Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AFR290W5.706ON121794749760.0
Ecym_40155.706ON125795037460.0
SAKL0E15004g5.706ON119697230800.0
KLLA0A00528g5.706ON122995130330.0
KLTH0E00968g5.706ON114896829430.0
Kwal_55.196785.706ON117896629000.0
ZYRO0B16412g5.706ON137298127710.0
TDEL0B021405.706ON114797126330.0
KNAG0C066305.706ON1281100825250.0
Smik_11.3605.706ON118097324990.0
KAFR0H001805.706ON124199124930.0
Suva_11.3335.706ON118797324690.0
Kpol_1043.735.706ON126098424600.0
Skud_11.3365.706ON118897924460.0
YKR096W5.706ON119598024090.0
TPHA0E001905.706ON1361101223940.0
NCAS0A031705.706ON1319103723880.0
CAGL0G02541g5.706ON129597923670.0
YIL151C5.706ON111897623040.0
Suva_9.375.706ON111797922900.0
Skud_9.175.706ON111897722890.0
Smik_9.185.706ON111897822890.0
CAGL0H06611g5.706ON1282103022820.0
NDAI0E050705.706ON155638412951e-154
TBLA0E017105.706ON152641311251e-130
TPHA0D046405.706ON9628633439e-32
TPHA0D008108.78ON121698820.69
NCAS0D049408.841ON327174800.71
TBLA0D056901.216ON426464820.77
NDAI0B012001.490ON504108810.83
Ecym_23115.477ON77581772.2
KAFR0I028101.490ON50388772.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR290W
         (1217 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR290W Chr6 (960776..964429) [3654 bp, 1217 aa] {ON} Syntenic h...  1921   0.0  
Ecym_4015 Chr4 complement(34835..38608) [3774 bp, 1257 aa] {ON} ...  1447   0.0  
SAKL0E15004g Chr5 (1246544..1250134) [3591 bp, 1196 aa] {ON} sim...  1191   0.0  
KLLA0A00528g Chr1 complement(44587..48276) [3690 bp, 1229 aa] {O...  1172   0.0  
KLTH0E00968g Chr5 complement(92019..95465) [3447 bp, 1148 aa] {O...  1138   0.0  
Kwal_55.19678 s55 complement(75394..78930) [3537 bp, 1178 aa] {O...  1121   0.0  
ZYRO0B16412g Chr2 (1329195..1333313) [4119 bp, 1372 aa] {ON} sim...  1071   0.0  
TDEL0B02140 Chr2 complement(380503..383946) [3444 bp, 1147 aa] {...  1018   0.0  
KNAG0C06630 Chr3 (1284481..1288326) [3846 bp, 1281 aa] {ON} Anc_...   977   0.0  
Smik_11.360 Chr11 (616879..620421) [3543 bp, 1180 aa] {ON} YIL15...   967   0.0  
KAFR0H00180 Chr8 complement(20661..24386) [3726 bp, 1241 aa] {ON...   964   0.0  
Suva_11.333 Chr11 (611602..612061,612092..615195) [3564 bp, 1187...   955   0.0  
Kpol_1043.73 s1043 (155026..158808) [3783 bp, 1260 aa] {ON} (155...   952   0.0  
Skud_11.336 Chr11 (608311..608769,608800..608948,608994..611952)...   946   0.0  
YKR096W Chr11 (626793..630380) [3588 bp, 1195 aa] {ON} Protein o...   932   0.0  
TPHA0E00190 Chr5 complement(20436..24521) [4086 bp, 1361 aa] {ON...   926   0.0  
NCAS0A03170 Chr1 complement(621400..625359) [3960 bp, 1319 aa] {...   924   0.0  
CAGL0G02541g Chr7 (231428..235315) [3888 bp, 1295 aa] {ON} simil...   916   0.0  
YIL151C Chr9 complement(57338..60694) [3357 bp, 1118 aa] {ON} Pu...   892   0.0  
Suva_9.37 Chr9 complement(51993..55343) [3351 bp, 1117 aa] {ON} ...   886   0.0  
Skud_9.17 Chr9 complement(34389..37745) [3357 bp, 1118 aa] {ON} ...   886   0.0  
Smik_9.18 Chr9 complement(34956..38312) [3357 bp, 1118 aa] {ON} ...   886   0.0  
CAGL0H06611g Chr8 (653472..657320) [3849 bp, 1282 aa] {ON} simil...   883   0.0  
NDAI0E05070 Chr5 (1159816..1164486) [4671 bp, 1556 aa] {ON} Anc_...   503   e-154
TBLA0E01710 Chr5 complement(411712..416292) [4581 bp, 1526 aa] {...   437   e-130
TPHA0D04640 Chr4 (1012556..1015444) [2889 bp, 962 aa] {ON} Anc_5...   136   9e-32
TPHA0D00810 Chr4 (162899..166549) [3651 bp, 1216 aa] {ON} Anc_8....    36   0.69 
NCAS0D04940 Chr4 (948608..949591) [984 bp, 327 aa] {ON}                35   0.71 
TBLA0D05690 Chr4 complement(1397632..1410426) [12795 bp, 4264 aa...    36   0.77 
NDAI0B01200 Chr2 complement(284935..286449) [1515 bp, 504 aa] {O...    36   0.83 
Ecym_2311 Chr2 (604942..607269) [2328 bp, 775 aa] {ON} similar t...    34   2.2  
KAFR0I02810 Chr9 (564378..565889) [1512 bp, 503 aa] {ON} Anc_1.4...    34   2.4  

>AFR290W Chr6 (960776..964429) [3654 bp, 1217 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YIL151C and YKR096W
          Length = 1217

 Score = 1921 bits (4976), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 929/947 (98%), Positives = 929/947 (98%)

Query: 271  VPTVAVTAKQSSQALMEKLQEIYRNIVRQETELQQRCSQLTTSQTTDLKNLWIIYKVNAE 330
            VPTVAVTAKQSSQALMEKLQEIYRNIVRQETELQQRCSQLTTSQTTDLKNLWIIYKVNAE
Sbjct: 271  VPTVAVTAKQSSQALMEKLQEIYRNIVRQETELQQRCSQLTTSQTTDLKNLWIIYKVNAE 330

Query: 331  LIDNYFMFITTALLPTQPEADLLIGKEIIEVYRIERRLWVYGTITFLDVLKNFSNFMDPE 390
            LIDNYFMFITTALLPTQPEADLLIGKEIIEVYRIERRLWVYGTITFLDVLKNFSNFMDPE
Sbjct: 331  LIDNYFMFITTALLPTQPEADLLIGKEIIEVYRIERRLWVYGTITFLDVLKNFSNFMDPE 390

Query: 391  VCCQFIIYVFISISNMLGDIPPKFSIIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYHE 450
            VCCQFIIYVFISISNMLGDIPPKFSIIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYHE
Sbjct: 391  VCCQFIIYVFISISNMLGDIPPKFSIIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYHE 450

Query: 451  ALKYTFGHGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAE 510
            ALKYTFGHGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAE
Sbjct: 451  ALKYTFGHGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAE 510

Query: 511  RNSGHHRNAHLVEYLKHTEVMLLPSFLESSELQDVVLAFFEQKFGVTSNVDFFDPRLVFV 570
            RNSGHHRNAHLVEYLKHTEVMLLPSFLESSELQDVVLAFFEQKFGVTSNVDFFDPRLVFV
Sbjct: 511  RNSGHHRNAHLVEYLKHTEVMLLPSFLESSELQDVVLAFFEQKFGVTSNVDFFDPRLVFV 570

Query: 571  QDSERLKHFFRHASLYAESHLLQLVGFGDPRNPFALLFELPKHLXXXXXXXXXXXXXXXX 630
            QDSERLKHFFRHASLYAESHLLQLVGFGDPRNPFALLFELPKHL                
Sbjct: 571  QDSERLKHFFRHASLYAESHLLQLVGFGDPRNPFALLFELPKHLKERKDRREKRKSKSST 630

Query: 631  XXQYDTSIDDDCAFAAPSEFFETIDSTKYIYKFPDDINIWKESLSYANVTAMKCSMIVLR 690
              QYDTSIDDDCAFAAPSEFFETIDSTKYIYKFPDDINIWKESLSYANVTAMKCSMIVLR
Sbjct: 631  STQYDTSIDDDCAFAAPSEFFETIDSTKYIYKFPDDINIWKESLSYANVTAMKCSMIVLR 690

Query: 691  KFLHGPLLTALPHLLPWGYFLAATNSRVITIPQDEIRRFWVALVRQLFPFNTIITFLNVL 750
            KFLHGPLLTALPHLLPWGYFLAATNSRVITIPQDEIRRFWVALVRQLFPFNTIITFLNVL
Sbjct: 691  KFLHGPLLTALPHLLPWGYFLAATNSRVITIPQDEIRRFWVALVRQLFPFNTIITFLNVL 750

Query: 751  LLYMNNQTQANFPFDEYFEQFIDMSLADLVGYFCENEELPEVWECWGTLWFDALNTKHIT 810
            LLYMNNQTQANFPFDEYFEQFIDMSLADLVGYFCENEELPEVWECWGTLWFDALNTKHIT
Sbjct: 751  LLYMNNQTQANFPFDEYFEQFIDMSLADLVGYFCENEELPEVWECWGTLWFDALNTKHIT 810

Query: 811  NLTDINSTGVKDHMFMDSPIDGISFDHNDESGEKFWKRCARVILLFRALALECPVGLREI 870
            NLTDINSTGVKDHMFMDSPIDGISFDHNDESGEKFWKRCARVILLFRALALECPVGLREI
Sbjct: 811  NLTDINSTGVKDHMFMDSPIDGISFDHNDESGEKFWKRCARVILLFRALALECPVGLREI 870

Query: 871  SGGRNWRSLVFKFEEPPSEWCDMYLEPFTLVFDTFEQISPVNLDQRATPYCGMTPDIDIR 930
            SGGRNWRSLVFKFEEPPSEWCDMYLEPFTLVFDTFEQISPVNLDQRATPYCGMTPDIDIR
Sbjct: 871  SGGRNWRSLVFKFEEPPSEWCDMYLEPFTLVFDTFEQISPVNLDQRATPYCGMTPDIDIR 930

Query: 931  TLQGYRILLPDYYCFNRNGDMITGSLYTIGTLESSGIHGGDDFNGKRLLENGELVSTERR 990
            TLQGYRILLPDYYCFNRNGDMITGSLYTIGTLESSGIHGGDDFNGKRLLENGELVSTERR
Sbjct: 931  TLQGYRILLPDYYCFNRNGDMITGSLYTIGTLESSGIHGGDDFNGKRLLENGELVSTERR 990

Query: 991  DYNSLIDREEQPIMDEFLRHTHCKNDVRWEQMLPRGDLHCFADTHVTYFVLDATTWLRHF 1050
            DYNSLIDREEQPIMDEFLRHTHCKNDVRWEQMLPRGDLHCFADTHVTYFVLDATTWLRHF
Sbjct: 991  DYNSLIDREEQPIMDEFLRHTHCKNDVRWEQMLPRGDLHCFADTHVTYFVLDATTWLRHF 1050

Query: 1051 GHVYKLAANNILKFAICLTTFQELRFLRKSKDESVLEAATRAVITVRQLYYERKLLPLRF 1110
            GHVYKLAANNILKFAICLTTFQELRFLRKSKDESVLEAATRAVITVRQLYYERKLLPLRF
Sbjct: 1051 GHVYKLAANNILKFAICLTTFQELRFLRKSKDESVLEAATRAVITVRQLYYERKLLPLRF 1110

Query: 1111 TGNVAGHLEEHLEIEEQMTWRSHVDEFVIEAIHKAQDKFNALNDDAKAASRDCIPTGADQ 1170
            TGNVAGHLEEHLEIEEQMTWRSHVDEFVIEAIHKAQDKFNALNDDAKAASRDCIPTGADQ
Sbjct: 1111 TGNVAGHLEEHLEIEEQMTWRSHVDEFVIEAIHKAQDKFNALNDDAKAASRDCIPTGADQ 1170

Query: 1171 RFNFIALVTDDLNMRNKAGAQNIKAFSTRFMFSVCNELGHAKNVCTN 1217
            RFNFIALVTDDLNMRNKAGAQNIKAFSTRFMFSVCNELGHAKNVCTN
Sbjct: 1171 RFNFIALVTDDLNMRNKAGAQNIKAFSTRFMFSVCNELGHAKNVCTN 1217

 Score =  393 bits (1009), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 188/200 (94%), Positives = 188/200 (94%)

Query: 1   MQVNEVAMEESGTRMDTALHQKRHSSALGGCRDGLAKRRGPRGGLTACGLVVDAIGAEPG 60
           MQVNEVAMEESGTRMDTALHQKRHSSALGGCRDGLAKRRGPRGGLTACGLVVDAIGAEPG
Sbjct: 1   MQVNEVAMEESGTRMDTALHQKRHSSALGGCRDGLAKRRGPRGGLTACGLVVDAIGAEPG 60

Query: 61  SPSYLPTTSSSNLDAAARAIDNSSLRQVSSTTLHDTXXXXXXXXXXXXVQVALDPYLTCA 120
           SPSYLPTTSSSNLDAAARAIDNSSLRQVSSTTLHDT            VQVALDPYLTCA
Sbjct: 61  SPSYLPTTSSSNLDAAARAIDNSSLRQVSSTTLHDTRLELPSRLSSSPVQVALDPYLTCA 120

Query: 121 DGQSCIVDRVEHFGYPQEEPSPRMGARPKEGVPQSLWSPHSKSGFNTHSKAVASNSGRRG 180
           DGQSCIVDRVEHFGYPQEEPSPRMGARPKEGVPQSLWSPHSKSGFNTHSKAVASNSGRRG
Sbjct: 121 DGQSCIVDRVEHFGYPQEEPSPRMGARPKEGVPQSLWSPHSKSGFNTHSKAVASNSGRRG 180

Query: 181 YPCTGSRFADAAGGEQLDDQ 200
           YPCTGSRFADAAGGEQLDDQ
Sbjct: 181 YPCTGSRFADAAGGEQLDDQ 200

>Ecym_4015 Chr4 complement(34835..38608) [3774 bp, 1257 aa] {ON}
            similar to Ashbya gossypii AFR290W
          Length = 1257

 Score = 1447 bits (3746), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 698/950 (73%), Positives = 799/950 (84%), Gaps = 4/950 (0%)

Query: 271  VPTVAVTAKQSSQALMEKLQEIYRNIVRQETELQQRCSQLTTSQTTDLKNLWIIYKVNAE 330
            V TVAV +K SSQ L+EKLQEIY+NIV+QETELQ+RCSQLTTSQTTDLKNLW+IYK+NAE
Sbjct: 309  VSTVAVPSKPSSQTLVEKLQEIYKNIVKQETELQERCSQLTTSQTTDLKNLWVIYKLNAE 368

Query: 331  LIDNYFMFITTALLPTQPEADLLIGKEIIEVYRIERRLWVYGTITFLDVLKNFSNFMDPE 390
            LIDNYF FITTALLPTQP+ADLLIG+EIIEVYRIERRLW+YGTITFLDVLKNFSNFMDPE
Sbjct: 369  LIDNYFTFITTALLPTQPKADLLIGQEIIEVYRIERRLWLYGTITFLDVLKNFSNFMDPE 428

Query: 391  VCCQFIIYVFISISNMLGDIPPKFSIIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYHE 450
            VCCQFI+YVFISISN+LG+IPP FS+IWLERLGDLSRMAIALYPSGFIDWKLSAEHWY E
Sbjct: 429  VCCQFIVYVFISISNILGNIPPTFSVIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYQE 488

Query: 451  ALKYTFGHGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAE 510
            ALKY FGHGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAE
Sbjct: 489  ALKYNFGHGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAE 548

Query: 511  RNSGHHRNAHLVEYLKHTEVMLLPSFLESSELQDVVLAFFEQKFGVTSNVDFFDPRLVFV 570
            RNSGHHR +H+VEYLKHTEVMLLPSFLE+ E Q VVLAFF+QKFG T + +FFDP L+FV
Sbjct: 549  RNSGHHRYSHIVEYLKHTEVMLLPSFLENVESQGVVLAFFDQKFGATGSANFFDPSLIFV 608

Query: 571  QDSERLKHFFRHASLYAESHLLQLVGFGDPRNPFALLFELPKHLXXXXXXXXXXXXXXXX 630
            QD ERLKHFFRHASLYAESH+LQLVGFGDPRNPFALLFELPK +                
Sbjct: 609  QDCERLKHFFRHASLYAESHILQLVGFGDPRNPFALLFELPKCIKERKERKEKRKSKSTA 668

Query: 631  XXQYDTSIDDDCAFAAPSEFFETIDSTKYIYKFPDDINIWKESLSYANVTAMKCSMIVLR 690
              Q D SI DD     P +FFET++STK  Y+F  D+NIWKESL+Y N T+M+CSM+VLR
Sbjct: 669  SNQSDMSI-DDTFLGDPVQFFETLNSTKTAYRFSQDLNIWKESLNYVNKTSMRCSMVVLR 727

Query: 691  KFLHGPLLTALPHLLPWGYFLAATNSRVITIPQDEIRRFWVALVRQLFPFNTIITFLNVL 750
            KFL+  LLTALPHLLPW YFL A   R+  I  ++ +RFW+  +RQ+FP+ +I  FLNVL
Sbjct: 728  KFLNSSLLTALPHLLPWAYFLVAVGLRLDAIRNEDSKRFWIVFIRQIFPWESITNFLNVL 787

Query: 751  LLYMNNQTQANFPFDEYFEQFIDMSLADLVGYFCENEELPEVWECWGTLWFDALNTKHIT 810
            LLY+N+Q    FP DEY   +I+M L +L+ YFCENE+LPEVW CWGTLWFD +N+KH++
Sbjct: 788  LLYINDQKPTKFPIDEYMANYINMPLPELLEYFCENEDLPEVWNCWGTLWFDVINSKHVS 847

Query: 811  NLTDINSTGVKDHMFMDSPIDGISFDHNDESGEKFWKRCARVILLFRALALECPVGLREI 870
            NL DI+STGVKDHMF+D+P+DGISFDH+DESGEKFWKRC RVILLFR +A + P G  E 
Sbjct: 848  NLVDIHSTGVKDHMFLDAPVDGISFDHSDESGEKFWKRCVRVILLFRGIAYQFPFGFTEF 907

Query: 871  SGGRNWRSLVFKFEEPPSEWCDMYLEPFTLVFDTFEQISPVNLDQRATPYCGMTPDIDIR 930
            +G  +W+SLVFKF EPP+EW + YL  F+  +  FE IS VN D ++ P+ GM    DIR
Sbjct: 908  NGSDDWKSLVFKFNEPPAEWKEQYLGSFSKEYGEFESISFVNTDLQSPPHKGMVLGTDIR 967

Query: 931  TLQGYRILLPDYYCFNRNGDMITGSLYTIGTLE-SSGI-HGGDDFNG-KRLLENGELVST 987
            TLQGY+ L+PDY CFN+NGD+ITGSLYT G  E  SG+ +  +DF   KRLLEN  LV++
Sbjct: 968  TLQGYKQLVPDYLCFNKNGDLITGSLYTSGMSEGGSGVPNDSEDFGSTKRLLENELLVTS 1027

Query: 988  ERRDYNSLIDREEQPIMDEFLRHTHCKNDVRWEQMLPRGDLHCFADTHVTYFVLDATTWL 1047
            ERRDYN+L+D+EE PI+DEFL+  +   + RWEQ LPRGDL  F DTHVTYFVLDATTWL
Sbjct: 1028 ERRDYNNLLDKEETPIIDEFLKWRYSSTNSRWEQCLPRGDLQYFTDTHVTYFVLDATTWL 1087

Query: 1048 RHFGHVYKLAANNILKFAICLTTFQELRFLRKSKDESVLEAATRAVITVRQLYYERKLLP 1107
            RHFGHVYKLA +N+LKFAICLTTFQELRFLRKSKDESVLEAATRAVITVRQLYYERKLLP
Sbjct: 1088 RHFGHVYKLATSNLLKFAICLTTFQELRFLRKSKDESVLEAATRAVITVRQLYYERKLLP 1147

Query: 1108 LRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIEAIHKAQDKFNALNDDAKAASRDCIPTG 1167
            LRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIEAI KAQ KFN LN DAKA+ R+ I T 
Sbjct: 1148 LRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIEAIDKAQSKFNQLNKDAKASGRESITTI 1207

Query: 1168 ADQRFNFIALVTDDLNMRNKAGAQNIKAFSTRFMFSVCNELGHAKNVCTN 1217
             D +FNFIALVTDD+NMRNKA AQ+I+AFST+FMF++C+E+G +K VCT+
Sbjct: 1208 DDGKFNFIALVTDDINMRNKARAQSIRAFSTKFMFAICHEIGLSKKVCTD 1257

 Score = 61.6 bits (148), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 28/38 (73%), Positives = 35/38 (92%)

Query: 59  PGSPSYLPTTSSSNLDAAARAIDNSSLRQVSSTTLHDT 96
           P SP YLPTTSSSN++AAA+AID+SS++QVS TTLHD+
Sbjct: 129 PRSPYYLPTTSSSNMEAAAKAIDSSSIKQVSGTTLHDS 166

>SAKL0E15004g Chr5 (1246544..1250134) [3591 bp, 1196 aa] {ON} similar
            to uniprot|P36168 Saccharomyces cerevisiae YKR096W
            Hypothetical ORF
          Length = 1196

 Score = 1191 bits (3080), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 596/972 (61%), Positives = 733/972 (75%), Gaps = 32/972 (3%)

Query: 271  VPTVAVTAKQSSQALMEKLQEIYRNIVRQETELQQRCSQLTTSQTTDLKNLWIIYKVNAE 330
            +P V V  K +SQAL++KLQ+IYR+IV+QE ELQ+RCSQLT SQTTD+KNLW+IYKVNAE
Sbjct: 232  IPIVNVPPKHTSQALVQKLQDIYRSIVKQEIELQERCSQLTNSQTTDMKNLWVIYKVNAE 291

Query: 331  LIDNYFMFITTALLPTQPEADLLIGKEIIEVYRIERRLWVYGTITFLDVLKNFSNFMDPE 390
            LI+NY  FITTALLP+QPE DLLIG+EI+E+YR+ERRLWVYGTITFLDVLKNFSNFMDPE
Sbjct: 292  LINNYISFITTALLPSQPEQDLLIGQEIVEIYRVERRLWVYGTITFLDVLKNFSNFMDPE 351

