDQATEEVVRA 537
            F L IP  V  VP+ +LNPA++WV GE KY + V  LA+ F ENFK Y+  A+ E++ A
Sbjct: 481 TFNLHIPLHVNNVPSNILNPARSWVGGEAKYKTKVRTLANLFVENFKKYEANASTEIMCA 540

Query: 538 GPQI 541
           GP +
Sbjct: 541 GPLL 544

>KAFR0H00160 Chr8 complement(16235..17884) [1650 bp, 549 aa] {ON}
           Anc_5.708 YKR097W
          Length = 549

 Score =  910 bits (2352), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/550 (78%), Positives = 483/550 (87%), Gaps = 10/550 (1%)

Query: 1   MSPSKVYQTP-------EEKIRAELGLSSGVLTIRRNAPAAVLYEDALA-ERKTAISSTG 52
           MSPSKV  TP       E+KIR EL LSSGV TIRRNAP +VLYEDAL  E+ T ISSTG
Sbjct: 1   MSPSKV-TTPLKDLNAVEQKIRQELDLSSGVTTIRRNAPVSVLYEDALKDEKNTIISSTG 59

Query: 53  ALIAYSGEKTGRSPKDKRIVDEPTSSDNIWWGPVNRKASEKTWLINRERAADFLRTREHL 112
           ALIAYSGEKTGR PKDKRIV+E  S ++IWWGPVN+  SE+TW INRERAAD+LRTREH+
Sbjct: 60  ALIAYSGEKTGRCPKDKRIVEESDSKEDIWWGPVNKPCSERTWEINRERAADYLRTREHI 119

Query: 113 YIVDAYAGWDPRYRIKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEPDFTVWNAGQFPA 172
           YIVDA+AGWDP+YRIK+R+VC RAYHALFMTNMLIRPT++EL  FG+PDFTVWNAGQFPA
Sbjct: 120 YIVDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTKDELENFGDPDFTVWNAGQFPA 179

Query: 173 NTHTEGMSSKTTVEINFRAMEMVILGTEYAGEMKKGIFTVMFYLMPINHNVLTLHSSANQ 232
           N HTE MSSKTT+EINF+AMEM+ILGTEYAGEMKKGIFTVMFYLMPI+HNVLTLHSSAN+
Sbjct: 180 NFHTEDMSSKTTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPIHHNVLTLHSSANE 239

Query: 233 G-PNNDVTLFFGLSGTGKTTLSADQHRKLIGDDEHCWSDYGVFNIEGGCYAKCIGLSGEK 291
           G    DVTLFFGLSGTGKTTLSAD HR LIGDDEHCWSD GVFNIEGGCYAKCI LS EK
Sbjct: 240 GIEKKDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDTGVFNIEGGCYAKCINLSVEK 299

Query: 292 EPEIFNAIKYGSVLENVVYDPVTRVVDYEDSSITENTRCAYPIEYIPSAQIPCLSENHPS 351
           EPEIFN+IK+GS+LENVVYDP +R VDY+DSSITENTRCAYPIE+IPSA+IPC++ +HP 
Sbjct: 300 EPEIFNSIKFGSILENVVYDPKSREVDYDDSSITENTRCAYPIEFIPSAKIPCIANSHPK 359

Query: 352 NIVLLTCDASGVLPPVSRLTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLA 411
           NI+LLTCDASGVLPPVS+LT +QVMYHFISGYTSKMAGTEQGVTEP+ TFSSCFGQPFLA
Sbjct: 360 NIILLTCDASGVLPPVSKLTSDQVMYHFISGYTSKMAGTEQGVTEPQPTFSSCFGQPFLA 419

Query: 412 LHPMKYATMLAEKMSQHNASAWLINTGWTGSSYTAGGKRCPLKYTRAILDSIHDGTLAQA 471
           LHPMKYATMLAEKM +H A+AWLINTGWTGSSY AGGKRCPL YTRAILD+IHDG+L + 
Sbjct: 420 LHPMKYATMLAEKMEKHKANAWLINTGWTGSSYIAGGKRCPLPYTRAILDAIHDGSLEKE 479

