Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AFR291Cna 1ON1881887541e-102
Ecym_4014na 1ON31960800.056
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR291C
         (188 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR291C Chr6 complement(964460..965026) [567 bp, 188 aa] {ON} NO...   295   e-102
Ecym_4014 Chr4 (33833..34792) [960 bp, 319 aa] {ON} similar to A...    35   0.056

>AFR291C Chr6 complement(964460..965026) [567 bp, 188 aa] {ON}
           NOHBY635; No homolog in Saccharomyces cerevisiae
          Length = 188

 Score =  295 bits (754), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 169/188 (89%), Positives = 169/188 (89%)

Query: 1   MAQREVRRGAVLRQEGRRPLRVMARAAAPLATGRWLCEXXXXXXXXXXXXXXXXXXXMQA 60
           MAQREVRRGAVLRQEGRRPLRVMARAAAPLATGRWLCE                   MQA
Sbjct: 1   MAQREVRRGAVLRQEGRRPLRVMARAAAPLATGRWLCEVVPAAVAVRAVRAAPATAAMQA 60

Query: 61  LVCAGRRTSPGQSSQAVRMGGRGADMPERIQSALGRFATECKVRRSRSRLGMERDGPTGP 120
           LVCAGRRTSPGQSSQAVRMGGRGADMPERIQSALGRFATECKVRRSRSRLGMERDGPTGP
Sbjct: 61  LVCAGRRTSPGQSSQAVRMGGRGADMPERIQSALGRFATECKVRRSRSRLGMERDGPTGP 120

Query: 121 QVVVAICPVGARLVALHTAMGTIVVVAGGPGGGWQLGDRICTDGPLTFALYTGVYWSVGW 180
           QVVVAICPVGARLVALHTAMGTIVVVAGGPGGGWQLGDRICTDGPLTFALYTGVYWSVGW
Sbjct: 121 QVVVAICPVGARLVALHTAMGTIVVVAGGPGGGWQLGDRICTDGPLTFALYTGVYWSVGW 180

Query: 181 RAEREASV 188
           RAEREASV
Sbjct: 181 RAEREASV 188

>Ecym_4014 Chr4 (33833..34792) [960 bp, 319 aa] {ON} similar to
           Ashbya gossypii AFR291C
          Length = 319

 Score = 35.4 bits (80), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 27/60 (45%), Gaps = 2/60 (3%)

Query: 128 PVGARLVALHTAMGTIVVVAGG--PGGGWQLGDRICTDGPLTFALYTGVYWSVGWRAERE 185
           P   R   L  A G  V++ G        + G  I  DG +TF LY  VYW + W  +++
Sbjct: 249 PPRRRFYWLQVASGETVIIDGTLQREDAVRAGSTIYVDGSVTFQLYDKVYWCLRWSTKKD 308

 Score = 32.7 bits (73), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 16/24 (66%), Positives = 19/24 (79%)

Query: 84  ADMPERIQSALGRFATECKVRRSR 107
           A++  R+QSAL RFATE KVRR R
Sbjct: 135 AEVAPRLQSALFRFATESKVRRHR 158

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.136    0.429 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 13,722,193
Number of extensions: 414865
Number of successful extensions: 804
Number of sequences better than 10.0: 2
Number of HSP's gapped: 804
Number of HSP's successfully gapped: 3
Length of query: 188
Length of database: 53,481,399
Length adjustment: 103
Effective length of query: 85
Effective length of database: 41,670,801
Effective search space: 3542018085
Effective search space used: 3542018085
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 62 (28.5 bits)