Query: 391  VCCQFIIYVFISISNMLGDIPPKFSIIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYHE 450
            VCCQFI +VF+SISNMLGD+PP++SI WLERLGDLSRMAIALYPSGFIDWKLSAEHWY +
Sbjct: 352  VCCQFISHVFMSISNMLGDVPPRYSIPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYSQ 411

Query: 451  ALKYTFGHGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAE 510
            AL YT+GHGKLYYHMSTVQQNTL AFVNLGKSVFC+DTFIPSQQYMQLVIDNIYQRAFAE
Sbjct: 412  ALIYTYGHGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFAE 471

Query: 511  RNSGHHRNAHLVEYLKHTEVMLLPSFLESSELQDVVLAFFEQKFGV-TSNVDFFDPRLVF 569
            R+ G  RN  +VEYLKH+EVMLLPSFLES ELQ VVL FF+Q+FGV  +NVDFFD + +F
Sbjct: 472  RSGGSSRNFPIVEYLKHSEVMLLPSFLESPELQKVVLTFFQQRFGVWPNNVDFFDHKQIF 531

Query: 570  VQDSERLKHFFRHASLYAESHLLQLVGFGDPRNPFALLFELPKHLXXXXXXXXXXXXXXX 629
            +QD E+L++FF HA  +AESH+LQLVGFGDPRNPFA+LFELPK L               
Sbjct: 532  IQDGEKLRYFFSHAPAFAESHILQLVGFGDPRNPFAILFELPKFLKERKERKERRRSKSS 591

Query: 630  XXXQYDTSIDDDCAFAAPS--EFFETIDSTKYIYKFPDDINIWKESLSYANVTAMKCSMI 687
                  T++DD    ++ S   +FE IDS +  Y FP DI IW++SLSY N+T+M+CSM 
Sbjct: 592  PPLP--TNLDDGNGSSSISVDHYFENIDSHRVPYSFPQDIQIWQQSLSYLNLTSMECSMS 649

Query: 688  VLRKFLHGPLLTALPHLLPWGYFLAATNSRVITIPQDEIRRFWVALVRQLFPFNTIITFL 747
            VL+KFLH PLLTALPHLLPW +FL +   R+ ++  D +++FW+  +R++FP+N++++FL
Sbjct: 650  VLKKFLHAPLLTALPHLLPWAHFLVSVAIRISSLSSDALKKFWLVFMRRIFPWNSLVSFL 709

Query: 748  NVLLLYMNNQTQANFPFDEYFEQFIDMSLADLVGYFCENEELPEVWECWGTLWFDALNTK 807
            N L+ ++ + ++     ++  E++  M L  LV +F  +EELPEVW+CWGTLWFD ++ K
Sbjct: 710  NTLMAFLLDNSRNMSSVEKLCEEYNKMDLHTLVEHFTNSEELPEVWKCWGTLWFDTISNK 769

Query: 808  HITNLTDINSTGVKDHMFMDSPIDGISFDHNDESGEKFWKRCARVILLFRALALECPVGL 867
                 + + STG++DH+F+D+PIDGI FD +DESG KFWKR  RVI +F+ +A E   G+
Sbjct: 770  SELKASSVQSTGIRDHLFLDAPIDGICFDQDDESGLKFWKRACRVIFMFKGMAKEFHYGI 829

Query: 868  R----EISGGRNWRSL------VFKFEEPPSEW-CDMYLEPFTLVFDTFEQISPVNLDQR 916
            R     IS  R+  +L       FKFEE P EW  +++L+    +   FE ISP+N +  
Sbjct: 830  RVSDTPISTRRDVTTLHALKRFSFKFEELPQEWDNEVFLQSDNFI-KVFEPISPINSNFE 888

Query: 917  ATPYCGMTPDIDIRTLQGYRILLPDYYCFNRNGDMITGSLYTIGTLESSGIHGGDDFNGK 976
            A P   M     I   QGYR + PDYYCFN+NGD+ITGSLYT G LE   I GGDDFN K
Sbjct: 889  AVPSLSMIDGESIFEFQGYRRMYPDYYCFNKNGDLITGSLYTSGLLERVAIQGGDDFNVK 948

Query: 977  RLLENGELVSTERRDYNSLIDREEQP--IMDEFLRH---THCKNDVRWEQM----LPRGD 1027
            R +ENG L++     +NS +D  E+    M E+        C +    E +     P GD
Sbjct: 949  RHVENGVLLAA----HNSPVDCNERTPETMVEYAERKWLNMCMDPAFMESLRDSRFPHGD 1004

Query: 1028 LHCFADTHVTYFVLDATTWLRHFGHVYKLAANNILKFAICLTTFQELRFLRKSKDESVLE 1087
            L C AD++VTYFVLDAT+WLRHF HVYKLA NN+LKFAICLTTFQELRFLRKSKDESV+E
Sbjct: 1005 LACNADSNVTYFVLDATSWLRHFAHVYKLATNNVLKFAICLTTFQELRFLRKSKDESVVE 1064

Query: 1088 AATRAVITVRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIEAIHKAQD 1147
            AATRAVIT RQLYYERKLLPLRFTGN+A HLEEHLE EEQ+TWRSHVDEFVIEA++K+Q 
Sbjct: 1065 AATRAVITARQLYYERKLLPLRFTGNIATHLEEHLEFEEQITWRSHVDEFVIEAVYKSQR 1124

Query: 1148 KFNALNDDAKAASRDCIPTGA--DQRFNFIALVTDDLNMRNKAGAQNIKAFSTRFMFSVC 1205
            KF  LN  A+   ++ IPT    D +FNF+ LVTDDLNMR KA A +I  FS+RFMF+ C
Sbjct: 1125 KFKGLNLQARDQGQEYIPTDPKDDDKFNFVVLVTDDLNMRTKAEAHDIHIFSSRFMFAFC 1184

Query: 1206 NELGHAKNVCTN 1217
            N+LG+ + VC N
Sbjct: 1185 NQLGYNQKVCIN 1196

 Score = 39.7 bits (91), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 20/30 (66%), Positives = 25/30 (83%), Gaps = 2/30 (6%)

Query: 59  PGSPSYLPTTSSSNLDAAARAI--DNSSLR 86
           P SP YLPTTSSSNL+AA++ I  DNSS++
Sbjct: 107 PQSPFYLPTTSSSNLEAASKVITNDNSSVQ 136

>KLLA0A00528g Chr1 complement(44587..48276) [3690 bp, 1229 aa] {ON}
            similar to uniprot|P36168 Saccharomyces cerevisiae
            YKR096W
          Length = 1229

 Score = 1172 bits (3033), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 574/951 (60%), Positives = 722/951 (75%), Gaps = 23/951 (2%)

Query: 285  LMEKLQEIYRNIVRQETELQQRCSQLTTSQTTDLKNLWIIYKVNAELIDNYFMFITTALL 344
            L+EKLQEIY++IV+QETELQ+RCS LTT QTTDLKNLW+ YK+NAELIDNY +FITTALL
Sbjct: 284  LVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNYILFITTALL 343

Query: 345  PTQPEADLLIGKEIIEVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIIYVFISIS 404
            P+Q E+ L IG+EI++VYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFI YVFI++S
Sbjct: 344  PSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIAYVFIALS 403

Query: 405  NMLGDIPPKFSIIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYHEALKYTFGHGKLYYH 464
            NML D+PPK+SI WLERLGDLSRMAIALYPSGF+DWKLSAEHWY E+LK+TFGHGKLYYH
Sbjct: 404  NMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRESLKFTFGHGKLYYH 463

Query: 465  MSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNSGHHRNAHLVEY 524
            MSTVQQNTL AFVNLGKSVFC D F+PS QYMQLVIDNIYQRAFAER+S  +R  H+V+Y
Sbjct: 464  MSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFAERDSSGNRTNHIVDY 523

Query: 525  LKHTEVMLLPSFLESSELQDVVLAFFEQKFGVTSNVDFFDPRLVFVQDSERLKHFFRHAS 584
            LKHTEVMLLPSFLESSELQ+VV+ +F+ KFGV+S+ +FFDP L+F+QD+ERLKHFFRH+S
Sbjct: 524  LKHTEVMLLPSFLESSELQNVVIHYFQHKFGVSSSGNFFDPNLIFIQDAERLKHFFRHSS 583

Query: 585  LYAESHLLQLVGFGDPRNPFALLFELPKHLXXXXXXXXXXXXXXXXXXQYDTSIDDDCAF 644
            L+++SH+LQL GFGDP+NPFA+LFEL KHL                       ++     
Sbjct: 584  LFSQSHILQLCGFGDPKNPFAMLFELSKHLKSRKERKERKKSTKSTSEGSLDPVEFSSQQ 643

Query: 645  AAPSE-FFETIDSTKYIYKFPDDINIWKESLSYANVTAMKCSMIVLRKFLHGPLLTALPH 703
             A +E FF TIDS K  Y+FP D+ +WK SL Y NVT+MKC MIVLR+FL+GP++TALPH
Sbjct: 644  QASTEDFFSTIDSPKVPYEFPLDLGVWKRSLHYINVTSMKCGMIVLRRFLYGPIVTALPH 703

Query: 704  LLPWGYFLAATNSRVITIPQDEIRRFWVALVRQLFPFNTIITFLNVLLLYMNNQTQANFP 763
            +LPW  F+ +   R+  +    +++FW+  +R++FP++++ITF+N L+ Y       NF 
Sbjct: 704  VLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPWDSLITFMNTLIHYCMVTGTKNFD 763

Query: 764  FDEYFEQFIDMSLADLVGYFCENEELPEVWECWGTLWFDALNTKHITNLTDINSTGVKDH 823
             D +   ++ M+  +L+   CENE LPE W CWG+LWF+ ++ K   ++T + STG+ D 
Sbjct: 764  IDAHMSTYLPMNREELLTSICENENLPECWSCWGSLWFNTISKKSDLDVTTLESTGLSDT 823

Query: 824  MFMDSPIDGISFDHNDESGEKFWKRCARVILLFRALA--LECPV---GLREIS-GGRNWR 877
            +F+DSP +GI FD +DE G K+W+R  R +LLF  +     C     G ++++    +W+
Sbjct: 824  LFLDSPTEGICFDDDDEFGRKYWQRICRTLLLFNIITEWEACDGYGHGCKKLNPEATSWK 883

Query: 878  SLVFKFEEPPSEWCDMYLEP---FTLVFDTFEQISPVNL-DQRATPYCGMTPDIDIRTLQ 933
            +LVF+F +  ++   + L P    +  F+ FE IS +N  D        M P + I  LQ
Sbjct: 884  NLVFRFNDDTNDQLSVELYPEENESFPFEKFEIISNLNCSDNLQDGSKSMIPGVSIENLQ 943

Query: 934  GYRILLPDYYCFNRNGDMITGSLYTIGTLESSGIHGGDDFNGKRLLENGELVSTERRDYN 993
            G++++ PDY+CFN+NGD+IT SLYT G LE++ I GGDDFN  ++L+NG LV  +R +Y+
Sbjct: 944  GFKLMYPDYFCFNKNGDLITASLYTKGPLETANIQGGDDFNANKILDNGRLVVQDRLEYS 1003

Query: 994  SLIDREEQPIMDEFLRHTHCKNDVRWEQMLPR---GDLHCFADTHVTYFVLDATTWLRHF 1050
            S ID+ EQP ++ F+       D R  ++L R   G+L+C ADT+VT+FVLDATTWLRHF
Sbjct: 1004 SAIDKLEQPWLEAFMNP-----DFRQRELLNRSFLGNLNCQADTNVTFFVLDATTWLRHF 1058

Query: 1051 GHVYKLAANNILKFAICLTTFQELRFLRKSKDESVLEAATRAVITVRQLYYERKLLPLRF 1110
             H+YKLA +++LKFAICLTTFQELRFLRKSKDESVLEAATRAVI VRQLYYERKLL LRF
Sbjct: 1059 AHIYKLATSSVLKFAICLTTFQELRFLRKSKDESVLEAATRAVIAVRQLYYERKLLALRF 1118

Query: 1111 TGNVAGHLEEHLEIEEQMTWRSHVDEFVIEAIHKAQDKFNALNDDAKAASRDCIPTGAD- 1169
            TGNVAGHLEEHLEIEEQMTW+SHVDEFVI+AI KAQDKFN LN+DA    +DCIP   D 
Sbjct: 1119 TGNVAGHLEEHLEIEEQMTWKSHVDEFVIDAIAKAQDKFNVLNNDAIEKGKDCIPLSEDG 1178

Query: 1170 ---QRFNFIALVTDDLNMRNKAGAQNIKAFSTRFMFSVCNELGHAKNVCTN 1217
               QRFNF++LVTDD NMRNKA    I+ FSTRF+F++C ELG    VCTN
Sbjct: 1179 QSTQRFNFVSLVTDDFNMRNKAQQLGIRTFSTRFVFAICRELGRETGVCTN 1229

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 29/52 (55%), Gaps = 8/52 (15%)

Query: 41  PRGGLTACGLVVDAIGAEPGSPSYLPTTSSSNLDAAARAIDNSSLRQVSSTT 92
           PRG        VD  G  P SP YLPTTS +N +AA    +NSS+R+  S T
Sbjct: 93  PRG--------VDTSGEFPQSPFYLPTTSQTNFEAATTVNENSSIRRSDSVT 136

>KLTH0E00968g Chr5 complement(92019..95465) [3447 bp, 1148 aa] {ON}
            similar to uniprot|P36168 Saccharomyces cerevisiae
            YKR096W Hypothetical ORF
          Length = 1148

 Score = 1138 bits (2943), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 573/968 (59%), Positives = 711/968 (73%), Gaps = 40/968 (4%)

Query: 271  VPTVAVTAKQSSQALMEKLQEIYRNIVRQETELQQRCSQLTTSQTTDLKNLWIIYKVNAE 330
             P    T+ Q+SQAL++KLQ+IYRNIV+QE ELQ+RCSQLT SQTTDLKNLWIIYKVN E
Sbjct: 200  TPAAGQTSSQTSQALVQKLQDIYRNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTE 259

Query: 331  LIDNYFMFITTALLPTQPEADLLIGKEIIEVYRIERRLWVYGTITFLDVLKNFSNFMDPE 390
            LI+NY  FITTALLP+QPE DLLIG+EI+ +YRIERRLWV+GTITFLDVLKNFSNFMDPE
Sbjct: 260  LINNYVAFITTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPE 319

Query: 391  VCCQFIIYVFISISNMLGDIPPKFSIIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYHE 450
            VCCQFI +VFISISNMLGD+P KF+  WLERLGDLSRMAIALYPSGFIDWKLSAEHWY +
Sbjct: 320  VCCQFITHVFISISNMLGDMPQKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQ 379

Query: 451  ALKYTFGHGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAE 510
            AL + FGHGKLYYHMSTVQQNTL AFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAE
Sbjct: 380  ALSHIFGHGKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAE 439

Query: 511  RNSGHHRNAHLVEYLKHTEVMLLPSFLESSELQDVVLAFFEQKFGVTS-NVDFFDPRLVF 569
            RN G+ RN+ +VEYLKH+EVMLL SFLES ELQ VVL+FF+ KFG++S N D+F  + +F
Sbjct: 440  RNGGNQRNSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQNKFGISSNNTDYFSHQAIF 499

Query: 570  VQDSERLKHFFRHASLYAESHLLQLVGFGDPRNPFALLFELPKHLXXXXXXXXXXXXXXX 629
            +QD ER K+FFRHA  +AESH+LQ+VGFG+P+NPFALLFELPK L               
Sbjct: 500  LQDGERTKYFFRHAPAFAESHILQMVGFGNPKNPFALLFELPKFLKERKERKERRKSKSS 559

Query: 630  XXXQYDTSIDDDCAFAAPSEFFETIDSTKYIYKFPDDINIWKESLSYANVTAMKCSMIVL 689
                  TS++      +P E+ E++DS +++Y+FP D+ IW++SLS+ N T++KCS +VL
Sbjct: 560  NSF---TSMEAPSP-TSPIEYLESVDSPRFVYEFPTDLAIWQQSLSHINTTSIKCSAVVL 615

Query: 690  RKFLHGPLLTALPHLLPWGYFLAATNSRVITIPQDEIRRFWVALVRQLFPFNTIITFLNV 749
            +KFLHGPL++A  HLLPW YFL +   R+  +P  E++ FW+AL RQ+FP+N+I+ FLN+
Sbjct: 616  QKFLHGPLVSAAAHLLPWAYFLLSLAIRIDELPSPELKDFWIALCRQVFPWNSIVNFLNM 675

Query: 750  LLLYMNNQTQANFPFDEYFEQFIDMSLADLVGYFCENEELPEVWECWGTLWFDALNTKHI 809
            ++ +  +        D   EQF  + +  LV +F +NE+LPEVW+CWG LWFD ++ K  
Sbjct: 676  IIAFALDNAWKTSSIDNLCEQFDSVDVRTLVDHFSQNEDLPEVWKCWGALWFDVISDK-- 733

Query: 810  TNLTDINST--GVKDHMFMDSPIDGISFDHNDESGEKFWKRCARVILLFRALALECPVGL 867
            +++ D  +T   V+DHMF D P+DGI FD +DE+G +FWKR  R++ +F+ +A E  +GL
Sbjct: 734  SDVVDEGATYNSVQDHMFGDMPVDGICFDEDDETGSRFWKRACRLVFIFKGIAQEFNMGL 793

Query: 868  ----------REISGGRNWRSLVFKFEEPPSEWCDMYLEPFTLV---FDTFEQISPVNLD 914
                      R ++ G   ++  FKFE+PP +      E + L+      FE IS  NLD
Sbjct: 794  TLASVPLQSRRSLAAGHPLQNFCFKFEDPPVD-----SESYALISTQMPAFENISERNLD 848

Query: 915  QRATPYCGMTPDIDIRTLQGYRILLPDYYCFNRNGDMITGSLYTIGTLESSGIHGGDDFN 974
              A P   M     +  L GYR L  D+ CFN+ G +IT SLYT G+LE   IHGGDDFN
Sbjct: 849  PNAPPGQSMLEGKSLFELPGYRQLHADHTCFNKTGTLITCSLYTSGSLEKGPIHGGDDFN 908

Query: 975  GKRLLENGELVSTERRDYNSLIDREEQPIMD-----EFLRHTHCKNDVRWEQMLPRGDLH 1029
             +R   + EL   +      L D+ E+  +D     EF+  T       ++   P GDL 
Sbjct: 909  TERYSRSDELNKADNPQIKEL-DKMERMWLDTCMNPEFIEQT-------YDMKFPFGDLS 960

Query: 1030 CFADTHVTYFVLDATTWLRHFGHVYKLAANNILKFAICLTTFQELRFLRKSKDESVLEAA 1089
            C  D+ V+YFV DAT+WLRHF HVYKLA N +L+FAICLTTFQELRFLRKSKDESV+EAA
Sbjct: 961  CNCDSGVSYFVPDATSWLRHFAHVYKLATNGVLRFAICLTTFQELRFLRKSKDESVVEAA 1020

Query: 1090 TRAVITVRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIEAIHKAQDKF 1149
            TRAVITVRQLY E++LLPLRFTGNVA HLEEHLE EEQ+TWRSHVDEFVIEA++KAQ+KF
Sbjct: 1021 TRAVITVRQLYSEKRLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQNKF 1080

Query: 1150 NALNDDAKAASRDCIPTGADQRFNFIALVTDDLNMRNKAGAQNIKAFSTRFMFSVCNELG 1209
             ALN  AK    D IPT  ++ F+FIALV+DD NMR KA AQ I+ FS+RFMF+VCN++G
Sbjct: 1081 EALNAQAKEGGHDFIPTTEEEPFHFIALVSDDTNMRLKAHAQRIRTFSSRFMFAVCNQIG 1140

Query: 1210 HAKNVCTN 1217
             A + CTN
Sbjct: 1141 LAHHACTN 1148

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 44/78 (56%), Gaps = 9/78 (11%)

Query: 18 ALHQKRHSSALGGCRDGLAKRRGPRG----GLTACGLVVDAIGA-----EPGSPSYLPTT 68
          A  +++HS +      G+ KRR   G       A  L +D+ G+     +  SPSY+PTT
Sbjct: 21 AQQKRQHSRSCDYMGSGVNKRRLGSGISGAAAAAAALFLDSGGSPVRRKDAQSPSYMPTT 80

Query: 69 SSSNLDAAARAIDNSSLR 86
          SSSNL+AAA   +NSS+R
Sbjct: 81 SSSNLEAAAVENENSSVR 98

>Kwal_55.19678 s55 complement(75394..78930) [3537 bp, 1178 aa] {ON}
            YKR096W - Hypothetical ORF [contig 159] FULL
          Length = 1178

 Score = 1121 bits (2900), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 571/966 (59%), Positives = 700/966 (72%), Gaps = 42/966 (4%)

Query: 274  VAVTAKQSSQALMEKLQEIYRNIVRQETELQQRCSQLTTSQTTDLKNLWIIYKVNAELID 333
            V+ ++  +SQAL++KLQ+IYRNIV+QE ELQ+RC+QLTTSQTTDLKNLWIIYK+N ELI+
Sbjct: 233  VSPSSSPTSQALVQKLQDIYRNIVKQEVELQERCAQLTTSQTTDLKNLWIIYKINIELIN 292

Query: 334  NYFMFITTALLPTQPEADLLIGKEIIEVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCC 393
            NY  FITTALLP+QPE DLLIG+EI+ +YRIERRLWV+GTITFLDVLKNFSNFMDPEVCC
Sbjct: 293  NYVAFITTALLPSQPEQDLLIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCC 352

Query: 394  QFIIYVFISISNMLGDIPPKFSIIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYHEALK 453
            QFI +VFISIS MLGD+P KFS  W ERLGDLSRMAIALYPSGFIDWKLSAEHWY +AL 
Sbjct: 353  QFITHVFISISTMLGDMPQKFSTPWFERLGDLSRMAIALYPSGFIDWKLSAEHWYSQALS 412

Query: 454  YTFGHGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNS 513
            + FGHGKLYYHMSTVQQNTL AFVNLGKSVFCRDTFIPS QYMQLVIDNIYQRAFAERN 
Sbjct: 413  HIFGHGKLYYHMSTVQQNTLEAFVNLGKSVFCRDTFIPSPQYMQLVIDNIYQRAFAERNG 472

Query: 514  GHHRNAHLVEYLKHTEVMLLPSFLESSELQDVVLAFFEQKFGV-TSNVDFFDPRLVFVQD 572
            G+HRN+ +VEYLKH+EVMLL SFLES ELQ VVL+FF+ KFGV TSN DFF+PR +F+QD
Sbjct: 473  GNHRNSLMVEYLKHSEVMLLSSFLESPELQKVVLSFFQHKFGVSTSNTDFFNPRDMFLQD 532