Query: 472 EYETLPVFGLSIPKAVEGVPAELLNPAKNWVEGEGKYASAVSALASKFTENFKIYQDQAT 531
            +ETLP+F L +PK V  VP +LLNP+KNW EGE KY+ AV  L+  F ENFK Y+D+AT
Sbjct: 480 SFETLPIFNLKVPKNVNNVPTKLLNPSKNWYEGELKYSGAVKKLSKLFIENFKTYEDKAT 539

Query: 532 EEVVRAGPQI 541
           +EV+ AGP++
Sbjct: 540 KEVLAAGPRL 549

>Kpol_1043.75 s1043 (162051..163727) [1677 bp, 558 aa] {ON}
           (162051..163727) [1677 nt, 559 aa]
          Length = 558

 Score =  865 bits (2234), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/518 (77%), Positives = 453/518 (87%), Gaps = 1/518 (0%)

Query: 25  LTIRRNAPAAVLYEDALAERKTAISSTGALIAYSGEKTGRSPKDKRIVDEPTSSDNIWWG 84
           +TI+RN P A LYED L E  T +SSTGAL+AYSG KTGRSPKDKRIV+EP+S DNIWWG
Sbjct: 41  ITIKRNPPIAELYEDGLKEDSTTLSSTGALMAYSGVKTGRSPKDKRIVEEPSSKDNIWWG 100

Query: 85  PVNRKASEKTWLINRERAADFLRTREHLYIVDAYAGWDPRYRIKIRIVCCRAYHALFMTN 144
           PVN+  SE TW INRERA D+L TR+ LY++DAYAGWD  YRIKIR+VC R YHALFM N
Sbjct: 101 PVNKPCSELTWSINRERAIDYLNTRKILYVIDAYAGWDANYRIKIRVVCARPYHALFMNN 160

Query: 145 MLIRPTEEELAEFGEPDFTVWNAGQFPANTHTEGMSSKTTVEINFRAMEMVILGTEYAGE 204
           MLIRPT EEL  FGEPDFT+WNAG F AN+ T+ M+SKT++EINF++MEMVILGTEYAGE
Sbjct: 161 MLIRPTTEELENFGEPDFTIWNAGSFYANSLTKDMTSKTSIEINFKSMEMVILGTEYAGE 220

Query: 205 MKKGIFTVMFYLMPINHNVLTLHSSANQGPNN-DVTLFFGLSGTGKTTLSADQHRKLIGD 263
           MKKGIFTVMFYLMP+ HNVLTLHSSANQG NN DVTLFFGLSGTGKTTLSAD HR+LIGD
Sbjct: 221 MKKGIFTVMFYLMPVYHNVLTLHSSANQGVNNGDVTLFFGLSGTGKTTLSADPHRELIGD 280

Query: 264 DEHCWSDYGVFNIEGGCYAKCIGLSGEKEPEIFNAIKYGSVLENVVYDPVTRVVDYEDSS 323
           DEHCWSD+GVFNIEGGCYAKCIGL+ EKEPEIFNAIK+GSVLEN VYD  T VVDY+DS 
Sbjct: 281 DEHCWSDHGVFNIEGGCYAKCIGLTEEKEPEIFNAIKFGSVLENCVYDENTHVVDYDDSR 340

Query: 324 ITENTRCAYPIEYIPSAQIPCLSENHPSNIVLLTCDASGVLPPVSRLTPEQVMYHFISGY 383
           ITENTRCAYPI++I SA+IPCL++ HP+N++LLTCDASGVLPPVS+LTPEQVMYHFISGY
Sbjct: 341 ITENTRCAYPIDFIESAKIPCLTDKHPTNLILLTCDASGVLPPVSKLTPEQVMYHFISGY 400

Query: 384 TSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYATMLAEKMSQHNASAWLINTGWTGSS 443
           TSKMAGTEQGVTEPE TFS+CFGQPFLALHPMKYA MLA+KM+ H ASAWLINTGWTG+S
Sbjct: 401 TSKMAGTEQGVTEPEPTFSACFGQPFLALHPMKYAQMLADKMNHHKASAWLINTGWTGAS 460

Query: 444 YTAGGKRCPLKYTRAILDSIHDGTLAQAEYETLPVFGLSIPKAVEGVPAELLNPAKNWVE 503
           YTAGGKRCPLKYTRAILD+IH+G+LA  EYETLPVF L IPK VE VP+ELLNP+K W +
Sbjct: 461 YTAGGKRCPLKYTRAILDAIHNGSLANEEYETLPVFNLPIPKNVENVPSELLNPSKTWSD 520