Query: 573  SERLKHFFRHASLYAESHLLQLVGFGDPRNPFALLFELPKHLXXXXXXXXXXXXXXXXXX 632
             ER+K+FFRHA  +AESH+LQ VGFGDP+NPFALLFELPK L                  
Sbjct: 533  GERVKYFFRHAPAFAESHILQTVGFGDPKNPFALLFELPKFLKERKERKERRKSKSSHSF 592

Query: 633  QYDTSIDDDCAFAAPSEFFETIDSTKYIYKFPDDINIWKESLSYANVTAMKCSMIVLRKF 692
               TSI +  +  +PSE+ E +DS +Y Y+FP+D+ IW+ESLS+ N+T+ +CS IV +KF
Sbjct: 593  ---TSI-ETTSHLSPSEYLENVDSPRYAYEFPEDLAIWRESLSHINITSARCSSIVFQKF 648

Query: 693  LHGPLLTALPHLLPWGYFLAATNSRVITIPQDEIRRFWVALVRQLFPFNTIITFLNVLLL 752
            L GPL+ A+ H+LPW YFL +   ++ ++P  E++ FW+ LVRQ+FP+N+I+ FLN+L+ 
Sbjct: 649  LRGPLVVAVTHMLPWSYFLLSLALKIDSLPSVELKSFWITLVRQIFPWNSIVDFLNMLMA 708

Query: 753  YMNNQTQANFPFDEYFEQFIDMSLADLVGYFCENEELPEVWECWGTLWFDALNTKHITNL 812
            ++ +      P D   EQ   +    LV +F E+E+LPE+W CWG LWFD +  K     
Sbjct: 709  FVLDNNWKTSPIDTLCEQLDSVDARSLVEHFSEHEDLPEIWRCWGALWFDVIADKSNGED 768

Query: 813  TDINSTGVKDHMFMDSPIDGISFDHNDESGEKFWKRCARVILLFRALALECPVGL----- 867
             D+ ++G KDH F D P DGI FD +DE GEKFWKR  R+I +F+ +A E  +GL     
Sbjct: 769  GDVINSGSKDHPFWDLPGDGICFDEDDEVGEKFWKRACRLIFIFKGIAQEFSLGLTLSAF 828

Query: 868  -----REISGGRNWRSLVFKFEEPPSEWCDMYLEPFTL-VFDTFEQISPVNLDQRATPYC 921
                 R ++ G   ++  F FEE P++     ++ F       FE+I+  NLD    P  
Sbjct: 829  APQSRRPMTAGHPLQNFSFNFEEIPAQ---SQIQSFVRNQIPLFEEIATGNLDPNIRPGQ 885

Query: 922  GMTPDIDIRTLQGYRILLPDYYCFNRNGDMITGSLYTIGTLESSGIHGGDDFNGKRL--- 978
             M     I    GYR +  DY CFN++G +I+ SLYT G LE   I GGDDFN +R    
Sbjct: 886  SMLEGESIFDFPGYRQMYADYTCFNKSGSLISCSLYTSGKLERGPIQGGDDFNTERYGRS 945

Query: 979  -----LENGELVSTER--RDYNSLIDREEQPIMDEFLRHTHCKNDVRWEQMLPRGDLHCF 1031
                  EN ++   ER  RD+   +D    P   EF+          +E   P GDL C 
Sbjct: 946  EDSNKPENAQITELERLERDW---LDNCMNP---EFIEQA-------YEMKFPFGDLSCN 992

Query: 1032 ADTHVTYFVLDATTWLRHFGHVYKLAANNILKFAICLTTFQELRFLRKSKDESVLEAATR 1091
             D+ V+YFVLDAT+WLRHF HV+KLA NN+L+F ICLTTFQELRFLRKSKDESV+EAATR
Sbjct: 993  CDSGVSYFVLDATSWLRHFAHVFKLATNNVLRFGICLTTFQELRFLRKSKDESVVEAATR 1052

Query: 1092 AVITVRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIEAIHKAQDKFNA 1151
            AVITVRQLY ++KLLPLRFTGNVA HLEEHLE EEQ+TWRSHVDEFVIEA++KAQ KF A
Sbjct: 1053 AVITVRQLYSDKKLLPLRFTGNVATHLEEHLEFEEQITWRSHVDEFVIEAVYKAQKKFEA 1112

Query: 1152 LNDDAKAASRDCIPTGADQRFNFIALVTDDLNMRNKAGAQNIKAFSTRFMFSVCNELGHA 1211
            +N  AK A  D I T  ++ F+F+ALV+DD NMR KA  Q I+ FSTRFMF+VCN++G A
Sbjct: 1113 INAQAKEAGHDFIATTDEEPFHFVALVSDDTNMRVKAHTQRIQTFSTRFMFAVCNQIGLA 1172

Query: 1212 KNVCTN 1217
               CTN
Sbjct: 1173 HQACTN 1178

 Score = 38.1 bits (87), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 22/47 (46%), Positives = 27/47 (57%), Gaps = 4/47 (8%)

Query: 39  RGPRGGLTACGLVVDAIGAEPGSPSYLPTTSSSNLDAAARAIDNSSL 85
           RGP  G+    +  D       SPSYLPTTSSSNL+AA    +N S+
Sbjct: 77  RGPTIGMPHSVMSAD----NAYSPSYLPTTSSSNLEAAVTENENGSV 119

>ZYRO0B16412g Chr2 (1329195..1333313) [4119 bp, 1372 aa] {ON} similar
            to uniprot|P36168 Saccharomyces cerevisiae YKR096W
            Hypothetical ORF
          Length = 1372

 Score = 1071 bits (2771), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 533/981 (54%), Positives = 683/981 (69%), Gaps = 45/981 (4%)

Query: 271  VPTVAVTAKQSSQALMEKLQEIYRNIVRQETELQQRCSQLTTSQTTDLKNLWIIYKVNAE 330
            VP+V V +K+SSQAL++KLQ+IY+ IV+QE ELQ+RCSQLTTSQTT+LKNLW IYK+N++
Sbjct: 403  VPSVVVPSKRSSQALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINSD 462

Query: 331  LIDNYFMFITTALLPTQPEADLLIGKEIIEVYRIERRLWVYGTITFLDVLKNFSNFMDPE 390
            LI+NY  F+TTALLP+Q E D+LIG+EI+E+YRIERRLWVYGTITFLD+ KNFSNFMDPE
Sbjct: 463  LINNYVTFLTTALLPSQTEQDILIGEEIVEIYRIERRLWVYGTITFLDIFKNFSNFMDPE 522

Query: 391  VCCQFIIYVFISISNMLGDIPPKFSIIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYHE 450
            VCCQFI +VFISISNMLGDIPPK+ I WL+RLGDLSRMAIALYPSGFIDWKLSAEHWY E
Sbjct: 523  VCCQFITHVFISISNMLGDIPPKYGIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYME 582

Query: 451  ALKYTFGHGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAE 510
            A+K+T+ HGKLYYHMSTVQQNTL AFVNLGKSVFC+DTFIPSQQYMQLVIDNIYQRAF E
Sbjct: 583  AMKFTYSHGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFIPSQQYMQLVIDNIYQRAFVE 642

Query: 511  RNSGHHRNAHLVEYLKHTEVMLLPSFLESSELQDVVLAFFEQKFGVTS-NVDFFDPRLVF 569
            RN+G+HRN  L+EYLKH+EVMLLPSFLES++LQ VVL +F+ KFG  S NV+ FD R +F
Sbjct: 643  RNNGNHRNTQLIEYLKHSEVMLLPSFLESADLQQVVLIYFKAKFGCDSNNVNIFDTRKMF 702

Query: 570  VQDSERLKHFFRHASLYAESHLLQLVGFGDPRNPFALLFELPKHLXXXXXXXXXXXXXXX 629
             Q+ + L++FFRHA  +AESH+LQLVGFGDP+NPFALLFELP+ L               
Sbjct: 703  CQNPDYLRYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPRFLKDRKDKKEKRRTKST 762

Query: 630  XXXQYDT--SIDD-----DCAFAAPSEFFETIDSTKYIYKFPDDINIWKESLSYANVTAM 682
               +  +  +IDD         + P  FF  I++ ++ Y  P ++ IW ESL+Y N+T++
Sbjct: 763  TVTETSSTMAIDDLEDEQSDRMSTPEGFFGNIETLRFPYSVPSNLEIWNESLNYINMTSL 822

Query: 683  KCSMIVLRKFLHGPLLTALPHLLPWGYFLAATNSRVITIPQDEIRRFWVALVRQLFPFNT 742
            KCSM+VL+KFL GPL+ ALPH +PW YF+ +   ++  +  +  R+FWV  V ++FP+NT
Sbjct: 823  KCSMVVLQKFLKGPLVVALPHFMPWTYFIISLAYKIKDLNHESSRKFWVEFVDRIFPWNT 882

Query: 743  IITFLNVLLLYMNNQTQANFPFDEYFEQFIDMSLADLVGYFCENEELPEVWECWGTLWFD 802
            I++FLNVL+ YM + +  +   D    Q+  M L DL+ YF  NE LPEVW+CWGTLWFD
Sbjct: 883  IVSFLNVLIAYMLDNSWKSSLVDSLCGQYSSMGLEDLLDYFNNNEVLPEVWKCWGTLWFD 942

Query: 803  ALNTKHITNLTDINSTGVKDHMFMDSPIDGISFDHNDESGEKFWKRCARVILLFRALALE 862
             +  K  +++ D+ S G+K+HMF+D+PIDGI+FD NDESGE FWKR  R+I LF+ LA  
Sbjct: 943  TICNKEQSHVEDLESVGIKNHMFLDAPIDGIAFDANDESGENFWKRACRIIFLFKGLAEN 1002

Query: 863  CPVGL------------REISGGRNWRSLVFKFEE-----------PPSEWCDMYLEPFT 899
             P+G+             ++S     +S  FK              P      + L+   
Sbjct: 1003 FPIGITLSPVAPVYCRRNDVSPYHILKSFSFKLRRGSDSELVPMNPPQPSTTAIDLDHLK 1062

Query: 900  LVFDTFEQISPVNLDQRATPYCGMTPDIDIRTLQGYRILLPDYYCFNRNGDMITGSLYTI 959
               + FE+ S  N+     P   +     I    GYR L PDY+ +++NG+ ++ SLYT 
Sbjct: 1063 NTLEIFEEASWENIHMDTIPMLSVIEGESIFDYAGYRRLHPDYFSYDKNGEFLSASLYT- 1121

Query: 960  GTLESSGIHGGDDFNGKRLLENGELVSTERRDYNSLIDREEQPIMDEFLRHTHCKNDVRW 1019
                 S     +  N   +  +G  V ++R    S+   +E  I ++ +   +C      
Sbjct: 1122 -----SWYANNNTNNTGVIPAHGSDVDSQRDAVQSV---QEMHIFNQIMEPGYCGGFA-- 1171

Query: 1020 EQMLPRGDLHCFADTHVTYFVLDATTWLRHFGHVYKLAANNILKFAICLTTFQELRFLRK 1079
            + +  R  L+  A +  TYFVLD TTWLRHFGH+YKLA++ +LKFAICLTTF ELRFLRK
Sbjct: 1172 DDLFLRDALYQTAHSSTTYFVLDTTTWLRHFGHIYKLASSGVLKFAICLTTFHELRFLRK 1231

Query: 1080 SKDESVLEAATRAVITVRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVI 1139
             KDE+V+EAATRA+ITVRQLY E KLLPLRFTGNVA H+EEHLE EE++TWRSHVDEFVI
Sbjct: 1232 PKDENVVEAATRAIITVRQLYSEGKLLPLRFTGNVATHIEEHLEFEEKITWRSHVDEFVI 1291

Query: 1140 EAIHKAQDKFNALNDDAKAASRDCIPTGA-DQR--FNFIALVTDDLNMRNKAGAQNIKAF 1196
            EA++KAQ KF  +N              A D R    F+ LVTDD NMR KA  Q+++ F
Sbjct: 1292 EAVYKAQSKFQEMNQLQLEQEEQQHQLRAHDDRSGLKFVVLVTDDSNMRKKAQDQDVRTF 1351

Query: 1197 STRFMFSVCNELGHAKNVCTN 1217
            ST+F+FS+CN +G    +CTN
Sbjct: 1352 STKFVFSLCNSIGLRSKICTN 1372

>TDEL0B02140 Chr2 complement(380503..383946) [3444 bp, 1147 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1147

 Score = 1018 bits (2633), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 526/971 (54%), Positives = 658/971 (67%), Gaps = 73/971 (7%)

Query: 271  VPTVAVTAKQSSQALMEKLQEIYRNIVRQETELQQRCSQLTTSQTTDLKNLWIIYKVNAE 330
            VP+V V +K+SSQAL++KLQ+IY+ IV+QE ELQ+RCSQLT SQTT+LK LW+IYKVN++
Sbjct: 226  VPSVVVPSKKSSQALVQKLQDIYKVIVKQEIELQERCSQLTNSQTTELKQLWVIYKVNSD 285

Query: 331  LIDNYFMFITTALLPTQPEADLLIGKEIIEVYRIERRLWVYGTITFLDVLKNFSNFMDPE 390
            LI+NY  FITTALLP Q + DL IG+EI+E+YRIERRLWVYGTITFLDVLKNFSNFMDPE
Sbjct: 286  LINNYVTFITTALLPPQSDQDLAIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPE 345

Query: 391  VCCQFIIYVFISISNMLGDIPPKFSIIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYHE 450
            VC QFI +VFISISNML DIP +++I W +RLGDLSRMAIALYPSGFIDWKLSAEHWY E
Sbjct: 346  VCAQFITHVFISISNMLADIPSRYAIPWYQRLGDLSRMAIALYPSGFIDWKLSAEHWYME 405

Query: 451  ALKYTFGHGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAE 510
            A+KY +GHGKLYYHMSTVQQNTL AFVNLGKSVFC+DTF PSQQYMQLVIDNIYQRAF E
Sbjct: 406  AMKYIYGHGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRAFVE 465

Query: 511  RNSGHHRNAHLVEYLKHTEVMLLPSFLESSELQDVVLAFFEQKFGVTSNV-DFFDPRLVF 569
            RN+G+HRN+ L+EYLKH+EVMLLPSFLES++LQ VVL +F  KFG+ +N  + FD R +F
Sbjct: 466  RNNGNHRNSQLIEYLKHSEVMLLPSFLESTDLQQVVLIYFRDKFGMDTNENNIFDTRQMF 525

Query: 570  VQDSERLKHFFRHASLYAESHLLQLVGFGDPRNPFALLFELPKHLXXXXXXXXXXXXXXX 629
             Q+ ++LK+FFRHA  +AESH+LQLVGFGDP+NPFALLFELP+ L               
Sbjct: 526  DQNPDQLKYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPRCLKDRRDKKEKRKTKSS 585

Query: 630  XXXQYDT--SIDD----DCAF---AAPSEFFETIDSTKYIYKFPDDINIWKESLSYANVT 680
               +  +  +ID+    D +F   A   +FF+ IDS    Y FP  + +W  SL Y N+T
Sbjct: 586  VTTETSSAMAIDEEEYIDSSFSLGAQVQQFFDNIDSLTSPYLFPPSLEVWNCSLKYLNIT 645

Query: 681  AMKCSMIVLRKFLHGPLLTALPHLLPWGYFLAATNSRVITIPQDEIRRFWVALVRQLFPF 740
            ++ CSMIVL+KFL GP++ ALPHLLPW YF+ A  S+V  I     R FW+ LV ++FP+
Sbjct: 646  SLHCSMIVLKKFLEGPMVVALPHLLPWAYFIIAVVSKVQHITDGASREFWLELVNRIFPW 705

Query: 741  NTIITFLNVLLLYMNNQTQANFPFDEYFEQFIDMSLADLVGYFCENEELPEVWECWGTLW 800
            NTI+ FLNVL+ Y  +    + P D   E+   M L  LV +F  NE+LPEVW+CWG LW
Sbjct: 706  NTIVNFLNVLIAYTLDNIHPSLPIDPLCEELSTMGLDQLVEHFNNNEDLPEVWKCWGLLW 765

Query: 801  FDALNTKHITNLTDINSTGVKDHMFMDSPIDGISFDHNDESGEKFWKRCARVILLFRALA 860
            FDA+  K    +    S G+KDHMF+D PIDGI FD +DESG KFWKR  RVI LF+ +A
Sbjct: 766  FDAICDKDKVQMDSYESAGIKDHMFLDLPIDGIGFDRDDESGIKFWKRACRVIFLFKRIA 825

Query: 861  LECPVGL-----------REISGGRNWRSLVFKFEEPPSEWCDMYLEPFTLVFDT---FE 906
                  L           R        +S  FK         D +    +++ +T   FE
Sbjct: 826  ENFQTRLVVSSQAQVHCRRTDPMNHVLKSFCFKLR-------DTFYNSNSVLQNTIEVFE 878

Query: 907  QISPVNLDQRATPYCGMTPDIDIRTLQGYRILLPDYYCFNRNGDMITGSLYTIGTLESSG 966
            + S  N D + TP   +  +  I    GY+ LL D  C++R G+ ++ SLYT    E+S 
Sbjct: 879  EGSDANKDMQMTPQLSVLENESIFGYVGYKRLLSDLSCYDRGGEFVSTSLYTSWGNETS- 937

Query: 967  IHGGDDFNGKRLLENGELVSTERRDYNSLIDREEQPIMDEFLRHTHCKNDVRWEQMLPRG 1026
                     K  +   E   T+++  N      E  +  E +  +  + ++ + +     
Sbjct: 938  ---------KNEIPQSE--PTQQQTAN------EADLFIEGINTSLTEFNIDFPE----- 975

Query: 1027 DLHCFADTHVTYFVLDATTWLRHFGHVYKLAANNILKFAICLTTFQELRFLRKSKDESVL 1086
               C  +   T+FVLDAT+WLRHF HVYKLA+N +L+FAICLTTFQELRFLRKSKDE+V+
Sbjct: 976  ---CKMNGKDTFFVLDATSWLRHFAHVYKLASNQVLQFAICLTTFQELRFLRKSKDENVV 1032

Query: 1087 EAATRAVITVRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIEAIHKAQ 1146
            EAATRAVITVRQLY E ++LPLRFTGNVA H+EEHLE EEQ+TWRSHVDEFV EAI KAQ
Sbjct: 1033 EAATRAVITVRQLYTENRILPLRFTGNVATHIEEHLEFEEQITWRSHVDEFVFEAIKKAQ 1092

Query: 1147 DKFNALNDDAKAASRDCIPTGADQRFNFIALVTDDLNMRNKAGAQNIKAFSTRFMFSVCN 1206
             + +  N D                F+ + LVTDD NMR KA    I   STRF+F+ CN
Sbjct: 1093 ARLSQENRD----------------FHHVVLVTDDANMRRKAQQHAIHTLSTRFVFATCN 1136

Query: 1207 ELGHAKNVCTN 1217
             +G+   +CTN
Sbjct: 1137 AVGNRLKICTN 1147

>KNAG0C06630 Chr3 (1284481..1288326) [3846 bp, 1281 aa] {ON} Anc_5.706
            YIL151C
          Length = 1281

 Score =  977 bits (2525), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 508/1008 (50%), Positives = 668/1008 (66%), Gaps = 80/1008 (7%)

Query: 279  KQSSQALMEKLQEIYRNIVRQETELQQRCSQLTTSQTTDLKNLWIIYKVNAELIDNYFMF 338
            ++SSQAL++KLQ+IY+ IV+QE ELQ+RCSQLTTSQTT+LKNLW IYK+N +LI+NY  F
Sbjct: 285  RKSSQALVQKLQDIYKVIVKQEIELQERCSQLTTSQTTELKNLWTIYKINTDLINNYTTF 344

Query: 339  ITTALLPTQPEADLLIGKEIIEVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIIY 398
            ITTALLP+QP  D+LIG+EI+E+YRIERRLWVYGTITFLDVLKNFSNFMDPEVC QFI +
Sbjct: 345  ITTALLPSQPAQDILIGEEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCSQFITH 404

Query: 399  VFISISNMLGDIPPKFSIIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYHEALKYTFGH 458
            VFIS+S +L DIPPK +I WL+RLGDLSRMAIALYPSGFIDWKLSAEHWY EA+K+T+ H
Sbjct: 405  VFISLSAILIDIPPKHAIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYMEAMKFTYSH 464

Query: 459  GKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNS-GHHR 517
            GKLYYHMSTVQQNTL AFVNLGKSVFC+DTF PSQQYMQLVIDNIYQR F +RN+ G++R
Sbjct: 465  GKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVDRNTGGNYR 524

Query: 518  NAHLVEYLKHTEVMLLPSFLESSELQDVVLAFFEQKFGVT-SNVDFFDPRLVFVQDSERL 576
            N  L++YLKH+EVMLLPSFL S +LQ VVL +F+ +FG+  S  + FD + +F Q    L
Sbjct: 525  NPDLIDYLKHSEVMLLPSFLGSKDLQQVVLNYFQDRFGIDYSENNIFDTQDMFFQPPSCL 584

Query: 577  KHFFRHASLYAESHLLQLVGFGDPRNPFALLFELPKHLXXXXXXXXXXXXXXXXXXQYDT 636
            + FFRHA  +AESH+LQLVGFG+P+NPFALLFELPK+L                     +
Sbjct: 585  RFFFRHAPAFAESHILQLVGFGNPKNPFALLFELPKYLKERRDKKEKNKSKSTSTADVSS 644

Query: 637  ----SIDDDC---------------AFAAPSEFFETIDSTKYIYKFPDDINIWKESLSYA 677
                ++DD                 A  +  E+ + I++ KY  + P DI  W +SL + 
Sbjct: 645  TAPKTVDDQATDNVNEGTNDDHELTATLSGPEYLDNIETLKYAIETP-DICTWIKSLDFI 703

Query: 678  NVTAMKCSMIVLRKFLHGPLLTALPHLLPWGYFLAATNSRVITIPQDEIRRFWVALVRQL 737
            N+T++KCSMIVL+KFLHGPLL ALPH LPW  F+ A   +V  +  ++  +FW  L++++
Sbjct: 704  NMTSLKCSMIVLKKFLHGPLLIALPHFLPWTVFIIACGIKVNELENEKNYKFWRILMKRI 763

Query: 738  FPFNTIITFLNVLLLYMNNQTQANFPFDEYFEQFIDMSLADLVGYFCENEELPEVWECWG 797
            FP++TI +FLNVLL Y+ +        +E   Q+ DM L D++ +F ++E+LPEVW+CWG
Sbjct: 764  FPWDTITSFLNVLLAYVLDNYGNTTIIEELCMQYSDMDLDDMLAHFNKSEDLPEVWKCWG 823

Query: 798  TLWFDALNTKHITNLTDINSTGVKDHMFMDSPIDGISFDHNDESGEKFWKRCARVILLFR 857
            TLW+DA+  K+  +       G+ DHMF+D PIDGI FD  DE+G KFWKR  RVI LF+
Sbjct: 824  TLWYDAICNKNSVDADTFAGFGIGDHMFLDFPIDGIEFDAEDETGAKFWKRALRVIFLFK 883

Query: 858  ALALECPVGLR-----------EISGGRNWRSLVFKFEEPPSEWCDMYLEPFTLVFDTF- 905
             ++ +   GL+           E +     R   FK E         Y EP +  F+ F 
Sbjct: 884  GISKKFDFGLKISHEAGVYCRNEKAADSPLRRFTFKLES--------YDEPTSSKFNEFI 935

Query: 906  ---EQISPVNLDQRATPYCGMTPDIDIRTLQGYRILLPDYYCFNRNGDMITGSLYT---I 959
               E++S +N D  ATP   +    +I    GYR L  D   F++NG++++ S+YT   I
Sbjct: 936  PLCEEVSAINNDALATPSLSVVQGENIFEYMGYRTLGLDKNSFDKNGEIVSSSIYTSWMI 995

Query: 960  GTLESSGIHGGDDFNGKRLLENGEL----------VSTERRDYNSLIDREEQPIMDE--- 1006
             T E++        N       G+L          +S   +   S +  ++ P ++E   
Sbjct: 996  DTGEAAAAASSATDNNAVSEGQGDLAANGTPISASLSAAGKTTTSHVTDDQDPGLNENDL 1055

Query: 1007 ---FLRHTHCKNDVRWEQMLPRGDLHCFA----------DTHVTYFVLDATTWLRHFGHV 1053
               F+     ++   +  M+  G  +             D   T+F+ DAT+WLRHF H+
Sbjct: 1056 FKKFMSLGDPRDRNVYHNMI-TGKSYLVKNLWESSVDELDRLKTFFIFDATSWLRHFAHI 1114

Query: 1054 YKLAANNILKFAICLTTFQELRFLRKSKDESVLEAATRAVITVRQLYYERKLLPLRFTGN 1113
            YK+A N +LKF +CLTTFQELRFLRKSKDE+V+EAA RA+IT+RQLY E +LLPLRFTGN
Sbjct: 1115 YKIATNGVLKFGVCLTTFQELRFLRKSKDENVVEAAARAIITMRQLYRENRLLPLRFTGN 1174

Query: 1114 VAGHLEEHLEIEEQMTWRSHVDEFVIEAIHKAQDKFNALNDDAKAASRDC----IPTGAD 1169
            VA  +EEHLE EEQ+TWRSHVDEFVIEA+ KAQDKF    +  +          +P G  
Sbjct: 1175 VANDIEEHLEFEEQITWRSHVDEFVIEAVMKAQDKFTTAGETKQPEEEGTGPPRVPLGG- 1233

Query: 1170 QRFNFIALVTDDLNMRNKAGAQNIKAFSTRFMFSVCNELGHAKNVCTN 1217
            +RF+++ LVT+D NM+ KA  Q IK FST F+FS+C++LG + ++CTN
Sbjct: 1234 KRFHYVTLVTNDQNMKRKAQDQGIKTFSTDFVFSLCSKLGMSLDLCTN 1281

>Smik_11.360 Chr11 (616879..620421) [3543 bp, 1180 aa] {ON} YIL151C
            (REAL)
          Length = 1180

 Score =  967 bits (2499), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 490/973 (50%), Positives = 652/973 (67%), Gaps = 76/973 (7%)

Query: 279  KQSSQALMEKLQEIYRNIVRQETELQQRCSQLTTSQTTDLKNLWIIYKVNAELIDNYFMF 338
            K+S  AL++KLQE+YR IV+QE ELQ+RCSQLT SQTT+LK+LW IYK+N EL++NY  F
Sbjct: 250  KRSGIALIQKLQELYRVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTELVNNYVTF 309

Query: 339  ITTALLPTQPEADLLIGKEIIEVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIIY 398
            ITTALLP+QP  DL+IG+EI+E+YRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFI +
Sbjct: 310  ITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 369

Query: 399  VFISISNMLGDIPPKFSIIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYHEALKYTFGH 458
            VFIS+S M+ DIP K+SI WL+RLGDLSRMAIALYPS FIDWKLSAEHWY EA+KYT+ H
Sbjct: 370  VFISLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYTYNH 429

Query: 459  GKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNSGHHRN 518
            GKLYYHMSTVQQNTL AFVNLGKSVFC++TF PS QYMQLVIDNIYQRAF ERN+G+ RN
Sbjct: 430  GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRN 489

Query: 519  AHLVEYLKHTEVMLLPSFLESSELQDVVLAFFEQKFGVTSN-VDFFDPRLVFVQDSERLK 577
            + L+EYLKH+E MLLPSFLES +LQ+VVL++F +KFG+ +N  + F+   +F+Q+ +  K
Sbjct: 490  SLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNCEDMFIQNPDFFK 549

Query: 578  HFFRHASLYAESHLLQLVGFGDPRNPFALLFELPKHLXXXXXXXXXXXXXXXXXXQYDTS 637
            +FFRH   +A+SH+LQ+VGFG+P+NPFA+LFELPK+L                    ++S
Sbjct: 550  YFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKTSNNDSSVTESS 609

Query: 638  I--------DDDCAFAAPS---------EFFETIDSTKYIYKFPDDIN--IWKESLSYAN 678
                     DDD   ++ +         EFF  ID+ +     P  +    W E+L + N
Sbjct: 610  TGNSRNGNEDDDETMSSTTSMSDPDLLVEFFNDIDTLRRPI-LPSMLTNEAWLETLKFLN 668

Query: 679  VTAMKCSMIVLRKFLHGPLLTALPHLLPWGYFLAATNSRVITIPQDEIRRFWVALVRQLF 738
            +T++KC MIVLRKFLHGPL  ALPH+LPW YF+ +   +   +     + FW+ +++++F
Sbjct: 669  MTSLKCGMIVLRKFLHGPLGVALPHVLPWIYFIISICLKSNQLNDPISKEFWIVIIKRMF 728

Query: 739  PFNTIITFLNVLLLYMNNQTQANFPFDEYFEQFIDMSLADLVGYFCENEELPEVWECWGT 798
            P++T++TF+NVL+ Y+ +   +N    +   ++  ++L++L+  F ENE+LPE+W CWGT
Sbjct: 729  PWDTMVTFMNVLIAYLLDNETSNSIIGDLCNEYSKLNLSELLNSFNENEDLPEIWGCWGT 788

Query: 799  LWFDAL---NTKHITNLTDINSTGVKDHMFMDSPIDGISFDHNDESGEKFWKRCARVILL 855
            LWFDA+   NT  I++  +    G++D+M +DSP DGI FD  DE+GEKFWKR  R+I L
Sbjct: 789  LWFDAICQKNTHSISSEDNFQEIGIRDYMALDSPTDGIIFDDKDENGEKFWKRACRIIFL 848

Query: 856  FRALALECPVGL----------REISGGRNWRSLVFKFEEPPSEWCDM-YLEPFTLVFDT 904
            FR ++   P+G+            +      R LV+K E   +    +  L     +FD 
Sbjct: 849  FREVSRSFPLGVIVRHDPLVNCSSLQSNNILRDLVYKLEPLTNIRSSVPVLSTLESIFDI 908

Query: 905  FEQISPVNLDQRATPYCGMTPDIDIRTLQGYRILLPDYYCFNRNGDMITGSLYTIGTLES 964
             E  S +N D  A P   +    +I    GY+ L PDY CF++NG+ ++ SLYT   +  
Sbjct: 909  SEARSEINTDLHAVPELSVINGDNIFHYVGYKKLRPDYTCFDKNGEFLSASLYTSWYVP- 967

Query: 965  SGIHGGDDFNGKRLLENGELVSTERRDYNSLIDREEQPIMDEFLRHTHCKNDVRWEQMLP 1024
                     N    LE     + ER +    ++               C   V  E   P
Sbjct: 968  ---------NCNNNLETNISYANERENEALFLE---------------CMKSVHPEIAYP 1003

Query: 1025 RGDLHCFADTHVTYFVLDATTWLRHFGHVYKLAANNILKFAICLTTFQELRFLRKSKDES 1084
              D         TYFV DAT+WLRH   ++KLA N +L+FAICLTTFQELRFLRKSKDE+
Sbjct: 1004 EIDF------KTTYFVFDATSWLRHSARIFKLAQNRLLRFAICLTTFQELRFLRKSKDEN 1057

Query: 1085 VLEAATRAVITVRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIEAIHK 1144
            V+EAATR +IT+RQLY E K+LPLRFTGNVA H+EE+LE EEQ+TWR+HVDEFVIE+I K
Sbjct: 1058 VMEAATRGIITIRQLYCEDKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMK 1117

Query: 1145 AQDKFNALNDDAKAASRDCIPTGADQRFNFIALVTDDLNMRNKAGAQNIKAFSTRFMFSV 1204
            AQ+K     ++AK       P  +  RFN++ L++DD  M+ KA  + I+  STRF+FS+
Sbjct: 1118 AQEKL----ENAKQ------PNISSHRFNYVVLISDDDTMKKKAEEKKIRTLSTRFVFSL 1167

Query: 1205 CNELGHAKNVCTN 1217
            C +LG  +++CT+
Sbjct: 1168 CTKLGEQRHLCTD 1180

>KAFR0H00180 Chr8 complement(20661..24386) [3726 bp, 1241 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1241

 Score =  964 bits (2493), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 505/991 (50%), Positives = 657/991 (66%), Gaps = 64/991 (6%)

Query: 271  VPTVAVTAKQSSQALMEKLQEIYRNIVRQETELQQRCSQLTTSQTTDLKNLWIIYKVNAE 330
            V   +VT K++S+ L+EKLQ IY+ IV+QE ELQQRCSQLTTSQTT+LKNLW IYK+N +
Sbjct: 271  VEETSVT-KKTSRVLIEKLQNIYKIIVKQEMELQQRCSQLTTSQTTELKNLWSIYKLNTD 329

Query: 331  LIDNYFMFITTALLPTQPEADLLIGKEIIEVYRIERRLWVYGTITFLDVLKNFSNFMDPE 390
            LI+NY  FITTALLP+Q   D+ IG+EI+E+YRIERRLWVYGTITFLDVLKNFSNFMDPE
Sbjct: 330  LINNYITFITTALLPSQSLQDIQIGEEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPE 389

Query: 391  VCCQFIIYVFISISNMLGDIPPKFSIIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYHE 450
            VC QFI +VFIS+S ML D+PPK SI WL+RLGDLSRMAIALYPSGFIDWKLSAEHWY E
Sbjct: 390  VCSQFITHVFISLSTMLIDLPPKHSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYME 449

Query: 451  ALKYTFGHGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAE 510
            A+K+T+ HGKLYYHMSTVQQNTL AFVNLGKSVFC+DTF PSQQYMQLVIDNIYQR F +
Sbjct: 450  AMKFTYSHGKLYYHMSTVQQNTLEAFVNLGKSVFCQDTFTPSQQYMQLVIDNIYQRTFVD 509

Query: 511  RN-SGHHRNAHLVEYLKHTEVMLLPSFLESSELQDVVLAFFEQKFGVTSN-VDFFDPRLV 568
            RN +G+ RN+ L++YLKH+EVMLLPSFLE+ +LQ VVL +F  +FGV  N  + F+ + +
Sbjct: 510  RNKNGNVRNSDLIDYLKHSEVMLLPSFLENEDLQQVVLNYFNDRFGVDYNDNNIFETQDM 569

Query: 569  FVQDSERLKHFFRHASLYAESHLLQLVGFGDPRNPFALLFELPKHLXX---XXXXXXXXX 625
            F Q    L+ +FRHA  +AESH+LQLVGFG+P+NPFALLF+LP  L              
Sbjct: 570  FFQVPASLRFYFRHAPAFAESHILQLVGFGNPKNPFALLFDLPNFLKERKDKKEKNKSKS 629

Query: 626  XXXXXXXQYDTS-----IDDDCAFAAP----SEFFETIDSTKYIYKFPDDINIWKESLSY 676
                     DT+     I +  A+       +E+F+ IDS +     P +I +W +SL +
Sbjct: 630  STEISTMSIDTNDSRGPILNTSAYVNEGNIVTEYFDNIDSLRLPIDHP-NILVWLKSLEH 688

Query: 677  ANVTAMKCSMIVLRKFLHGPLLTALPHLLPWGYFLAATNSRVITIPQDEIRRFWVALVRQ 736
             N+T++KCS+IVLRKFL GPLL ALPH+LPW YF+ AT  +  +       +FW  ++R+
Sbjct: 689  LNMTSLKCSVIVLRKFLRGPLLIALPHVLPWTYFIIATFLKAQSSKNTSSVKFWTIVMRR 748

Query: 737  LFPFNTIITFLNVLLLYMNN---QTQANFPFDEYFEQFIDMSLADLVGYFCENEELPEVW 793
            + P+NT+ +FLNVLL Y+ +   QT++     E +  F   +  +L+ YF  NE LPE+W
Sbjct: 749  ILPWNTLTSFLNVLLAYILDNFYQTESIAKLCETYSNF--ENFYELLDYFNRNENLPEIW 806

Query: 794  ECWGTLWFDALNTKHITNLTDINSTGVKDHMFMDSPIDGISFDHNDESGEKFWKRCARVI 853
            +CWGTLWFD ++ K   N    N  G++DHMF+D P+DGI FD  DE+GE FW R  R++
Sbjct: 807  KCWGTLWFDVISNKRALNADTFNGLGIEDHMFLDFPLDGIGFDELDETGENFWNRALRIV 866

Query: 854  LLFRALALECPVGLR------------EISGGRNWRSLVFKFEE-PPSEWCDMYLEPFTL 900
             LF+ +A     GLR            +I      +S  FK E    S +          
Sbjct: 867  FLFKGIAENLQTGLRVSRTAPVHCRRDDIDPNHILKSFSFKMEGFDESSYSGQPFSTINK 926

Query: 901  VFDTFEQISPVNLDQRATPYCGMTPDIDIRTLQGYRILLPDYYCFNRNGDMITGSLYTIG 960
            +   FE I   NLD  A P   +    +I    GY+ L  + + F+RNG++++ S+YT  
Sbjct: 927  LLPLFENIDETNLDFDARPMLSVVKGENIFEYVGYKKLFLNNHSFDRNGELVSSSIYTAW 986

Query: 961  TLESSGIHGGDDFNGKRLLENGELVSTERRDYNSLIDREEQPI-MDEFLRHTHCKNDVRW 1019
             +++   +  ++  G +   N ++   +R+    L+  E+Q   M  F  +   ++D  +
Sbjct: 987  VIDND--NSLNNSQGNQYTSNMQMTQQQRQ----LLPPEQQNFQMRNFASNEDTEDDFNF 1040

Query: 1020 EQMLPRGDLHCFADT-------------HVTYFVLDATTWLRHFGHVYKLAANNILKFAI 1066
            E  +    L+   D              ++TYFV DAT+WLRHF H+YKL+ NN+L FA+
Sbjct: 1041 ELYMNPEKLNKNMDQASIWTTANDEINRNITYFVFDATSWLRHFAHIYKLSTNNVLNFAV 1100

Query: 1067 CLTTFQELRFLRKSKDESVLEAATRAVITVRQLYYERKLLPLRFTGNVAGHLEEHLEIEE 1126
            CLTTFQELRFLRKSKDE+V+ AA RA+IT+RQLY E KLLPLRFTGNVA  +EEHLE EE
Sbjct: 1101 CLTTFQELRFLRKSKDENVVGAAARAIITMRQLYSEGKLLPLRFTGNVATDIEEHLEFEE 1160

Query: 1127 QMTWRSHVDEFVIEAIHKAQDKFNALNDDAKAASRDCIPTGADQRFNFIALVTDDLNMRN 1186
            Q+TWRSHVDEFVIEA+ KAQ+KF + N+               + FN + LVTDD+NM+ 
Sbjct: 1161 QITWRSHVDEFVIEAVVKAQNKFISANESVTLR----------KGFNHVVLVTDDINMKR 1210

Query: 1187 KAGAQNIKAFSTRFMFSVCNELGHAKNVCTN 1217
            KA  Q IK F+T F+FSVC +LG   NVCTN
Sbjct: 1211 KAQEQGIKTFTTHFIFSVCRKLGIQDNVCTN 1241

>Suva_11.333 Chr11 (611602..612061,612092..615195) [3564 bp, 1187 aa]
            {ON} YKR096W (REAL)
          Length = 1187

 Score =  955 bits (2469), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 493/973 (50%), Positives = 651/973 (66%), Gaps = 81/973 (8%)

Query: 279  KQSSQALMEKLQEIYRNIVRQETELQQRCSQLTTSQTTDLKNLWIIYKVNAELIDNYFMF 338
            K+SS AL++KLQE+Y+ IV+QE ELQ+RCSQLT SQTT+LK+LW IY++N EL++NY  F
Sbjct: 262  KKSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELVNNYVTF 321

Query: 339  ITTALLPTQPEADLLIGKEIIEVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIIY 398
            ITTALLP+QP+ DL+IG+EI+E+YRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFI +
Sbjct: 322  ITTALLPSQPQHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 381

Query: 399  VFISISNMLGDIPPKFSIIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYHEALKYTFGH 458
            VF+S+S M+ DIP K+SI WL+RLGDLSRMAIALYPS FIDWKLSAEHWY EA+KY + H
Sbjct: 382  VFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYVYNH 441

Query: 459  GKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNSGHHRN 518
            GKLYYHMSTVQQNTL AFVNLGKSVFC++TF PS QYMQLVIDNIYQRAF ERN+G+ RN
Sbjct: 442  GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRN 501

Query: 519  AHLVEYLKHTEVMLLPSFLESSELQDVVLAFFEQKFGVTSN-VDFFDPRLVFVQDSERLK 577
            + L+EYLKH+E MLLPSFLES +LQ+VVL++F +KFG+ +N  + F+P  +F+Q+ +  K
Sbjct: 502  SLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFVEKFGIDANGCNIFNPEDMFIQNPDFFK 561

Query: 578  HFFRHASLYAESHLLQLVGFGDPRNPFALLFELPKHLXXXXXXXXXXXXXXXXXXQY--- 634
            +FFRHA  +A+SH+LQ+VGFG+P+NPFA+LFELPKHL                       
Sbjct: 562  YFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKHLKERKDKKERKKSSNNESSITESS 621

Query: 635  -----DTSIDDDCAFAAPS---------EFFETIDSTKY-IYKFPDDINIWKESLSYANV 679
                 + + D+D   ++ +         EFF  ID+ +  I         W ESL + N+
Sbjct: 622  TSNSRNENDDNDEIMSSTTSISERDSLIEFFNDIDTLRRPIVSSMLTNEAWLESLKFLNM 681

Query: 680  TAMKCSMIVLRKFLHGPLLTALPHLLPWGYFLAATNSRVITIPQDEIRRFWVALVRQLFP 739
            T++KC MIVLRKFLHGPL  ALPH LPW YF+ +   +   +     + FW+ +V+++FP
Sbjct: 682  TSLKCGMIVLRKFLHGPLGIALPHFLPWIYFIISICLKSSQLSDPISKEFWIVIVKRIFP 741

Query: 740  FNTIITFLNVLLLYMNNQTQANFPFDEYFEQFIDMSLADLVGYFCENEELPEVWECWGTL 799
            ++T++TF+N+L+  + +    +       +++ D++LA+L+  F E EELPE+W CWGTL
Sbjct: 742  WDTMVTFMNILIACVLDNEMTSPIIGSLCDEYSDLNLAELLDVFKEKEELPEIWGCWGTL 801

Query: 800  WFDAL---NTKHITNLTDINSTGVKDHMFMDSPIDGISFDHNDESGEKFWKRCARVILLF 856
            WFD +   NT  I++  D    G+KD+M +DSPIDGI FD NDE+GEKFWKR  R I LF
Sbjct: 802  WFDTICQKNTNSISSDDDFEEVGIKDYMALDSPIDGIIFDVNDENGEKFWKRACRTIFLF 861

Query: 857  RALALECPVGL---REISGGRN-------WRSLVFKFEEPPSEWCDM-YLEPFTLVFDTF 905
            R L+    +G+    E S  R+         +L +K E   +    +  L     + D F
Sbjct: 862  RELSRSFQIGVIINNESSINRSSLQSNNILGNLSYKLEPLSTLGSSIPTLNTLEGIIDVF 921

Query: 906  EQISPVNLDQRATPYCGMTPDIDIRTLQGYRILLPDYYCFNRNGDMITGSLYTIGTLESS 965
            E  S  N+D  A P   +     I    GY+ L P+Y CF++NG+ ++ SLYT   + + 
Sbjct: 922  ETRSENNIDLHAVPELSVIKGGSIFNYTGYKKLCPNYTCFDKNGEFLSASLYTSWYVPNG 981

Query: 966  GIHGGDDFNGKRLLEN-GELVSTERRDYNSLIDREEQPIMDEFLRHTHCKNDVRWEQMLP 1024
              +   + N     EN G+ +   + D     DRE                         
Sbjct: 982  SNNPETNINSNCEKENEGQFLECLKSD-----DRE------------------------- 1011

Query: 1025 RGDLHCFADTHVTYFVLDATTWLRHFGHVYKLAANNILKFAICLTTFQELRFLRKSKDES 1084
                    D + TYFV DAT+WLRH   ++KLA N +LKFAICLTTFQELRFLRKSKDE+
Sbjct: 1012 -------IDLNTTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLRKSKDEN 1064

Query: 1085 VLEAATRAVITVRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIEAIHK 1144
            V+EAATR +IT+RQLYYE K+LPLRFTGNVA H+EE+LE EEQ+TWR+HVDEFVIE+I K
Sbjct: 1065 VMEAATRGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFVIESIMK 1124

Query: 1145 AQDKFNALNDDAKAASRDCIPTGADQRFNFIALVTDDLNMRNKAGAQNIKAFSTRFMFSV 1204
            AQ+K    N          +P  +  RFN++ L++DD  M+ KA  + IK  STRF+FS+
Sbjct: 1125 AQEKLENANQ---------LPVSS-CRFNYVILISDDDTMKKKAEEKKIKTLSTRFVFSL 1174