Query: 504 GEGKYASAVSALASKFTENFKIYQDQATEEVVRAGPQI 541
            +  Y+ AV  L S F +NF IYQDQAT++V+ AGP +
Sbjct: 521 PDVTYSQAVKKLGSLFVQNFTIYQDQATDDVIAAGPAL 558

>TPHA0E00170 Chr5 complement(16873..18609) [1737 bp, 578 aa] {ON}
           Anc_5.708 YKR097W
          Length = 578

 Score =  860 bits (2221), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/517 (76%), Positives = 446/517 (86%), Gaps = 1/517 (0%)

Query: 24  VLTIRRNAPAAVLYEDALAERKTAISSTGALIAYSGEKTGRSPKDKRIVDEPTSSDNIWW 83
           ++ I+RN P A LYED L E KT +SSTGALIAYSG KTGRSPKDKRIV+E  S DNIWW
Sbjct: 60  LINIKRNPPVATLYEDGLKENKTTLSSTGALIAYSGVKTGRSPKDKRIVEEELSKDNIWW 119

Query: 84  GPVNRKASEKTWLINRERAADFLRTREHLYIVDAYAGWDPRYRIKIRIVCCRAYHALFMT 143
           GPVN++ SE+TW INRERA D+L TR+ LY++DA+ GWDPRYRIKIR+VC RAYHALFM 
Sbjct: 120 GPVNKQCSERTWAINRERAVDYLNTRDTLYVIDAFVGWDPRYRIKIRVVCARAYHALFMN 179

Query: 144 NMLIRPTEEELAEFGEPDFTVWNAGQFPANTHTEGMSSKTTVEINFRAMEMVILGTEYAG 203
           NMLIRPT+EEL  FG+PDFTVWNAGQF AN+ T  MSSKT+VEINF+ MEM ILGTEYAG
Sbjct: 180 NMLIRPTKEELENFGKPDFTVWNAGQFFANSLTNDMSSKTSVEINFKEMEMTILGTEYAG 239

Query: 204 EMKKGIFTVMFYLMPINHNVLTLHSSANQGPNN-DVTLFFGLSGTGKTTLSADQHRKLIG 262
           EMKKGIFTVMFYLMPI HNVLTLHSSANQ  NN DVTLFFGLSGTGKTTLSAD HR+LIG
Sbjct: 240 EMKKGIFTVMFYLMPIYHNVLTLHSSANQENNNGDVTLFFGLSGTGKTTLSADPHRQLIG 299

Query: 263 DDEHCWSDYGVFNIEGGCYAKCIGLSGEKEPEIFNAIKYGSVLENVVYDPVTRVVDYEDS 322
           DDEHCWSD GVFNIEGGCYAKCIGLS EKEP+IFNAIK+GSVLEN +YD  T  VDY++S
Sbjct: 300 DDEHCWSDNGVFNIEGGCYAKCIGLSKEKEPDIFNAIKFGSVLENCIYDEETHEVDYDNS 359

Query: 323 SITENTRCAYPIEYIPSAQIPCLSENHPSNIVLLTCDASGVLPPVSRLTPEQVMYHFISG 382
           +ITENTRCAYPI+YI +A+IPCL++ HP+N++LLTCDASGVLPPVS+LTPEQVMYHFISG
Sbjct: 360 TITENTRCAYPIDYISNAKIPCLADKHPTNLILLTCDASGVLPPVSKLTPEQVMYHFISG 419

Query: 383 YTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYATMLAEKMSQHNASAWLINTGWTGS 442
           YTSKMAGTE GVTEP+ TFSSCFGQPFLALHPMKYA+MLAEKM +H A+AWL+NTGWTGS
Sbjct: 420 YTSKMAGTEVGVTEPQPTFSSCFGQPFLALHPMKYASMLAEKMDKHKANAWLLNTGWTGS 479

Query: 443 SYTAGGKRCPLKYTRAILDSIHDGTLAQAEYETLPVFGLSIPKAVEGVPAELLNPAKNWV 502
           SY +GG RCPLKYTRAILD+IHDG+L   EYETLP+F L IPK   GVP+ELLNPA +W 
Sbjct: 480 SYVSGGSRCPLKYTRAILDAIHDGSLQNEEYETLPIFNLQIPKNANGVPSELLNPAGSWT 539