Query: 1205 CNELGHAKNVCTN 1217
            C +LG  +++CT+
Sbjct: 1175 CTKLGEQRHLCTD 1187

>Kpol_1043.73 s1043 (155026..158808) [3783 bp, 1260 aa] {ON}
            (155026..158808) [3783 nt, 1261 aa]
          Length = 1260

 Score =  952 bits (2460), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 497/984 (50%), Positives = 659/984 (66%), Gaps = 86/984 (8%)

Query: 271  VPTVAVTAKQSSQALMEKLQEIYRNIVRQETELQQRCSQLTTSQTTDLKNLWIIYKVNAE 330
            VP+V+V  ++SSQAL++KLQ+IY+ I++QE ELQ+RCSQLT SQTT++KNLW+IYK+NA+
Sbjct: 304  VPSVSVPPRKSSQALVQKLQDIYKIILKQEVELQERCSQLTNSQTTEIKNLWVIYKLNAD 363

Query: 331  LIDNYFMFITTALLPTQPEADLLIGKEIIEVYRIERRLWVYGTITFLDVLKNFSNFMDPE 390
            LI+NY  FITTAL P+Q ++DLLIG+EI+++Y+IERRLWVYGTITFLDVLKNFSNFMDPE
Sbjct: 364  LINNYVTFITTALFPSQSKSDLLIGEEIVDIYKIERRLWVYGTITFLDVLKNFSNFMDPE 423

Query: 391  VCCQFIIYVFISISNMLGDIPPKFSIIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYHE 450
            VCCQFI +VFISIS+ML DIP K++I WL++LGDLSRMA+AL+PSGFIDWKLSAE WY  
Sbjct: 424  VCCQFITHVFISISSMLDDIPQKYAIPWLQKLGDLSRMAVALFPSGFIDWKLSAERWYMA 483

Query: 451  ALKYTFGHGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAE 510
            A++Y++G+GKLYYHMSTVQQNTL AFVNLGKSVFC++TF+PSQQY+QLVIDNIYQRAFA+
Sbjct: 484  AMEYSYGYGKLYYHMSTVQQNTLEAFVNLGKSVFCQNTFVPSQQYLQLVIDNIYQRAFAD 543

Query: 511  RN-SGHHRNAH-LVEYLKHTEVMLLPSFLESSELQDVVLAFFEQKFGV---TSNVDFFDP 565
            RN S + RN   LV+YLKH+EVMLLP+F+ES +LQ VVL +F +KFG+    +NV  F P
Sbjct: 544  RNSSSNSRNCQLLVDYLKHSEVMLLPNFMESPDLQQVVLLYFMEKFGIDYNNNNVKMFQP 603

Query: 566  RLVFVQDSERLKHFFRHASLYAESHLLQLVGFGDPRNPFALLFELPKHLXXXXXXXXXXX 625
            R +F+Q++++LK +FRHA+ +AE+ +LQLVG+G+P+NPFALLF LPK+L           
Sbjct: 604  RQMFIQNNDQLKFYFRHANAFAEAQILQLVGYGNPKNPFALLFSLPKYLKERRDKKEKRK 663

Query: 626  XXXXXXXQYDTSID-------------DDCAFAAPSEFFETIDSTKYIYKFPDDINIWKE 672
                   +  +S               +   F    +FF  ID        P+ I++W +
Sbjct: 664  PKNQIVGEDGSSTTFSSVSGMEYMVNMETNVFLGSEDFFNNIDKLAINNFMPNSISLWND 723

Query: 673  SLSYANVTAMKCSMIVLRKFLHGPLLTALPHLLPWGYFLAATNSRVITIPQDEIRRFWVA 732
            SL Y N TA KCSMIVL+KFL+GPL+ ALPH+LPW YFL +   ++       +  FW A
Sbjct: 724  SLKYHNFTATKCSMIVLQKFLNGPLMVALPHILPWVYFLISIALQIEKYQDTAMMEFWYA 783

Query: 733  LVRQLFPFNTIITFLNVLLLYMNNQTQANFPFDEYFEQFIDMSLADLVGYFCENEELPEV 792
             ++++FP+N+++ FLNVLL YM +    N P +E  +Q+  ++L +L+  F  NE+LPEV
Sbjct: 784  FIKRIFPWNSMVRFLNVLLAYMIDNCWDNSPLNELCDQYGSLNLEELLRNFNANEDLPEV 843

Query: 793  WECWGTLWFDALNTKHIT-NLTDINSTGVKDHMFMDSPIDGISFDHNDESGEKFWKRCAR 851
            W+C G+LWFD ++ K  + N       G+KD+ F+D P+DGI FD NDE G KFWKR  R
Sbjct: 844  WKCRGSLWFDIIDEKRNSQNCDSYTECGIKDYQFLDFPVDGIEFDENDEIGIKFWKRSVR 903

Query: 852  VILLFR------------ALALECPVGLREISGGRNWRSLVFKFEEPPSEWCDMYLEPFT 899
            VI LFR            A++   PV  R    G N   + + F+        M+ +   
Sbjct: 904  VIFLFRGIVERFNGFGNLAISYNAPVINRR-GLGVNSHLVGYSFKLMAKSDDIMFDD--- 959

Query: 900  LVFDTFEQISPVNLDQRATPYCGMTPDIDIRTLQGYRILLPDYYCFNRNGDMITGSLYTI 959
            ++   FE+I   N D  A P   M    +I    GY+ +  DYY F++NGD+I+ S Y  
Sbjct: 960  MLVSNFEEIDSNNSDFNAIPLLSMIYGENIFEYVGYKRIHADYYSFDKNGDLISTSFYNT 1019

Query: 960  GTL-ESSGIHGG--------------DDFNGKRLLENGELVSTERRDYNSLIDREEQPIM 1004
             ++ + +G++GG              D  N K L             +N   D E   + 
Sbjct: 1020 WSINQDTGVNGGPLSNNSSSSNAASSDPMNEKEL-------------FNKCFDPEYDSV- 1065

Query: 1005 DEFLRHTHCKNDVRWEQMLPRGDLHCFADTHVTYFVLDATTWLRHFGHVYKLAANNILKF 1064
            DEF       N   ++ +  +  +  + D   TYF+LDAT+WLRHF HVYK+A N+ILKF
Sbjct: 1066 DEFW------NKEIYDDIGRKFGMELYED---TYFILDATSWLRHFAHVYKIATNSILKF 1116

Query: 1065 AICLTTFQELRFLRKSKDESVLEAATRAVITVRQLYYERKLLPLRFTGNVAGHLEEHLEI 1124
            +ICLTTFQELRFLRKSKDE+V+EAATRA+IT+RQL+ E KLLPLRFTGNVA H+EEHLE 
Sbjct: 1117 SICLTTFQELRFLRKSKDENVVEAATRAIITLRQLFSEGKLLPLRFTGNVATHIEEHLEF 1176

Query: 1125 EEQMTWRSHVDEFVIEAIHKAQDKFNALNDDAKAASRDCIPTGADQRFNFIALVTDDLNM 1184
            EEQ+TWRSHVDEFVIEA+ KA+          K   ++       Q    I LVTDD NM
Sbjct: 1177 EEQITWRSHVDEFVIEAVIKAE---------TKRKEQEMHNMKGFQ----IVLVTDDSNM 1223

Query: 1185 RNKAGAQNIKAFSTRFMFSVCNEL 1208
            +NKA  +  K FSTRF+F++ N L
Sbjct: 1224 KNKALEKGSKTFSTRFVFAISNYL 1247

>Skud_11.336 Chr11 (608311..608769,608800..608948,608994..611952)
            [3567 bp, 1188 aa] {ON} YKR096W (REAL)
          Length = 1188

 Score =  946 bits (2446), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/979 (50%), Positives = 652/979 (66%), Gaps = 85/979 (8%)

Query: 275  AVTAKQSSQALMEKLQEIYRNIVRQETELQQRCSQLTTSQTTDLKNLWIIYKVNAELIDN 334
            +  +K+SS AL++KLQE+Y+ IV+QE ELQ+RCSQLT SQTT+LK+LW IY++N ELI+N
Sbjct: 259  SANSKRSSIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYRINTELINN 318

Query: 335  YFMFITTALLPTQPEADLLIGKEIIEVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQ 394
            Y  FITTALLP+QP  DLLIG+EI+E+YRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQ
Sbjct: 319  YVTFITTALLPSQPLHDLLIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQ 378

Query: 395  FIIYVFISISNMLGDIPPKFSIIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYHEALKY 454
            FI +VF+S+S M+ DIP K+SI WL+RLGDLSRMAIALYPS FIDWKLSAEHWY EA+KY
Sbjct: 379  FITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKY 438

Query: 455  TFGHGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNSG 514
             + HGKLYYHMSTVQQNTL AFVNLGKSVFC++TF PS QYMQLVIDNIYQRAF ERN+G
Sbjct: 439  IYNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNG 498

Query: 515  HHRNAHLVEYLKHTEVMLLPSFLESSELQDVVLAFFEQKFGVTSN-VDFFDPRLVFVQDS 573
            + RN+ L+EYLKH+E MLLPSFLES +LQ+VV+++F +KFG+ +N  + F+P  +F+Q+ 
Sbjct: 499  NLRNSLLIEYLKHSEAMLLPSFLESPDLQNVVVSYFVEKFGIDANGCNIFNPEDMFIQNP 558

Query: 574  ERLKHFFRHASLYAESHLLQLVGFGDPRNPFALLFELPKHLXXXXXXXXXXXXXXXXXXQ 633
            +  K+FFRHA  +A+SH+LQ+VGFG+P+NPFA+LFELPK+L                   
Sbjct: 559  DFFKYFFRHAPSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKSSNNDSSV 618

Query: 634  YDTSIDD-------------------DCAFAAPSEFFETIDSTKY-IYKFPDDINIWKES 673
             ++S  +                   D  F A  EFF  ID+ +  I         W E+
Sbjct: 619  TESSTGNSRNDNNDDDEIMSSTASISDHDFLA--EFFNDIDTLRRPILPSMLTSEAWLET 676

Query: 674  LSYANVTAMKCSMIVLRKFLHGPLLTALPHLLPWGYFLAATNSRVITIPQDEIRRFWVAL 733
            L + N+T++KC MIVLRKFLHGPL  ALPH+LPW YF+ AT  +   +     + FW+ +
Sbjct: 677  LKFLNMTSLKCGMIVLRKFLHGPLGIALPHILPWIYFIIATCLKSNQLSDPTSKDFWMII 736

Query: 734  VRQLFPFNTIITFLNVLLLYMNNQTQANFPFDEYFEQFIDMSLADLVGYFCENEELPEVW 793
            V+++FP++TI+TF+NVL+ Y+ +    N    E   ++  ++LA L+  F E+EELPE+W
Sbjct: 737  VKRVFPWDTIVTFMNVLIAYLLDNEALNPIIGELCSKYGTLNLAGLLESFNESEELPEIW 796

Query: 794  ECWGTLWFDAL---NTKHITNLTDINSTGVKDHMFMDSPIDGISFDHNDESGEKFWKRCA 850
             CWGTLWFD +   N   I++  +    G+KD+M +D+P DGI FD  DESGEKFWKR  
Sbjct: 797  NCWGTLWFDTICQKNAHSISSDDNFQEIGIKDYMALDAPTDGIIFDDKDESGEKFWKRAC 856

Query: 851  RVILLFRALALECPVG-------LREISGGRN---WRSLVFKFEEPPSEWCDM-YLEPFT 899
            R+I LFR L+   P+G       L + S  ++    R+LV+K E   +   +   L    
Sbjct: 857  RIIFLFRELSRTFPIGVIVSNDPLIKCSSSQSSIILRNLVYKLEPLSNIRSNTPILTALE 916

Query: 900  LVFDTFEQISPVNLDQRATPYCGMTPDIDIRTLQGYRILLPDYYCFNRNGDMITGSLYTI 959
               D  E  S  N+D  A P   +    +I    GY+ L PDY CF+RNG+ ++ SLYT 
Sbjct: 917  NSVDISEARSKNNIDLYAVPELSVNSGDNIFHYTGYKKLRPDYTCFDRNGEFLSASLYT- 975

Query: 960  GTLESSGIHGGDDFNGKRLLENGELVSTERRDYNSLIDREEQPIMDEFLRHTHCKNDVRW 1019
                            +  L NG  +S      NS I++ ++              D+  
Sbjct: 976  ----------------RWYLPNGNNISEAL--VNSDIEKGDE--------------DLFL 1003

Query: 1020 EQMLPRGDLHCFA-DTHVTYFVLDATTWLRHFGHVYKLAANNILKFAICLTTFQELRFLR 1078
            E M P     C   D   TYFV DAT+WLRH   ++KLA N +LKFAICLTTFQELRFLR
Sbjct: 1004 ECMKP----DCPGIDFETTYFVFDATSWLRHSARIFKLAQNRLLKFAICLTTFQELRFLR 1059

Query: 1079 KSKDESVLEAATRAVITVRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFV 1138
            KSKDE+V+EAATR +IT+RQLYYE K+LPLRFTGNVA H+EE+LE EEQ+TWR+HVDEFV
Sbjct: 1060 KSKDENVMEAATRGIITIRQLYYEDKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEFV 1119

Query: 1139 IEAIHKAQDKFNALNDDAKAASRDCIPTGADQRFNFIALVTDDLNMRNKAGAQNIKAFST 1198
            IE+I KAQ+K                P    +  N++ L++DD  M+ KA  + IK  ST
Sbjct: 1120 IESIKKAQEKLENAGQ----------PHVTPRHSNYVVLISDDDTMKKKAEEKEIKTLST 1169

Query: 1199 RFMFSVCNELGHAKNVCTN 1217
            +F+FS+C +LG  +++CT+
Sbjct: 1170 KFVFSLCTKLGEKRHLCTD 1188

>YKR096W Chr11 (626793..630380) [3588 bp, 1195 aa] {ON} Protein of
            unknown function that may interact with ribosomes, based
            on co-purification experiments; green fluorescent protein
            (GFP)-fusion protein localizes to the nucleus and
            cytoplasm; predicted to contain a PINc domain
          Length = 1195

 Score =  932 bits (2409), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/980 (49%), Positives = 656/980 (66%), Gaps = 88/980 (8%)

Query: 276  VTAKQSSQALMEKLQEIYRNIVRQETELQQRCSQLTTSQTTDLKNLWIIYKVNAELIDNY 335
             + K+S  AL++KLQE+Y+ IV+QE ELQ+RCSQLT SQTT+LK+LW IYK+N +L++NY
Sbjct: 266  ASNKRSGIALIQKLQELYKVIVKQEIELQERCSQLTNSQTTELKSLWTIYKINTDLVNNY 325

Query: 336  FMFITTALLPTQPEADLLIGKEIIEVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQF 395
              FITTALLP+QP  DL+IG+EI+E+YRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQF
Sbjct: 326  VTFITTALLPSQPPHDLVIGQEIVEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQF 385

Query: 396  IIYVFISISNMLGDIPPKFSIIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYHEALKYT 455
            I +VF+S+S M+ DIP K+SI WL+RLGDLSRMAIALYPS FIDWKLSAEHWY EA+KY 
Sbjct: 386  ITHVFVSLSTMISDIPSKYSITWLQRLGDLSRMAIALYPSSFIDWKLSAEHWYTEAMKYI 445

Query: 456  FGHGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNSGH 515
            + HGKLYYHMSTVQQNTL AFVNLGKSVFC++TF PS QYMQLVIDNIYQRAF ERN+G+
Sbjct: 446  YNHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGN 505

Query: 516  HRNAHLVEYLKHTEVMLLPSFLESSELQDVVLAFFEQKFGVTSN-VDFFDPRLVFVQDSE 574
             RN+ L+EYLKH+E MLLPSFLES +LQ+VVL++F +KFG+ +N  + F+   +FVQ+ +
Sbjct: 506  LRNSLLIEYLKHSEAMLLPSFLESPDLQNVVLSYFIEKFGIDANGCNIFNAEDMFVQNPD 565

Query: 575  RLKHFFRHASLYAESHLLQLVGFGDPRNPFALLFELPKHLXXXXXXXXXXXXXXXXXXQY 634
              K+FFRH   +A+SH+LQ+VGFG+P+NPFA+LFELPK+L                    
Sbjct: 566  FFKYFFRHGPSFAQSHILQIVGFGEPKNPFAILFELPKYLKERKDKKERKKSSNNDSSVT 625

Query: 635  DTSI--------DDDCAFAAPS---------EFFETIDSTKYIYKFPDDIN--IWKESLS 675
            ++S         DDD   ++ +         EFF  ID+ +     P  +    W E+L 
Sbjct: 626  ESSTGNSRNDNEDDDEIMSSTTSISDHDLLAEFFNDIDTLRRPI-LPSMLTNEAWLETLK 684

Query: 676  YANVTAMKCSMIVLRKFLHGPLLTALPHLLPWGYFLAATNSRVITIPQDEIRRFWVALVR 735
            + N+T++KC +IVLRKFLHGPL  ALPH+LPW YF+ +   +   +     + FW+ +V+
Sbjct: 685  FLNMTSLKCGIIVLRKFLHGPLGIALPHILPWIYFIISICLKSSQLSDPVSKEFWMIIVK 744

Query: 736  QLFPFNTIITFLNVLLLYMNNQTQANFPFDEYFEQFIDMSLADLVGYFCENEELPEVWEC 795
            + FP++T++TF+NVL++Y+ +   +N    +  + +  +SL++L+  F E EELPE+  C
Sbjct: 745  RAFPWDTMVTFMNVLIVYLLDNQTSNSIIGDLCDDYDKLSLSELLELFNEGEELPEILGC 804

Query: 796  WGTLWFDAL---NTKHITNLTDINSTGVKDHMFMDSPIDGISFDHNDESGEKFWKRCARV 852
            WGTLWFD +   NT  I++  +    G+KD+M +DSP DGI FD  DE+GEKFWKR  R 
Sbjct: 805  WGTLWFDTICEKNTHSISSEDNFQEIGIKDYMALDSPTDGIIFDEKDENGEKFWKRACRT 864

Query: 853  ILLFRALALECPVGLREISGGRNWR----------SLVFKFEEPPSEWCDMY-----LEP 897
            I LFR L+   P+G+   +    +R          SLVFK E      C+++     L  
Sbjct: 865  IFLFRELSRSFPIGVIIRNDPLIYRSSFQNTNILGSLVFKLE----PLCNIHNNIPVLGA 920

Query: 898  FTLVFDTFEQISPVNLDQRATPYCGMTPDIDIRTLQGYRILLPDYYCFNRNGDMITGSLY 957
               + D  E  S  N D  A P   +    +I    GY+ L  DY CF++NG+ ++ SLY
Sbjct: 921  LESIIDISEARSENNTDLHAVPELSVNEGDNIFHYVGYKKLRADYTCFDKNGEFLSASLY 980

Query: 958  TIGTLESSGIHGGDDFNGKRLLENGELVSTERRDYNSLIDREEQPIMDEFLRHTHCKNDV 1017
            T   + +S     +D                  +YNS  ++E + +  E ++  + + D 
Sbjct: 981  TTWYVPNSNNTNIED----------------NINYNS--EKENEGLFLECIKSDYPEIDF 1022

Query: 1018 RWEQMLPRGDLHCFADTHVTYFVLDATTWLRHFGHVYKLAANNILKFAICLTTFQELRFL 1077
            +                  TYFV DAT+WLRH   ++KLA N +L+FAICLTTFQELRFL
Sbjct: 1023 K-----------------TTYFVFDATSWLRHSARIFKLAQNRLLRFAICLTTFQELRFL 1065

Query: 1078 RKSKDESVLEAATRAVITVRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEF 1137
            RKSKDE+V+EAATR +IT+RQLYYE K+LPLRFTGNVA H+EE+LE EEQ+TWR+HVDEF
Sbjct: 1066 RKSKDENVMEAATRGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDEF 1125

Query: 1138 VIEAIHKAQDKFNALNDDAKAASRDCIPTGADQRFNFIALVTDDLNMRNKAGAQNIKAFS 1197
            VIE++ KAQ+K  + ++          P  + +RFN++ L++DD  M+ KA  + IK  S
Sbjct: 1126 VIESVMKAQEKLESASE----------PRLSPRRFNYVVLISDDDAMKKKAEEKEIKTLS 1175

Query: 1198 TRFMFSVCNELGHAKNVCTN 1217
            TRF+FS+C +LG  +++CT+
Sbjct: 1176 TRFVFSLCTKLGEQRHLCTD 1195

>TPHA0E00190 Chr5 complement(20436..24521) [4086 bp, 1361 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1361

 Score =  926 bits (2394), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 496/1012 (49%), Positives = 646/1012 (63%), Gaps = 94/1012 (9%)

Query: 271  VPTVAVTAKQSSQALMEKLQEIYRNIVRQETELQQRCSQLTTSQTTDLKNLWIIYKVNAE 330
            +P+V+V  ++SSQ L++KLQ+IY+ IV+QE ELQ+RC +LT SQTT+LKNLW IY+VN+E
Sbjct: 370  IPSVSVPLRKSSQVLVQKLQDIYKTIVKQEIELQERCGRLTNSQTTELKNLWTIYRVNSE 429

Query: 331  LIDNYFMFITTALLPTQPEADLLIGKEIIEVYRIERRLWVYGTITFLDVLKNFSNFMDPE 390
            L+DNY  FITTA+ PTQPE+D  IGKEIIE+Y+IERRLWVYGTITFLD+LKNFSNFMDPE
Sbjct: 430  LVDNYITFITTAIHPTQPESDQQIGKEIIEIYKIERRLWVYGTITFLDLLKNFSNFMDPE 489

Query: 391  VCCQFIIYVFISISNMLGDIPPKFSIIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYHE 450
            VCCQFI +VFISISNML DIP K+ + W ++LGDLSRMAIALYPS FIDWKLSAE WY  
Sbjct: 490  VCCQFIFHVFISISNMLADIPQKYRVSWYQKLGDLSRMAIALYPSNFIDWKLSAERWYMA 549

Query: 451  ALKYTFGHGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAE 510
            A+++T+GHGKLYYHMSTVQQNTL AFVNLGKS+FC++TF+PSQQY+QLVI NIYQRA+A+
Sbjct: 550  AMEFTYGHGKLYYHMSTVQQNTLEAFVNLGKSLFCKNTFVPSQQYLQLVIGNIYQRAYAD 609

Query: 511  -RNSGHHRNAH-LVEYLKHTEVMLLPSFLESSELQDVVLAFFEQKFGV---TSNVDFFDP 565
              NS + RN   LV+Y+KH EV LLP+F ES ELQ VVL +F  KFGV    S+ + F  
Sbjct: 610  SNNSNNGRNDQLLVDYIKHCEVTLLPNFKESQELQQVVLMYFIDKFGVDYNNSSNNMFIS 669

Query: 566  RLVFVQDSERLKHFFRHASLYAESHLLQLVGFGDPRNPFALLFELPKHLXXXXXXXXXXX 625
            R +FVQ++++ K F+R+++ +AES +LQ+VG+G+ ++PF+LLFELPK+L           
Sbjct: 670  RKMFVQNNDQFKCFYRYSAAFAESQILQIVGYGNLKSPFSLLFELPKYLKDRKEKKEKRK 729

Query: 626  XXXXXXXQYDT-------------SIDDDCAFAAPSEFFETIDSTKYIYKFPDDINIWKE 672
                   +                ++ ++  F    EFFE ID+  Y    P+ ++IW  
Sbjct: 730  PKTMLILKITQPRLYHRWVGTTLPTMPNNNVFLTAEEFFENIDTINYPSFMPNSVDIWNH 789

Query: 673  SLSYANVTAMKCSMIVLRKFLHGPLLTALPHLLPWGYFLAATNSRVITIPQDEIRRFWVA 732
            SL YAN  ++KCSMIV +KFLH P + ALPH LPW YF+ +   ++       +  FWV 
Sbjct: 790  SLQYANHVSIKCSMIVWKKFLHAPFMIALPHTLPWCYFIISIVLQLDKHKNVAMNEFWVE 849

Query: 733  LVRQLFPFNTIITFLNVLLLYMNNQTQANFPFDEYFEQFIDMSLADLVGYFCENEELPEV 792
             VR++FP+N+I+ FLNVLL YM +        +E    +  MSL +L+ YF ENEELPEV
Sbjct: 850  FVRRIFPWNSIVKFLNVLLAYMVDNCWEQSILNELCPFYNSMSLDELLTYFNENEELPEV 909

Query: 793  WECWGTLWFDALNTKHIT--------------NLTDINSTGVKDHMFMDSPIDGISFDHN 838
            W+C G+LWFD +  K                 N+ D    GVKD+ F D PIDG  FD +
Sbjct: 910  WKCRGSLWFDTIMEKSNLNKDKNPEVINGSDFNINDYKGNGVKDYKFFDFPIDGTDFDES 969

Query: 839  DESGEKFWKRCARVILLFRALALECPVGLREISGGRNWRSLVFKFEEP-----PSEW--- 890
            DE GE+FWKR ARVI LF+ LA E   GL    GG     L+  +E P       E+   
Sbjct: 970  DEIGERFWKRAARVIFLFKKLA-ESYTGL----GG-----LILSYEAPVFNRRKDEYKVN 1019

Query: 891  --CDMYLE-PFTL-----------VFDTFEQISPVNLDQRATPYCGMTPDIDIRTLQGYR 936
              C   LE  F L           + ++FE    VN D   TP   M     I    GY+
Sbjct: 1020 TVCQELLEFSFKLNASSDGVMLDDIIESFETPDEVNYDTHKTPMLSMVDGDSIFDYVGYK 1079

Query: 937  ILLPDYYCFNRNGDMITGSLYTIGTLESSGIHGGDDFNGKRLLENGELVSTERRDYNSLI 996
             + P++Y F++NGD I+ S +   ++++  +      N    + +  + S    D  S  
Sbjct: 1080 RVCPNFYSFDKNGDFISTSFFNSWSIKN--LTNELSRNTCSSITDDAISSGSGND--SAA 1135

Query: 997  DREEQPIMDEFLRHTHCKNDVRWEQMLPRGDLHCFADTHV-------TYFVLDATTWLRH 1049
                   M+E L    C  D +++ +        + D+         TYF+LDAT+WLRH
Sbjct: 1136 ASTNNDPMNELLVFNECF-DPKYKTLEEFWSQEIYPDSQTNISLQGKTYFILDATSWLRH 1194

Query: 1050 FGHVYKLAANNILKFAICLTTFQELRFLRKSKDESVLEAATRAVITVRQLYYERKLLPLR 1109
            F H+YK+A + ILKFAICLTTFQELR+LRKSKD +V+EAATRA+IT+RQLY+E  LLPLR
Sbjct: 1195 FAHIYKIATSKILKFAICLTTFQELRYLRKSKDHNVVEAATRAIITLRQLYHENNLLPLR 1254

Query: 1110 FTGNVAGHLEEHLEIEEQMTWRSHVDEFVIEAIHKAQ----DKFNALNDDAKAASRDCIP 1165
            FTGNVA H+EEHLE EEQ+TWRSHVDEFVIEA+ KA+    D+ N +N D     +    
Sbjct: 1255 FTGNVATHIEEHLEFEEQITWRSHVDEFVIEAVLKAEEKRTDRLNDINMDTDEKEKSIFG 1314

Query: 1166 TGADQRFNFIALVTDDLNMRNKAGAQNIKAFSTRFMFSVCN-----ELGHAK 1212
                     I LVTDD+ M+NKA  + IK FSTRF+FS+ N     E GH K
Sbjct: 1315 ---------IILVTDDITMKNKAMDRKIKTFSTRFIFSMANYIRTMEEGHNK 1357

>NCAS0A03170 Chr1 complement(621400..625359) [3960 bp, 1319 aa] {ON}
            Anc_5.706 YIL151C
          Length = 1319

 Score =  924 bits (2388), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 508/1037 (48%), Positives = 654/1037 (63%), Gaps = 109/1037 (10%)

Query: 279  KQSSQALMEKLQEIYRNIVRQETELQQRCSQLTTSQTTDLKNLWIIYKVNAELIDNYFMF 338
            K++ +AL+ KLQ+IY+ IV+QE ELQ+RCSQLTTSQTTDLKNLW IYKVN +LI+NY  F
Sbjct: 294  KKTGEALVRKLQDIYKVIVKQEIELQERCSQLTTSQTTDLKNLWTIYKVNIDLINNYVTF 353

Query: 339  ITTALLPTQPEADLLIGKEIIEVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIIY 398
            ITTALL +Q + DL IG+EIIE+YRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFI +
Sbjct: 354  ITTALLSSQSQQDLHIGEEIIEIYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFITH 413

Query: 399  VFISISNMLGDIPPKFSIIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYHEALKYTFGH 458
            VFIS+S ML DIP K+SI WL+RLGDLSRMAIALYPSGFIDWKLSAE WY EA+K+T+ H
Sbjct: 414  VFISLSTMLADIPTKYSIPWLQRLGDLSRMAIALYPSGFIDWKLSAEEWYMEAMKFTYNH 473

Query: 459  GKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNSGHHRN 518
            GKLYYHMSTVQQNTL AFVNLGKSVFC++TF PSQQYMQLVIDNIYQRAF ERN+G++RN
Sbjct: 474  GKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNGNNRN 533

Query: 519  AHLVEYLKHTEVMLLPSFLESSELQDVVLAFFEQKFGV--------------------TS 558
              L+EYLKH+EVMLLP+FLE+SELQ VVL +F++KFG+                    T 
Sbjct: 534  LQLIEYLKHSEVMLLPTFLENSELQQVVLLYFQEKFGILEVTIPSTSETISINTMNNNTR 593

Query: 559  NVDFFDPRLVFVQDSERLKHFFRHASLYAESHLLQLVGFGDPRNPFALLFELPKHLXXXX 618
             +D F  R +F+Q+ E+LK+FFRHA  +AESH+LQLVGFGDP+NPFALLFELPK+L    
Sbjct: 594  TIDMFRSRDMFIQNPEQLKYFFRHAPAFAESHILQLVGFGDPKNPFALLFELPKYLKERK 653

Query: 619  XXXXXXXXXXXXXXQYDT-----------SID------DDCAF---------AAPSEFFE 652
                            +            SID      DD                EFF+
Sbjct: 654  DKKEKKKSKSNSNSNNNNNASTAGDGSMMSIDNSEMGEDDINNLFSDNVMNQVTSEEFFQ 713

Query: 653  TIDSTKYIYKFPDDINIWKESLSYANVTAMKCSMIVLRKFLHGPLLTALPHLLPWGYFLA 712
             I+  ++ Y  P+ + IW  SL++ N+ ++KCSMIVL+KFLHGPLL ALPHLLPW YF+ 
Sbjct: 714  NIEQLRFDYFIPNSLEIWMASLNHINLISLKCSMIVLKKFLHGPLLIALPHLLPWCYFII 773

Query: 713  ATNSRVITIPQDEIRRFWVALVRQLFPFNTIITFLNVLLLYM--------------NNQT 758
            +   +   +  ++ + FW+ +++ +FP+N II FLNVLL Y                 Q 
Sbjct: 774  SILLKREGLTHEDSKIFWIGILKTIFPWNDIINFLNVLLRYTLDNIGLPTPSAVNDTKQK 833

Query: 759  QANFPFDEYFEQFIDMSLADLVGYFCENEELPEVWECWGTLWFDALNTKHITNLTDINST 818
              N    +   ++  M  ADL+ +F ENE+LPEVW+CWGTLWFD ++ K+  +     + 
Sbjct: 834  DMNVFILDLCNKYSTMGFADLLQHFNENEDLPEVWKCWGTLWFDTISNKNGMDADSFENL 893

Query: 819  GVKDHMFMDSPIDGISFDHNDESGEKFWKRCARVILLFRALALEC-PVGLR-EISGGRNW 876
            G+KDHMF+D PIDGI +   DE+GE FWKR  R+I LF+ +A     +GL+   + G  +
Sbjct: 894  GIKDHMFLDFPIDGIGYVLEDETGENFWKRTLRIIFLFKGIAENFDSLGLKVSYNAGTEY 953

Query: 877  RS-----------LVFKFEEPPSEWCDMYL------------EPFTLVFDTFEQISPVNL 913
            R+             FK+    +++ D  L               T   D  E I   NL
Sbjct: 954  RNNNVPMDNILKMFSFKWAGSNADYVDANLGDELEIYTNTIINRITEFVDIKEPIHETNL 1013

Query: 914  DQRATPYCGMTPDIDIRTLQGYRILLPDYYCFNRNGDMITGSLYTIGTLESSGIHGGDDF 973
            +    P   M  + DI    GY+ L P+   F++NG+  +GS+YT   +         D+
Sbjct: 1014 NFEIPPLKSMIANEDIFDYTGYKKLEPNSRSFDKNGEFSSGSIYTAWPM---------DY 1064

Query: 974  NGKRLLENGELVSTERRDYNSLIDREEQPIMDEFLRHTHCKNDVRWEQMLPRGDLHCFAD 1033
            +   L +N    +    +   L        +DE       + + R +  L         +
Sbjct: 1065 DQLILAQNNNNNTNATDEMTDLFTGTLS--IDELSFRQLKRPEFRDKSTLLSSTSTEPFN 1122

Query: 1034 THVTYFVLDATTWLRHFGHVYKLAANNILKFAICLTTFQELRFLRKSKDESVLEAATRAV 1093
             + TYFV DAT+WLRHF H+YKLA+N++LKFA+CLTTFQELRFLRKSKD +V+EA+TRA+
Sbjct: 1123 RYKTYFVFDATSWLRHFAHIYKLASNHVLKFAVCLTTFQELRFLRKSKDANVVEASTRAI 1182

Query: 1094 ITVRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIEAIHKAQDKF---- 1149
            IT+RQLY +  LLPLRFTGNVA  +EEHLE EEQ+TWRSHVDEFVIEA+ KAQ+KF    
Sbjct: 1183 ITMRQLYSDGNLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAVMKAQEKFVKSK 1242

Query: 1150 ---------NALNDDAKAASRDCIPTGADQRFNFIALVTDDLNMRNKAGAQNIKAFSTRF 1200
                     N    DA   +           F ++ L+TDD +MR KA  + I  F T+ 
Sbjct: 1243 TVENMEGTSNWGEIDATTTTVSAEEEEKSNLFKYVVLITDDDSMRMKAQLKGISTFGTQV 1302

Query: 1201 MFSVCNELGHAKNVCTN 1217
            +FSVC+ +G  + VCTN
Sbjct: 1303 VFSVCSMMGIDEGVCTN 1319

>CAGL0G02541g Chr7 (231428..235315) [3888 bp, 1295 aa] {ON} similar to
            uniprot|P36168 Saccharomyces cerevisiae YKR096w
          Length = 1295

 Score =  916 bits (2367), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/979 (48%), Positives = 639/979 (65%), Gaps = 79/979 (8%)

Query: 275  AVTAKQSSQALMEKLQEIYRNIVRQETELQQRCSQLTTSQTTDLKNLWIIYKVNAELIDN 334
            A  + + +QAL++KLQ+IY+NIVRQE ELQ++C+QLT+SQTTDL ++W IY++N EL+ N
Sbjct: 360  ANNSNKPTQALVQKLQDIYKNIVRQEVELQEKCAQLTSSQTTDLNSIWSIYRINVELVTN 419

Query: 335  YFMFITTALLPTQPEADLLIGKEIIEVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQ 394
            Y  FI+TALL +Q + DL+IG+EI+E YRI RRLWVYGTITFLDVLKNFS+FMDPEVC Q
Sbjct: 420  YVTFISTALLSSQSQYDLMIGQEIVETYRIGRRLWVYGTITFLDVLKNFSSFMDPEVCSQ 479

Query: 395  FIIYVFISISNMLGDIPPKFSIIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYHEALKY 454
            FI +VFISIS ML DIP K+SI W++RLGDLSRMAIALYPSGFIDWKLS+E+WY++ALKY
Sbjct: 480  FITHVFISISTMLADIPTKYSIPWMQRLGDLSRMAIALYPSGFIDWKLSSEYWYNQALKY 539

Query: 455  TFGHGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNSG 514
            T+G+GKLYYHMST+QQNTL AFVNLGKSVFC+DTFIPS QYMQLVIDNIYQRAF ER S 
Sbjct: 540  TYGYGKLYYHMSTIQQNTLEAFVNLGKSVFCQDTFIPSPQYMQLVIDNIYQRAFIERGSN 599

Query: 515  HHRNAHLVEYLKHTEVMLLPSFLESSELQDVVLAFFEQKFGVT-SNVDFFDPRLVFVQDS 573
            + RN+ L+EYLKH+EVMLLP+F+ +  LQ VV+ +FE KFG    +++ F PR +F+Q+ 
Sbjct: 600  NTRNSQLIEYLKHSEVMLLPNFIGNENLQKVVMTYFEHKFGTDLHDLNIFQPRDIFLQNP 659

Query: 574  ERLKHFFRHASLYAESHLLQLVGFGDPRNPFALLFELPKHLXXXXXXXXXXXXXXXXXXQ 633
            E LK+FFRHA  +AESH+LQ VGFGD +NPFALLF+LPK L                   
Sbjct: 660  ENLKYFFRHAPAFAESHILQTVGFGDSKNPFALLFDLPKFLKEKKDKKDRKKTKSSGEPT 719

Query: 634  YDTSI---DDDC--AFAAPSEFFETIDSTKYIYKFPDDINIWKESLSYANVTAMKCSMIV 688
             + S+   D+    +  +  ++F  ++S ++ Y  P   +IW +SLSY N+TA++C +IV
Sbjct: 720  SNESVMSLDNISTDSLISSDQYFSNLESMQHPYLPPPRYDIWLKSLSYLNLTAVQCGVIV 779

Query: 689  LRKFLHGPLLTALPHLLPWGYFLAATNSRVITIPQDEIRRFWVALVRQLFPFNTIITFLN 748
            LRKFLHGP + ALPHL+ W YF+ +   +  T+  +E R FW + +R+L P N+I++FLN
Sbjct: 780  LRKFLHGPFVVALPHLMVWTYFIISVCLKSETLVDEESRYFWSSFMRRLLPLNSIVSFLN 839

Query: 749  VLLLYMNNQTQANFPFDEYFEQFIDMSLADLVGYFCENEELPEVWECWGTLWFDALNTKH 808
            VL+ Y  + +  +       E+   M L +L+  F  NEELPEVW+CWGTLWFDA+  K 
Sbjct: 840  VLIAYALDNSYYSTLISSISEELDSMDLQELLTKFNNNEELPEVWKCWGTLWFDAITDKS 899

Query: 809  ITNLTDINSTGVKDHMFMDSPIDGISFDHNDESGEKFWKRCARVILLFRALALECPVGLR 868
             T+       GV DH+F DSPIDGI FD  DE+GEKFWKR  R+I LF+ +A    +G+ 
Sbjct: 900  NTDTNSYEKIGVSDHLFFDSPIDGIVFDSKDENGEKFWKRALRIIFLFKKIAETFDIGIT 959

Query: 869  ------------EISGGRNWRSLVFKFEEPPSEWCDMYLEP---FTLVFDTFEQISPVNL 913
                        ++       S  FK E+       + +E       + +  E  + VN+
Sbjct: 960  LSHTAPVYCRRDDVELNHILGSFSFKIEQHLLNGNTVQVEIENCLGAIIEMTEMPNEVNI 1019

Query: 914  DQRATPYCGMTPDIDIRTLQGYRILLPDYYCFNRNGDMITGSLYT------------IGT 961
               ATP   +  + +I    GY+ + P+   F++NG++ + + YT              +
Sbjct: 1020 TMDATPPMSLQENENIFEYTGYKRIAPELQNFDKNGELRSAANYTSWYSAQEIVPKSAAS 1079

Query: 962  LESS--GIHGGDDFNGKRLLEN-GELVSTERRDYNSLIDREEQPIMDEFLRHTHCKNDVR 1018
             E+S  G   G  F  + + EN   + + E  +  SL+D                     
Sbjct: 1080 PENSVAGSSPGRSFQSQDVEENIFSVFTNEEENSTSLLDG-------------------- 1119

Query: 1019 WEQMLPRGDLHCFADTHVTYFVLDATTWLRHFGHVYKLAANNILKFAICLTTFQELRFLR 1078
                          +   T FVLDAT+WLRH  H+YKLA+N+ L F+ICLTTFQELRFLR
Sbjct: 1120 -------------LNLETTSFVLDATSWLRHSAHIYKLASNSFLVFSICLTTFQELRFLR 1166

Query: 1079 KSKDESVLEAATRAVITVRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFV 1138
            KSKDE+V+EAA RA+I +RQLY + K++PLRFTGN+A H+EEHLE EEQ+TWRSHVDEFV
Sbjct: 1167 KSKDENVMEAAARAIIIIRQLYSDGKVIPLRFTGNIATHIEEHLEFEEQITWRSHVDEFV 1226

Query: 1139 IEAIHKAQDKFNALNDDAKAASRDCIPTGADQRFNFIALVTDDLNMRNKAGAQNIKAFST 1198
            IE+I KAQ KF           +  +    D    F  LV+DD NM+ KA  + I+ F+T
Sbjct: 1227 IESISKAQKKF----------LQPFVQNPVDNDSRFFVLVSDDENMKRKAHEKEIRTFTT 1276

Query: 1199 RFMFSVCNELGHAKNVCTN 1217
            RF+F++C+E+G  + +CTN
Sbjct: 1277 RFVFALCSEMGKGRLICTN 1295

>YIL151C Chr9 complement(57338..60694) [3357 bp, 1118 aa] {ON}
            Putative protein of unknown function, predicted to
            contain a PINc domain
          Length = 1118

 Score =  892 bits (2304), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/976 (47%), Positives = 639/976 (65%), Gaps = 93/976 (9%)

Query: 278  AKQSSQALMEKLQEIYRNIVRQETELQQRCSQLTTSQTTDLKNLWIIYKVNAELIDNYFM 337
            + Q +Q  ++KLQEIY+ IV QETELQQRC  LTTSQTT+LK+LW IY++N ELI NY  
Sbjct: 200  SAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYIN 259

Query: 338  FITTALLPTQPEADLLIGKEIIEVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFII 397
            FI TALL TQP  DL++G+EI+++YRIE+RLWVYG ITFLDVLKNFSNFMDPEVCCQFII
Sbjct: 260  FIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFII 319

Query: 398  YVFISISNMLGDIPPKFSIIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYHEALKYTFG 457
            Y FIS+SNML DIP K+SI+W +RLGDLSRMAI+LYPSGFIDW+LSAE+WY E++KY +G
Sbjct: 320  YAFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYG 379

Query: 458  HGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNSGH-- 515
             GKLYYH++TVQQN+L AFVNLGKSVFC+D F PSQQ +QL+I+NIYQ AF +R+SG   
Sbjct: 380  CGKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRSSGSAN 439

Query: 516  -----HRNAHLVEYLKHTEVMLLPSFLESSELQDVVLAFFEQKFGVTSN-VDFFDPRLVF 569
                 HRN+ L++YLKHTEVMLLPSFLE+ +LQ VVL +F+ KFG   N  D FD + +F
Sbjct: 440  NNEIAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDVFDTKDMF 499

Query: 570  VQDSERLKHFFRHASLYAESHLLQLVGFGDPRNPFALLFELPKHLXXXXXXXXXXXXXXX 629
             Q+ E L+++FRHA  +AES LLQL+GFG+P+NPFALLF+LPK+L               
Sbjct: 500  CQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYLKLKKDKREKKRSEAT 559

Query: 630  XXXQYDTSIDDDCAFAAPSEFFETIDSTKYIYK-FPDDINIWKESLSYANVTAMKCSMIV 688
                Y    D      +   +F+ ID+    +   P ++NIW +SL++ N+T+++CS+ V
Sbjct: 560  ETSSYTDPFD---VQISSESYFQNIDALNSSFNDIPTNLNIWLDSLNHINMTSIQCSIHV 616

Query: 689  LRKFLHGPLLTALPHLLPWGYFLAATNSRVITIPQDEIRRFWVALVRQLFPFNTIITFLN 748
            L KFLH PL+ ALPH L W +F+ A   ++  +   ++  FW+  +R+  P+N+I+T  N
Sbjct: 617  LTKFLHAPLVVALPHFLTWLHFIVAILKKLEMVNSKQVVAFWIHFLRRTMPWNSIVTLGN 676

Query: 749  VLLLYMNNQTQANFPF-DEYFEQFIDMSLADLVGYFCENEELPEVWECWGTLWFDALNTK 807
            VL+ YM +      PF  +  E+F  + L DL+ Y+ ENE LPE+W+CWGTLWFDA+   
Sbjct: 677  VLVCYMLDNLH---PFLKKELEKFYSLELDDLIEYYNENENLPEIWKCWGTLWFDAIKKC 733

Query: 808  HITNLTDINSTGVKDHMFMDSPIDGISFDHNDESGEKFWKRCARVILLFRALALECP-VG 866
             +  +      GV+DH+F DSP+DGI FD  DE GEKFW R  R +LL + +A + P +G
Sbjct: 734  DVMEI-----PGVQDHLFFDSPLDGIVFDEKDEVGEKFWMRSVRAVLLLKGIAKKFPDLG 788