Query: 503 EGEGKYASAVSALASKFTENFKIYQDQATEEVVRAGP 539
           +    Y +AV  L   F ENFK Y+D+AT EV++AGP
Sbjct: 540 DSSEDYMTAVQRLGKLFNENFKTYEDKATNEVIKAGP 576

>TBLA0E01700 Chr5 complement(408779..410509) [1731 bp, 576 aa] {ON}
           Anc_5.708 YKR097W
          Length = 576

 Score =  844 bits (2180), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/525 (74%), Positives = 449/525 (85%), Gaps = 5/525 (0%)

Query: 22  SGVLTIRRNAPAAVLYEDALAERKTAISSTGALIAYSGEKTGRSPKDKRIVDEPTSSDNI 81
           S ++ I+ N  AA+LYEDAL E KT ISS+GALIAYSG KTGRSPKDKRIV E  S DN+
Sbjct: 52  SSLINIKHNPSAAILYEDALKEPKTVISSSGALIAYSGAKTGRSPKDKRIVYEDGSKDNV 111

Query: 82  WWGPVNRKASEKTWLINRERAADFLRTREHLYIVDAYAGWDPRYRIKIRIVCCRAYHALF 141
           WWGPVN+  SEKTW INRER  D+L TR +LY++DAY GWDPRYR+K+R+VC RAYHALF
Sbjct: 112 WWGPVNKPCSEKTWQINRERTLDYLGTRSNLYVIDAYVGWDPRYRLKVRVVCARAYHALF 171

Query: 142 MTNMLIRPTEEELAEFGEPDFTVWNAGQFPANTHTEGMSSKTTVEINFRAMEMVILGTEY 201
           MTNMLIRPTEEEL  F EPDFTVWNAG F AN++T  M+SKT+VEINF+AMEM+ILGTEY
Sbjct: 172 MTNMLIRPTEEELKNFNEPDFTVWNAGGFSANSYTADMTSKTSVEINFKAMEMIILGTEY 231

Query: 202 AGEMKKGIFTVMFYLMPINHNVLTLHSSANQG-PNNDVTLFFGLSGTGKTTLSADQHRKL 260
           AGEMKKGIFTVMFYLMPI+HN+LTLHSSAN+G    DVT+FFGLSGTGKTTLSAD +R L
Sbjct: 232 AGEMKKGIFTVMFYLMPIHHNILTLHSSANEGIEKKDVTVFFGLSGTGKTTLSADPNRLL 291

Query: 261 IGDDEHCWSDYGVFNIEGGCYAKCIGLSGEKEPEIFNAIKYGSVLENVVYDPVTRVVDYE 320
           IGDDEHCWSD+GVFNIEGGCYAKCIGL+ EKEPEIF+AI++GSVLENV Y+ +   VDY 
Sbjct: 292 IGDDEHCWSDHGVFNIEGGCYAKCIGLTREKEPEIFDAIRFGSVLENVTYNELNHKVDYN 351

Query: 321 DSSITENTRCAYPIEYIPSAQIPCLSENHPSNIVLLTCDASGVLPPVSRLTPEQVMYHFI 380
           D +ITENTRCAYPI+YI SA+IPCL+ +HP N++LLTCDASGVLPPVS+LTPEQVMYHFI
Sbjct: 352 DCAITENTRCAYPIDYIKSAKIPCLANSHPKNLILLTCDASGVLPPVSKLTPEQVMYHFI 411

Query: 381 SGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYATMLAEKMSQHNASAWLINTGWT 440
           SGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHP+ YATMLA+KM Q+ ++AWLINTGWT
Sbjct: 412 SGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPITYATMLAKKMDQYKSNAWLINTGWT 471

Query: 441 GSSYTAGGKRCPLKYTRAILDSIHDGTLAQAEYETLPVFGLSIPKAVEGVPAELLNPAKN 500
           GSSY+AGG RCPLKYTRAILD+IHDGTLA   YETLPVF L IP  V GVP E+LNP  +
Sbjct: 472 GSSYSAGGSRCPLKYTRAILDAIHDGTLANENYETLPVFNLQIPTHVNGVPNEILNPENS 531