Query: 867  LREISGGRNWRSLVF--KFEEPPSEWCDMYLEPFTLVFDTF------------------- 905
            L+      ++++ VF  + + PP    D +L+  T   D +                   
Sbjct: 789  LK-----VSFQASVFCRRNDIPP----DYFLKNLTFKLDAYDEDNYNDNNELDDLYDTIE 839

Query: 906  --EQISPVNLDQRATPYCGMTPDIDIRTLQGYRILLPDYYCFNRNGDMITGSLYTIGTLE 963
              E+I  VN+D +ATP   +     I    GY  L PDY+CF++NG   +  +Y+  +  
Sbjct: 840  INEEIEAVNMDPQATPNLSVVSGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQWSNV 899

Query: 964  SSGIHGGDDFNGKRLLENGELVSTERRDYNSLIDREEQPIMDEFLRHTHCKNDVRWEQML 1023
             +G+    D +G+ + +            N+L    E+   D+    +   ++       
Sbjct: 900  GNGVTL--DVSGESIYDVAN---------NNLSLHWEKIFFDKIAAASKGSDE------- 941

Query: 1024 PRGDLHCFADTHVTYFVLDATTWLRHFGHVYKLAANNILKFAICLTTFQELRFLRKSKDE 1083
               + +C       YFV+DAT+WLRHF H++KLA NN LKFAICLTTFQELR+LR SKD+
Sbjct: 942  ---NYNC-----TLYFVIDATSWLRHFAHIFKLAKNNTLKFAICLTTFQELRYLRGSKDD 993

Query: 1084 SVLEAATRAVITVRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIEAIH 1143
            +V+EAATR+VIT+RQLY E+K++P+RFTGN+A H+EE+LE EEQ+TW++HVDEFVI+AI 
Sbjct: 994  TVVEAATRSVITIRQLYDEKKIIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVIDAIA 1053

Query: 1144 KAQDKFNA--LNDDAKAASRDCIPTGADQRFNFIALVTDDLNMRNKAGAQNIKAFSTRFM 1201
            K   +F A  L D+ K   ++           F  LVTDD NM  KA  + IK  +T+++
Sbjct: 1054 KLNQRFQAERLTDENKNKGKE-----------FAVLVTDDDNMNQKAKDRMIKTCNTKYL 1102

Query: 1202 FSVCNELGHAKNVCTN 1217
            FS+ ++LG    +CTN
Sbjct: 1103 FSLGSKLGINSGLCTN 1118

>Suva_9.37 Chr9 complement(51993..55343) [3351 bp, 1117 aa] {ON}
            YIL151C (REAL)
          Length = 1117

 Score =  886 bits (2290), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 475/979 (48%), Positives = 641/979 (65%), Gaps = 83/979 (8%)

Query: 271  VPTVA--VTAKQSSQALMEKLQEIYRNIVRQETELQQRCSQLTTSQTTDLKNLWIIYKVN 328
            +P+V   + + Q +Q  ++KLQEIY+ IV QETELQQRC  LTTSQTT+LK+LW IYK+N
Sbjct: 190  LPSVTRQLPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYKLN 249

Query: 329  AELIDNYFMFITTALLPTQPEADLLIGKEIIEVYRIERRLWVYGTITFLDVLKNFSNFMD 388
             ELI NY  FI TALL TQP  DL++G+EI+++YRIE+RLWVYG ITFLDVLK+FSNFMD
Sbjct: 250  TELIKNYINFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKSFSNFMD 309

Query: 389  PEVCCQFIIYVFISISNMLGDIPPKFSIIWLERLGDLSRMAIALYPSGFIDWKLSAEHWY 448
            PEVCCQFI Y FI ISNML DIP K+SI+W +RLGDLSRMAI+LYPSGFIDW+LSAE+WY
Sbjct: 310  PEVCCQFITYAFICISNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWY 369

Query: 449  HEALKYTFGHGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAF 508
             E++KY +G GKLYYH++T+QQN+L AFVNLGKSVFC+D F PSQQ +QL+I+NIYQ AF
Sbjct: 370  TESMKYIYGCGKLYYHIATIQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAF 429

Query: 509  AERNSGH-------HRNAHLVEYLKHTEVMLLPSFLESSELQDVVLAFFEQKFGVTSN-V 560
             +R+SG+       HRN+ L++YLKHTEVMLLPSFLE+ +LQ VVL +F+ KFG   N  
Sbjct: 430  IDRSSGNTNNNETAHRNSQLIDYLKHTEVMLLPSFLENLDLQHVVLLYFKDKFGKDFNGN 489

Query: 561  DFFDPRLVFVQDSERLKHFFRHASLYAESHLLQLVGFGDPRNPFALLFELPKHLXXXXXX 620
            D F  + +F Q+ E L+++FRHA  +AES +LQL+GFG+P+NPFALLF+LPKHL      
Sbjct: 490  DVFSTKDMFCQNPESLRYYFRHAPAFAESQILQLIGFGNPKNPFALLFQLPKHLKFKKDK 549

Query: 621  XXXXXXXXXXXXQYDTSIDDDCAFAAPSEFFETIDSTKYIYKF-PDDINIWKESLSYANV 679
                         Y    DD     +   +F+ ID+    +   P +I IW +SL+Y N+
Sbjct: 550  REKKKSGAAEIPHYRDPFDDQ---GSSESYFQNIDTLNSDFNDPPTNIGIWLDSLNYINM 606

Query: 680  TAMKCSMIVLRKFLHGPLLTALPHLLPWGYFLAATNSRVITIPQDEIRRFWVALVRQLFP 739
            T+++CS+ VL KFLH PL  ALPH L W +F+ A   ++ TI  +++  FW+  +R+  P
Sbjct: 607  TSIQCSIQVLTKFLHAPLAVALPHFLIWLHFIIAVLKKLETINSEQVTAFWIHFLRRTMP 666

Query: 740  FNTIITFLNVLLLYMNNQTQANFPF-DEYFEQFIDMSLADLVGYFCENEELPEVWECWGT 798
            +N+++TF NVL+ YM +      PF ++  E+F  + L DL+ YF ENE LPEVW+CWG+
Sbjct: 667  WNSMVTFSNVLVCYMLDNLH---PFLEKQLEKFYSLELDDLIEYFNENENLPEVWKCWGS 723

Query: 799  LWFDALNTKHITNLTDINSTGVKDHMFMDSPIDGISFDHNDESGEKFWKRCARVILLFRA 858
            LWFDA+    +  +      GV+DH+F DSP+DGI FD  DE GEKFW R  R IL  + 
Sbjct: 724  LWFDAVKKCDVMEI-----PGVQDHLFFDSPLDGIVFDKKDEIGEKFWIRSVRTILTLKG 778

Query: 859  LALECP-VGLR------------EISGGRNWRSLVFKFEEPPSEWCDMYLEPFTL--VFD 903
            +A + P +GL+            +IS     ++L FK  +P  E  D + +   L  ++D
Sbjct: 779  IAKKFPDLGLKVNFQASVFCRRNDISPDYFLKNLTFKL-DPYEE--DAFNDNNELDELYD 835

Query: 904  TF---EQISPVNLDQRATPYCGMTPDIDIRTLQGYRILLPDYYCFNRNGDMITGSLYTIG 960
            T    E I  VN+D +ATP   +     I    GY  L  DY+CF++NG   +  +YT  
Sbjct: 836  TIEINELIETVNIDLQATPKLSVVSGESIFEYTGYTRLTQDYHCFDKNGGFNSAFIYT-- 893

Query: 961  TLESSGIHGGDDFNGKRLLENGELVSTERRDYNSLIDREEQPIMDEFLRHTHCKNDVRWE 1020
              + S +  G   +          VS+E     SL D     +   + +       + ++
Sbjct: 894  --QWSNVGNGVTLD----------VSSE-----SLYDSTTNDLSLHWAK-------ILFD 929

Query: 1021 QMLPRGDLHCFADTHVTYFVLDATTWLRHFGHVYKLAANNILKFAICLTTFQELRFLRKS 1080
            ++   G       +   YFV+DAT+WLRHF H++KLA NNILKFAICLTTFQELR+LR S
Sbjct: 930  KVFTIGKNTDDDGSCSVYFVIDATSWLRHFAHIFKLAKNNILKFAICLTTFQELRYLRGS 989

Query: 1081 KDESVLEAATRAVITVRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIE 1140
            KD++V+EAATR+VIT+RQLY E+K++P+RFTGN+A H+EE+LE EEQ+TW++HVDEFVI+
Sbjct: 990  KDDNVVEAATRSVITIRQLYDEKKIIPMRFTGNIATHIEENLEFEEQITWKTHVDEFVID 1049

Query: 1141 AIHKAQDKFNALN--DDAKAASRDCIPTGADQRFNFIALVTDDLNMRNKAGAQNIKAFST 1198
            AI K    F      D  K  S++           F  LVTDD NM  KA  + IK  +T
Sbjct: 1050 AIAKLNQNFQTERTIDKNKGRSKE-----------FAVLVTDDDNMNQKAKDKMIKTCNT 1098

Query: 1199 RFMFSVCNELGHAKNVCTN 1217
            +++FS+ ++LG    +CTN
Sbjct: 1099 KYLFSLGSKLGINSGLCTN 1117

>Skud_9.17 Chr9 complement(34389..37745) [3357 bp, 1118 aa] {ON}
            YIL151C (REAL)
          Length = 1118

 Score =  886 bits (2289), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/977 (48%), Positives = 631/977 (64%), Gaps = 85/977 (8%)

Query: 273  TVAVTAKQSSQALMEKLQEIYRNIVRQETELQQRCSQLTTSQTTDLKNLWIIYKVNAELI 332
            T  + + Q +Q  ++KLQEIYR IV QETELQQRC  LTTSQTT+LK+LW IY++N ELI
Sbjct: 195  TRQLPSAQPNQTFIKKLQEIYRIIVVQETELQQRCLFLTTSQTTELKSLWAIYRLNTELI 254

Query: 333  DNYFMFITTALLPTQPEADLLIGKEIIEVYRIERRLWVYGTITFLDVLKNFSNFMDPEVC 392
             NY  FI TALL TQP  DL++G+EI+++YRIE+RLWVYG ITFLDVLKNFSNFMDPEVC
Sbjct: 255  KNYINFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLDVLKNFSNFMDPEVC 314

Query: 393  CQFIIYVFISISNMLGDIPPKFSIIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYHEAL 452
            CQFIIY FIS+S+ML DIP K+SI+W +RLGDLSRMAI+LYPSGFIDW+LSAE+WY E++
Sbjct: 315  CQFIIYAFISVSSMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESM 374

Query: 453  KYTFGHGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERN 512
            KY +G GKLYYH++TVQQN+L AFVNLGKSVFC+D F PSQQ +QL+I+NIYQ AF +R+
Sbjct: 375  KYIYGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDLFTPSQQTLQLLIENIYQSAFIDRS 434

Query: 513  SG-------HHRNAHLVEYLKHTEVMLLPSFLESSELQDVVLAFFEQKFGVTSN-VDFFD 564
            S         HRN+ L++YLKHTEVMLLPSFLE+ +LQ VVL +F+ KFG   N  D FD
Sbjct: 435  SAGTNNNETAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKDKFGKDFNGNDIFD 494

Query: 565  PRLVFVQDSERLKHFFRHASLYAESHLLQLVGFGDPRNPFALLFELPKHLXXXXXXXXXX 624
             + +F Q+ E L+++FRHA  +AES LLQL+GFG+P+NPFALLF+LPK+L          
Sbjct: 495  TKDMFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYLKLKRHKREKK 554

Query: 625  XXXXXXXXQYDTSIDDDCAFAAPSEFFETIDS-TKYIYKFPDDINIWKESLSYANVTAMK 683
                    QY    DD     +   +F+ IDS T      P ++NIW +SL++ N+T+++
Sbjct: 555  KSGATEVPQYRDPFDDQI---SSESYFQNIDSLTSNFDDIPTNLNIWLDSLNHINMTSIQ 611

Query: 684  CSMIVLRKFLHGPLLTALPHLLPWGYFLAATNSRVITIPQDEIRRFWVALVRQLFPFNTI 743
            CS+ VL KFLH PL+ ALPH L W +F+ A   ++ T+    +  FW+  +R+  P+N++
Sbjct: 612  CSIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLETVNSKAVSGFWIHFLRRTMPWNSM 671

Query: 744  ITFLNVLLLYMNNQTQANFPFDEY-FEQFIDMSLADLVGYFCENEELPEVWECWGTLWFD 802
            +   NVL+ YM +      PF E   E+F  + L DL+ YF ENE LPE+W+CWG+LWFD
Sbjct: 672  VNLANVLVCYMLDNIH---PFLERELERFYSLELDDLIEYFNENENLPEIWKCWGSLWFD 728

Query: 803  ALNTKHITNLTDINSTGVKDHMFMDSPIDGISFDHNDESGEKFWKRCARVILLFRALALE 862
            A+    +  +      GV+DH+F DSP+DGI FD  DE GE+FW R  R IL+ + +A +
Sbjct: 729  AIKKCDVMEI-----PGVQDHLFFDSPLDGIVFDEKDEIGERFWIRSIRTILILKGVAKK 783

Query: 863  CP-VGLREISGGRNWRSLVFKFEEPPSEWCDMYLEPFTLVFDTFEQ-------------- 907
             P +GL+      N+++ VF      S   D +L+ FT   D +E+              
Sbjct: 784  FPDLGLK-----VNFQAPVFCRRNDISP--DYFLKNFTFKLDEYEENDHNDNNELDELYD 836

Query: 908  -------ISPVNLDQRATPYCGMTPDIDIRTLQGYRILLPDYYCFNRNGDMITGSLYTIG 960
                   I  VN D RATP   +    +I    GY  L PDY+CF++NG   +  +Y+  
Sbjct: 837  TIEINEKIERVNRDLRATPNLSVVSGENIFEYTGYTRLTPDYHCFDKNGGFNSAFIYSQW 896

Query: 961  TLESSGIHGGDDFNGKRLLENGELVSTERRDYNSLIDREEQPIMDEFLRHTHCKNDVRWE 1020
            +   +G+    D + + + +            N+L    E+   D      H        
Sbjct: 897  SNVGNGMVL--DVSSESMYDAAN---------NNLSPHWEKIFFDRITTAGH-------- 937

Query: 1021 QMLPRGDLHCFADTHVTYFVLDATTWLRHFGHVYKLAANNILKFAICLTTFQELRFLRKS 1080
                 GD +        YFV+DAT+WLRHF H++KLA NNILKFAICLTTFQELR+LR S
Sbjct: 938  ----NGDKNGNCS---VYFVIDATSWLRHFAHIFKLAKNNILKFAICLTTFQELRYLRGS 990

Query: 1081 KDESVLEAATRAVITVRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIE 1140
            KD++V+EAATR+VIT+RQLY E+K++PLRFTGN+A ++EE+LE EEQ+TW +HVDEFVI+
Sbjct: 991  KDDNVVEAATRSVITIRQLYDEKKIIPLRFTGNIATNVEENLEFEEQITWETHVDEFVID 1050

Query: 1141 AIHKAQDKFNALNDDAKAASRDCIPTGADQRFNFIALVTDDLNMRNKAGAQNIKAFSTRF 1200
            AI K    F          +   I    ++   +  LVTDD NM  KA  + IK  +T++
Sbjct: 1051 AIAKLNQNF---------QTERLIDKNKNKNNAYAVLVTDDDNMDGKAKDKMIKTCNTKY 1101

Query: 1201 MFSVCNELGHAKNVCTN 1217
            +FS+ +++G    +CTN
Sbjct: 1102 LFSLGSKIGINSGLCTN 1118

>Smik_9.18 Chr9 complement(34956..38312) [3357 bp, 1118 aa] {ON}
            YIL151C (REAL)
          Length = 1118

 Score =  886 bits (2289), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/978 (47%), Positives = 629/978 (64%), Gaps = 97/978 (9%)

Query: 278  AKQSSQALMEKLQEIYRNIVRQETELQQRCSQLTTSQTTDLKNLWIIYKVNAELIDNYFM 337
            + Q +Q  ++KLQEIY+ IV QETELQQRC  LTTSQTT+LK+LW IY++N ELI NY  
Sbjct: 200  SAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTELKSLWAIYRLNTELIKNYIN 259

Query: 338  FITTALLPTQPEADLLIGKEIIEVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFII 397
            FI TALL TQP  DL++G+EI+++Y +E+RLWVYG ITFLDVLKNFSNFMDPEVCCQFII
Sbjct: 260  FIITALLTTQPINDLIMGQEILDIYGMEKRLWVYGIITFLDVLKNFSNFMDPEVCCQFII 319

Query: 398  YVFISISNMLGDIPPKFSIIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYHEALKYTFG 457
            Y FIS+SNML DIP K+SI+W +RLGDLSRMAI+LYPSGFIDW+LSAE+WY E++KY +G
Sbjct: 320  YAFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFIDWRLSAEYWYTESMKYIYG 379

Query: 458  HGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAER------ 511
             GKLYYH++TVQQN+L AFVNLGKSVFC+D F PSQQ +QL+I+NIYQ AF +R      
Sbjct: 380  CGKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQLLIENIYQSAFIDRGSSGTN 439

Query: 512  -NSGHHRNAHLVEYLKHTEVMLLPSFLESSELQDVVLAFFEQKFGVTSN-VDFFDPRLVF 569
             N   H+N+ L++YLKHTEVMLLPSFLE+ +LQ VVL +F+ KFG   N  D FD + +F
Sbjct: 440  NNETAHKNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFKNKFGKDFNGNDVFDTKDMF 499

Query: 570  VQDSERLKHFFRHASLYAESHLLQLVGFGDPRNPFALLFELPKHLXXXXXXXXXXXXXXX 629
             Q+ E L+++FRHA  +AES LLQL+GFG+P+NPFALLF+LPK+L               
Sbjct: 500  CQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQLPKYLKLKKDKREKKRSSAT 559

Query: 630  XXXQYDTSIDDDCAFAAPSEFFETIDSTKYIY-KFPDDINIWKESLSYANVTAMKCSMIV 688
               QY     D     +P  +F+ ID+    +   P ++NIW ESL++ N+T+++CS+ V
Sbjct: 560  ETPQYRDPFHDK---KSPESYFQNIDALSSNFDDIPTNLNIWLESLNHINMTSIQCSIHV 616

Query: 689  LRKFLHGPLLTALPHLLPWGYFLAATNSRVITIPQDEIRRFWVALVRQLFPFNTIITFLN 748
            L KFLH P + ALPH L W YFL A   R+ TI   ++  FW+  +R+  P+N++++  N
Sbjct: 617  LTKFLHAPFVIALPHFLTWLYFLVAILKRLETINSKQVIAFWIHFLRRTMPWNSMVSLAN 676

Query: 749  VLLLYMNNQTQANFPF-DEYFEQFIDMSLADLVGYFCENEELPEVWECWGTLWFDALNTK 807
            VL+ YM +      PF  +  E F    L DL+ +F ENE LPE+W+CWG+LWFDA+   
Sbjct: 677  VLVCYMLDNLH---PFLKKELESFYSFELDDLIEHFNENENLPEIWKCWGSLWFDAIKKC 733

Query: 808  HITNLTDINSTGVKDHMFMDSPIDGISFDHNDESGEKFWKRCARVILLFRALALECP-VG 866
             +  +      GV+DH+F DSP+DGI FD  DE GE+FW R  R I L + +A + P +G
Sbjct: 734  DVMEI-----PGVQDHLFFDSPLDGIVFDEKDEIGERFWVRSVRAISLLKGIAKKFPDLG 788

Query: 867  LREISGGRNWRSLVF-KFEEPPSEWCDMYLEPFTLVFDTF-------------------- 905
            L+      N+++ VF +  + P    D +L  FT   D +                    
Sbjct: 789  LK-----VNFQAPVFCRRNDIPQ---DYFLRKFTFKLDAYDEGNNNDNNELDELYETIEI 840

Query: 906  -EQISPVNLDQRATPYCGMTPDIDIRTLQGYRILLPDYYCFNRNGDMITGSLYTIGTLES 964
             E+I  VNLD RATP   +     I    GY  L PDY+CF++NG   +  +Y+  +   
Sbjct: 841  NEKIDNVNLDLRATPNLSVVFGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQWSNVG 900

Query: 965  SGIHGGDDFNGKRLLENGELVSTERRDYNSLIDREEQPIMDEFLRHTHCKNDVRWEQM-- 1022
            +G+                            ID   +PI D     T     + WE++  
Sbjct: 901  NGVP---------------------------IDVSNEPIYDV----TDNDLSLHWEKIFF 929

Query: 1023 --LPRGDLHCFADTHVT-YFVLDATTWLRHFGHVYKLAANNILKFAICLTTFQELRFLRK 1079
              +     +C  + + T YFV+DAT+WLRHF H++KLA N+IL FAICLTTFQELR+LR 
Sbjct: 930  DRIAAAYKNCDENDNCTIYFVVDATSWLRHFAHIFKLAKNSILDFAICLTTFQELRYLRG 989

Query: 1080 SKDESVLEAATRAVITVRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVI 1139
            SKD++V+EAATR+VIT+RQLY ERK++P+RFTGN+A H+EE+LE EEQ+TW++HVDEFVI
Sbjct: 990  SKDDNVVEAATRSVITIRQLYDERKIIPMRFTGNIATHVEENLEFEEQITWKTHVDEFVI 1049

Query: 1140 EAIHKAQDKFNALNDDAKAASRDCIPTGADQRFNFIALVTDDLNMRNKAGAQNIKAFSTR 1199
            +AI K    F          +   I    ++   F  LVTDD NM  KA  + IK  +T+
Sbjct: 1050 DAIAKLNQNFQ---------TERMIAENKNKNKQFAVLVTDDDNMNKKAKDKMIKTCNTK 1100

Query: 1200 FMFSVCNELGHAKNVCTN 1217
            ++FS+ ++LG    +CTN
Sbjct: 1101 YLFSLGSKLGINSGLCTN 1118

>CAGL0H06611g Chr8 (653472..657320) [3849 bp, 1282 aa] {ON} similar to
            uniprot|P36168 Saccharomyces cerevisiae YKR096w
          Length = 1282

 Score =  883 bits (2282), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/1030 (46%), Positives = 651/1030 (63%), Gaps = 98/1030 (9%)

Query: 274  VAVTAKQSSQALMEKLQEIYRNIVRQETELQQRCSQLTTSQTTDLKNLWIIYKVNAELID 333
            +  T  +S+QAL+ KLQ+IY++I+ QE ELQ  CS +T+SQTTDLK +W +YK+N EL++
Sbjct: 265  LPTTWNRSTQALISKLQDIYKSILVQEVELQNCCSAITSSQTTDLKKIWEVYKINVELVN 324