Query: 501 WVEGEGK----YASAVSALASKFTENFKIYQDQATEEVVRAGPQI 541
           W     K    Y  AV+ LA+ F ENFKIYQD+AT++V+ AGPQ+
Sbjct: 532 WNSPANKNNISYNKAVNKLAALFVENFKIYQDKATDDVLAAGPQV 576

>Suva_7.275 Chr7
           complement(476201..476281,476285..476410,476414..476494)
           [288 bp, 96 aa] {ON} YKR097W (REAL)
          Length = 96

 Score = 64.7 bits (156), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 46/113 (40%), Positives = 58/113 (51%), Gaps = 22/113 (19%)

Query: 370 LTPEQVMYHFISGYTSKMAGTEQGVTEPEATFSSCFGQPFLALHPMKYATMLAEKMSQHN 429
           LT E+VMYHF SG+ S   G         +       +PFLALHP+ Y T++A KM  H 
Sbjct: 1   LTSEEVMYHFNSGHASN--GRNWAGCHLTSNVLLVLVKPFLALHPISYITVIATKMFAH- 57

Query: 430 ASAWLINTGWTGSSYTAGGKRCPLKYTRAILDSIHDGTLAQ-----AEYETLP 477
            SA+LINTG+             LK TR   DSIHD +LA+       Y+ LP
Sbjct: 58  -SAYLINTGYA------------LK-TRVNFDSIHDDSLAKELFRAPTYKCLP 96

>TPHA0O00600 Chr15 complement(107944..112062) [4119 bp, 1372 aa]
           {ON} Anc_1.380 YLR256W
          Length = 1372

 Score = 35.0 bits (79), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 20/84 (23%), Positives = 41/84 (48%), Gaps = 20/84 (23%)

Query: 445 TAGGKRCPLKYTR----AILDSIHD-----GTLAQAEYETLPVFGLSIPKAVEGVPAELL 495
           T    +CP+ +T+    AI   +++      ++ ++E E +P+  ++ PK ++ +P E  
Sbjct: 354 TKAPNKCPIDHTKYQELAITSKVNNQPITSASIQKSEEEKIPIIQMTSPKIIKNIPLEST 413

Query: 496 NPAKNWVEGEGKYASAVSALASKF 519
           NP  ++            +LASKF
Sbjct: 414 NPLPSF-----------HSLASKF 426

>Kwal_56.24265 s56 complement(928206..928859) [654 bp, 217 aa] {ON}
           YPL233W (NSL1) - Protein required for cell viability
           [contig 165] FULL
          Length = 217

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 33/59 (55%), Gaps = 2/59 (3%)

Query: 24  VLTIRRNAPAAVLYEDALAERKTAISSTGALIAYSGEKTGRSPKDKR-IVDEPTSSDNI 81
           V  +RR AP  + + D +AE ++A+    ALIA   E    S +D++  V+E   SDNI
Sbjct: 112 VAQLRREAPQKLCH-DYVAEARSALEEADALIASFTESDETSSRDQQESVEELYKSDNI 169

>KLTH0F02024g Chr6 (161423..163627) [2205 bp, 734 aa] {ON} similar
           to uniprot|P33310 Saccharomyces cerevisiae YLR188W MDL1
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane mediates export of peptides
           generated upon proteolysis of mitochondrial proteins
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 734

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 46/90 (51%), Gaps = 20/90 (22%)

Query: 243 GLSGTGKTTLSA--------DQHRKLIGDDEHCWSDYGVFNIEGGCYAKCIGLSGEKEPE 294
           G SG GK+T+++        D    LIG       +   FN+    Y + +G+  ++EP 
Sbjct: 484 GPSGGGKSTVASLLLRFYDVDAGAILIGGQ-----NIADFNLR--KYRRLVGIV-QQEPM 535

Query: 295 IFNAIKYGSVLENVVYDPVTRVVDYEDSSI 324
           +FN    G++LEN++Y    R+++ ED  +
Sbjct: 536 LFN----GTILENILYTVPQRLLNEEDGRV 561

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.132    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 57,821,001
Number of extensions: 2523462
Number of successful extensions: 6260
Number of sequences better than 10.0: 27
Number of HSP's gapped: 6321
Number of HSP's successfully gapped: 27
Length of query: 541
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 427
Effective length of database: 40,409,475
Effective search space: 17254845825
Effective search space used: 17254845825
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)