Query: 334  NYFMFITTALLPTQPEADLLIGKEIIEVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCC 393
            NY +FITTALLP+Q + DLLIG+EII+VY+IERRLWVYGTITFLDVLK+FSNFMDPE+CC
Sbjct: 325  NYVIFITTALLPSQSQTDLLIGQEIIDVYKIERRLWVYGTITFLDVLKHFSNFMDPEICC 384

Query: 394  QFIIYVFISISNMLGDIPPKFSIIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYHEALK 453
            QFII+VFISI+NM   IP KFSI W  RLGDLSRMA ALYP G  DWKLSAE+WY EA+K
Sbjct: 385  QFIIHVFISIANMSDYIPKKFSIPWFSRLGDLSRMATALYPPGATDWKLSAEYWYGEAMK 444

Query: 454  YTFGHGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNS 513
            YT+G GKLYYHM+TVQQN+LAAF+NLGKSVFCRD F+P+QQY+QLVIDNIYQRA+  R  
Sbjct: 445  YTYGVGKLYYHMATVQQNSLAAFINLGKSVFCRDAFVPTQQYLQLVIDNIYQRAYISRGE 504

Query: 514  GHHRNAHLVEYLKHTEVMLLPSFLESSELQDVVLAFFEQKFG---VTSNVDFFDPRLVFV 570
                N  +++YLKH E+M+LP+F+E+ ELQ +   +F +KFG   V +N  FFD R +FV
Sbjct: 505  ESSSNVQILDYLKHNEIMVLPNFMENFELQRMAYVYFSEKFGQDFVGNN--FFDTRSMFV 562

Query: 571  QDSERLKHFFRHASLYAESHLLQLVGFGDPRNPFALLFELPKHLXXXXXXXXXXXXXXXX 630
            Q+ E +K +FRH+ L+A++H+LQ+VG+G+  N FALL+ELPK +                
Sbjct: 563  QNLESVKFYFRHSPLFAQAHILQVVGYGNIGNAFALLYELPKFIKDNEISRQRKKSKTGV 622

Query: 631  XXQYDTSIDDDCAFAAP-------SEFFETIDSTKYIYKFPDDINIWKESLSYANVTAMK 683
                D    D  +F           E+F ++++    +  P +++IW +SL Y N T + 
Sbjct: 623  ----DNMSIDTLSFQVSGNEIHDVGEYFNSLENIDKEFTLPPNVDIWIQSLQYTNTTGIF 678

Query: 684  CSMIVLRKFLHGPLLTALPHLLPWGYFLAATNSRVITIPQDEIRRFWVALVRQLFPFNTI 743
            C M+VL+KFL GP +TALPHLLPW YFL +   ++ T+     + FW   +R++FP+NTI
Sbjct: 679  CGMMVLQKFLQGPFVTALPHLLPWVYFLISVAFKIETLRDTNSQYFWKLFIRRIFPWNTI 738

Query: 744  ITFLNVLLLYMNNQTQANFPFDEYFEQFIDMSLADLVGYFCENEELPEVWECWGTLWFDA 803
            I FLNVL+ ++ + + +    ++  E +  +SL +++  F ENEELPEVW CWG+LWFD 
Sbjct: 739  INFLNVLIAFLKDNSDSCSLVNQLCETYSQLSLDEILTNFSENEELPEVWNCWGSLWFDT 798

Query: 804  LNTKHITNLTDINSTGVKDHMFMDSPIDGISFDHNDESGEKFWKRCARVILLFRALALEC 863
            +  K  T+ + + + G+KD  F+D+P DGI FD  D++G KFWKR  R++ LF+  A + 
Sbjct: 799  IKNKSETSYSGLKTAGIKDVNFLDAPYDGIVFDEEDDNGNKFWKRACRILFLFKGYAEKF 858

Query: 864  PVGLR----------------EISGGRNWRSLVFKFEE-----PPSEWCDMYLEPFTLVF 902
              GLR                +    RN    +FKF+      P  E  + Y + ++L  
Sbjct: 859  DQGLRLTNINSLNSEEENIFTKKQEKRNI-DFLFKFDPTYDLLPIDEASNKYFQVYSLFT 917

Query: 903  D---TFEQISPVNLDQRATPYCGMTPDIDIRTLQGYRILLPDYYCFNRNGDMITGSLYT- 958
            +    FE IS  N+   A P   +     I    GY+ LLP YY +++NG++  G++Y+ 
Sbjct: 918  EKLPAFESISENNIILDAVPQLSVIDGESIFDYVGYKKLLPCYYYYDKNGNVNKGAIYSN 977

Query: 959  ------IGT-----LESSG---IHGGDDFNG-----KRL----LENGELVSTERRDYNSL 995
                  +G      +E+     I G DD        KRL    LE  E  S E  D+ + 
Sbjct: 978  WEAFNQLGNGLKPRMENGSSFIIDGLDDSKNFEIREKRLFAKYLECDE--SQESSDHLAE 1035

Query: 996  IDREEQPIMDEFLRHTHCKNDVRWEQMLPRGDLHCFADT-----------HVTYFVLDAT 1044
            ++RE     DE       K D  +     + DL     T           + TYF+ DAT
Sbjct: 1036 VEREGDETEDETEETNSRKVDKYYTN---QRDLDTIFKTIKINGEMRVAYYSTYFIFDAT 1092

Query: 1045 TWLRHFGHVYKLAANNILKFAICLTTFQELRFLRKSKDESVLEAATRAVITVRQLYYERK 1104
            TWLRHF H+YK+A + +L F ICLTTFQELRFLR+S+DE+V+EAATRAVI +R LY  +K
Sbjct: 1093 TWLRHFAHIYKIAYSGLLNFVICLTTFQELRFLRRSRDENVMEAATRAVIVIRLLYKLKK 1152

Query: 1105 LLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIEAIHKAQDK--FNALNDDAKAASRD 1162
            ++PLRF G +A H+EEHLE EEQ+TWRSHV+EFVIEA+ K+Q+   F+ L++++  A  D
Sbjct: 1153 VIPLRFNGKIASHIEEHLEFEEQITWRSHVNEFVIEAVAKSQENGMFDELHNESAKADFD 1212

Query: 1163 C----IPTGAD--QRFNFIA---------LVTDDLNMRNKAGAQNIKAFSTRFMFSVCNE 1207
                     AD  QR N  A         LVTDD NM +KA  + I+  STRF+FS+C++
Sbjct: 1213 AENMDTADSADTKQRGNSNASTNSKVLSVLVTDDRNMDSKAKERGIRTCSTRFIFSICSQ 1272

Query: 1208 LGHAKNVCTN 1217
            LG    +CTN
Sbjct: 1273 LGMKYGICTN 1282

>NDAI0E05070 Chr5 (1159816..1164486) [4671 bp, 1556 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1556

 Score =  503 bits (1295), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 254/384 (66%), Positives = 302/384 (78%), Gaps = 44/384 (11%)

Query: 275 AVTAKQSSQALMEKLQEIYRNIVRQETELQQRCSQLTTSQTTDLKNLWIIYKVNAELIDN 334
           ++T K SSQAL++KLQ+IY+ IV+QE +LQ RCSQLTTSQTTDLKNLW IYK+N +LI+N
Sbjct: 388 SITTKTSSQALIQKLQDIYKLIVKQEIQLQDRCSQLTTSQTTDLKNLWTIYKINLDLINN 447

Query: 335 YFMFITTALLPTQPEADLLIGKEIIEVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQ 394
           Y  FIT ALLPTQ + DL IG+EIIE+YRIERRLWVYGTITFLDVLK+FSNFMDPEVCCQ
Sbjct: 448 YINFITNALLPTQSKNDLHIGEEIIEIYRIERRLWVYGTITFLDVLKSFSNFMDPEVCCQ 507

Query: 395 FIIYVFISISNMLGDIPPKFSIIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYHEALKY 454
           FI +VFI+IS +L DIP K+SI WL+RLGDLSRMAIALYPSGFIDWKLSAEHWY+EA+K+
Sbjct: 508 FISHVFIAISLILNDIPMKYSIQWLQRLGDLSRMAIALYPSGFIDWKLSAEHWYNEAMKF 567

Query: 455 TFGHGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNSG 514
           T+ HGKLYYHMSTVQQNTL AFVNLGKSVFC++TF PSQQYMQLVIDNIYQRAF ERN+G
Sbjct: 568 TYSHGKLYYHMSTVQQNTLEAFVNLGKSVFCQETFTPSQQYMQLVIDNIYQRAFVERNNG 627

Query: 515 HHRNAHLVEYLKHTEVMLLPSFLESSELQDVVLAFFEQKFGVT----------------- 557
           +HRN  L+EYLKHTEVMLLP+FLES +LQ+VVL +F+ KFG+                  
Sbjct: 628 NHRNLQLIEYLKHTEVMLLPTFLESLDLQNVVLVYFQTKFGILDSTPQPQTSDNNNNTNG 687

Query: 558 ---------------------------SNVDFFDPRLVFVQDSERLKHFFRHASLYAESH 590
                                      + +D F  + +F+Q+ + LK+FFRH+  +A+SH
Sbjct: 688 ANVNIPYSSSSTTTSSSSSSDNTTRSFTTIDIFRNQDMFIQNPDHLKYFFRHSGTFAQSH 747

Query: 591 LLQLVGFGDPRNPFALLFELPKHL 614
           +LQLVGFGDP+NPFALLFELPK L
Sbjct: 748 ILQLVGFGDPKNPFALLFELPKFL 771

 Score =  351 bits (901), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 216/589 (36%), Positives = 315/589 (53%), Gaps = 80/589 (13%)

Query: 639  DDDCAFAAPSEFFETIDSTKYIYKFPDDINIWKESLSYANVTAMKCSMIVLRKFLHGPLL 698
            D++ +     EFFE ID  ++ YK P  I IW ESL   N+ ++KCS+IVL+KFL+GP+L
Sbjct: 857  DNNYSNILCEEFFENIDLLQFPYKIPQTIEIWLESLKNINLISLKCSIIVLKKFLNGPIL 916

Query: 699  TALPHLLPWGYFLAATNSRV-ITIPQDEIRRFWVALVRQLFPFNTIITFLNVLLLYM-NN 756
             ALPHLL W +F+ +   ++  +I  ++ + FW + ++ + P+N+I+ FLNVL++Y+ +N
Sbjct: 917  IALPHLLTWIHFIISILLKIENSITDNQSKIFWYSFLKCIIPWNSIVNFLNVLMVYLLDN 976

Query: 757  QTQANF----PFDEYFEQFIDMSLADLVGYFCENEELPEVWECWGTLWFDALNTKHITN- 811
                NF         +      SL +++ +F +NE LPE+W+CWGTLWFD +  K+I + 
Sbjct: 977  INDENFKLIISLSNKYNSMSSSSLNEMLKFFNQNENLPEIWKCWGTLWFDVICNKNINSD 1036

Query: 812  ----------------------LTD-------INSTGVKDHMFMDSPIDGISFDHNDESG 842
                                  L D       + + G++DH  +D P+DGI F  NDE G
Sbjct: 1037 TTFLNQNNNNTTTTTKNNGEDILNDNYDTDKTLRAMGIEDHTILDCPLDGIGFVANDEDG 1096

Query: 843  EKFWKRCARVILLFRALALECP-VGLREISGGRNW------------RSLVFKFEE--PP 887
              F+KR  R+I L +++    P +GL+      N+             +  FK      P
Sbjct: 1097 INFYKRSIRLIFLCKSMIETFPNLGLKISHETSNYCRNTKIPQNFILNNFAFKLTNLYDP 1156

Query: 888  S----------------------EWCDMYLEPFTLVFDTFEQISPVNLD-QRATPYCGMT 924
            S                      E+    L      F   E I  +NL+ Q   P   + 
Sbjct: 1157 SLIIIPQTEQNIENENENENDDLEFNKSILSNIMEFFQIHEPIEEINLNLQLQPPLSILG 1216

Query: 925  PDIDIRTLQGYRILLPDYYCFNRNGDMITGSLYTIGTLESSGI-HGGDDFNGKRLLENGE 983
             + +I    GY+ L  +   F+ NG++I+GS+Y+   ++ +           +  L N  
Sbjct: 1217 GNENIFNYLGYKRLNFNIQSFHENGEIISGSIYSSWPIDYNKFKEQQQQQQQQEHLVNDS 1276

Query: 984  LVSTERRDYNSLIDREEQPIMDEFLRHT-HCKNDVRWE--QMLPRGDLHCFADTHVTYFV 1040
             +  E      +    E     EF++ + H K   R    Q      +    + H T+FV
Sbjct: 1277 TMKNENVTVGDI--TPEDASFKEFMKLSFHLKLSTRSNNSQTQNTHKMGVSINKHRTFFV 1334

Query: 1041 LDATTWLRHFGHVYKLAANNILKFAICLTTFQELRFLRKSKDESVLEAATRAVITVRQLY 1100
             DAT+WLRHF H+YKL+ N  LKFA+CLTTFQELRFLRKSKD +V+EA+TRA+IT+RQLY
Sbjct: 1335 FDATSWLRHFAHIYKLSKNGFLKFAVCLTTFQELRFLRKSKDGNVVEASTRAIITMRQLY 1394

Query: 1101 YERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIEAIHKAQDKF 1149
             E KLLPLRFTGNVA  +EEHLE EEQ+TWRSHVDEFVIEAI ++Q++F
Sbjct: 1395 KEGKLLPLRFTGNVATDIEEHLEFEEQITWRSHVDEFVIEAIIRSQERF 1443

>TBLA0E01710 Chr5 complement(411712..416292) [4581 bp, 1526 aa] {ON}
           Anc_5.706 YIL151C
          Length = 1526

 Score =  437 bits (1125), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 221/413 (53%), Positives = 282/413 (68%), Gaps = 77/413 (18%)

Query: 279 KQSSQALMEKLQEIYRNIVRQETELQQRCSQLTTSQTTDLKNLWIIYKVNAELIDNYFMF 338
           K+S+Q L++KLQ IY+ IV QE ELQ +C++L+TSQ+T LK LW IYK+N +LI+NY +F
Sbjct: 263 KKSNQNLIQKLQNIYKLIVSQELELQDKCNKLSTSQSTKLKYLWSIYKLNHDLINNYILF 322

Query: 339 ITTALLPTQPEADLLIGKEIIEVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCCQFIIY 398
           I T+L P+Q   D LIGKEI+E+Y+IERRLW+YGTITFLD+LKNF+NFMDPE+  QFI +
Sbjct: 323 ILTSLSPSQSINDQLIGKEILEIYKIERRLWIYGTITFLDILKNFANFMDPEILSQFITH 382

Query: 399 VFISISNMLGDIPPKFSIIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYHEALKYTFGH 458
           VF SISNM+ D+P  F   W +RLGDLSRMAIALYPS FIDWKLS+E+WY E++K+TF H
Sbjct: 383 VFESISNMISDLPIDFINPWYQRLGDLSRMAIALYPSNFIDWKLSSEYWYIESMKFTFSH 442

Query: 459 GKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERN------ 512
           GKLYYH+STVQQN L AFVNLGKSVFC DTFIPSQ+YMQLVIDNIYQRAF ERN      
Sbjct: 443 GKLYYHISTVQQNPLEAFVNLGKSVFCFDTFIPSQRYMQLVIDNIYQRAFIERNSNSSSS 502

Query: 513 -----------------SGHHRNAHLVEYLKHTEVMLLPSFLESSELQDVVLAFFEQKFG 555
                            + + +   L+EYLKH+EVMLLP+FLE+  L+ VVL +F   FG
Sbjct: 503 NNAGSSSNPNHFMTSSFAKNFQQRFLIEYLKHSEVMLLPNFLENDHLKTVVLNYFTNSFG 562

Query: 556 ---VTSN--------------------------------------------------VDF 562
              + SN                                                  ++ 
Sbjct: 563 KIAIQSNLSDPSNPNLNTNSGSNTSISGQANIENINNGHNIPSSSNVITSESLQINAINL 622

Query: 563 FDPRLVFVQ-DSERLKHFFRHASLYAESHLLQLVGFGDPRNPFALLFELPKHL 614
           F+ R +F Q +S+ LK+FF++++ +AESH+LQL+GFGDP+NPFALLF+LPK+L
Sbjct: 623 FNFRNIFKQKNSDILKYFFKNSATFAESHILQLIGFGDPKNPFALLFQLPKYL 675

 Score =  250 bits (639), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 150/334 (44%), Positives = 201/334 (60%), Gaps = 32/334 (9%)

Query: 905  FEQISPVNLDQRATPYCGMTPDIDIRTLQGYRILLPDYYCFNRNGDMITGSLYT---IGT 961
            FE+ S  N D    P   +  +  +   +GY+  +PD+  F++NG++I+ SLYT   I T
Sbjct: 1150 FEKNSIQNTDLNCEPGLSLIENESLFEYEGYKRFIPDFSNFDKNGELISTSLYTSTIIDT 1209

Query: 962  LESSG---------IHGGDDFNGKRLLENGELVSTERRDYNSLIDREEQPIMDEFLRHTH 1012
            +  S           +  D+ N       G   + E  +  + ID +E  +M++ + +  
Sbjct: 1210 INGSSSNANIINTTTNANDESNNDSSATAGSNQNKESSNSTTNIDNKELFLMEKEIFNKI 1269

Query: 1013 CKNDVRWEQMLPRGDLHCFADTHV----TYFVLDATTWLRHFGHVYKLAANNILKFAICL 1068
               D +    + RG++  F DT +    TYFVLDAT+WLRHF HVYKLA N ILKFAICL
Sbjct: 1270 LDPDYKNIDEIWRGEM--FHDTSIQFSDTYFVLDATSWLRHFAHVYKLATNGILKFAICL 1327

Query: 1069 TTFQELRFLRKSKDESVLEAATRAVITVRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQM 1128
            TTFQELRFLRKSKDE+V+EAATRA+IT+RQLY E++LLPLRFTGN+A H+EEHLE EEQ+
Sbjct: 1328 TTFQELRFLRKSKDENVMEAATRAIITLRQLYSEKRLLPLRFTGNIATHIEEHLEFEEQI 1387

Query: 1129 TWRSHVDEFVIEAIHKAQDKF--NALNDDAKAASRDCIPTGADQRFN--------FIALV 1178
            TWRSHVDEFVIEAI +AQ K   N   +D+   S +  P   +   N           LV
Sbjct: 1388 TWRSHVDEFVIEAIKRAQLKRRDNRNQEDSNVTSSNNNPIINNNENNGNLNVTDMIFVLV 1447

Query: 1179 TDDLNMRNK----AGAQNIKAFSTRFMFSVCNEL 1208
            TDD++M  K        +I  FST+F+FS+CN L
Sbjct: 1448 TDDISMIKKRQEEKSDNDIITFSTKFVFSLCNML 1481

 Score =  186 bits (471), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 83/216 (38%), Positives = 138/216 (63%), Gaps = 2/216 (0%)

Query: 646  APSEFFETIDSTKYIYKFPDDINIWKESLSYANVTAMKCSMIVLRKFLHGPLLTALPHLL 705
            +P +FF  ++S K  +  P+ + IW ESL Y N+ ++ CS+IVL+KFL+GPL  +LPH+L
Sbjct: 787  SPQDFFNNLESLKLSFFLPNSLEIWNESLKYINIISLNCSIIVLKKFLNGPLFVSLPHML 846

Query: 706  PWGYFLAATNSRVITIPQDEIRRFWVALVRQLFPFNTIITFLNVLLLYMNNQTQANFPFD 765
            PW YF+ +   R+ ++   E R FW+  +R++FP+N+I+++LNV++  + +    N    
Sbjct: 847  PWSYFIISLALRIESLENIESRIFWLQFIRKIFPWNSIVSYLNVIISVLLDNCYENSMIT 906

Query: 766  EYFEQFIDMSLADLVGYFCENE-ELPEVWECWGTLWFDALNTKHITNLTDIN-STGVKDH 823
            +    + + +L +L+  F ENE ELPEVW+C+G+LWFD +   +     D + +  +KD 
Sbjct: 907  KLINNYSNKNLDELLVEFNENEYELPEVWKCYGSLWFDVIAENYQIYSRDCSKNISMKDT 966

Query: 824  MFMDSPIDGISFDHNDESGEKFWKRCARVILLFRAL 859
              ++ PIDG+ FD  +E+G  FWKR  R+I LF+ +
Sbjct: 967  KCLNYPIDGLPFDEMEENGTNFWKRSCRLIFLFKTM 1002

>TPHA0D04640 Chr4 (1012556..1015444) [2889 bp, 962 aa] {ON} Anc_5.706
            YIL151C
          Length = 962

 Score =  136 bits (343), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 185/863 (21%), Positives = 350/863 (40%), Gaps = 154/863 (17%)

Query: 289  LQEIYRNIVRQETELQQRCSQ---LTTSQTTDLKNLWI--IYKVNAELIDNYFMFITTAL 343
            L  ++ +I R ET ++   S    L      D+ N ++  ++K++ +++  Y  FI  AL
Sbjct: 107  LLPLFMSIERAETSIETISSSQALLFLDGNEDVINSYLMRLFKLHTKIVSRYTEFIAIAL 166

Query: 344  LPTQPEADLLIGKEIIEVYRIERRLWVYGTITFLDVLKNFSNFM----------DPEVCC 393
                 + DL+ GKE +   R+  RL  +     L++++N+ N M          + +   
Sbjct: 167  NINNTQEDLIRGKEYVTKGRLNERLINHCLKPLLEIIENYKNHMKINGINVSVINNDNII 226

Query: 394  QFIIYVFISISNMLGDIPPKFSIIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYH---- 449
            +FI    I I++ML +IP KF   W   +GDL+R+ + L       ++L++ H Y+    
Sbjct: 227  EFIQSFIIDITHMLEEIPLKFHYDWELHIGDLNRLLMLLSVKDQEVYRLNSLHRYNIIAP 286

Query: 450  -EALKYTFGHGK----------LYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQL 498
              A+ Y+  +GK           Y+++S VQ ++LA  V L K +   +T +  +   QL
Sbjct: 287  VVAVNYSPNNGKESDIKNHMCNYYFNLSKVQHSSLARIVTLSKCLCIENTNVYQKSMAQL 346

Query: 499  VIDNIYQRAFAERNSGHHRNAHLVEYLKHTEVMLL----PSFLESSELQDVVLAFFEQKF 554
             ID I  +   ++ +           +K+  ++ L     S  + S ++   L +F  +F
Sbjct: 347  AIDKIISKLLNKQVNLKQSMGGTTILMKYFTLLSLFFGSTSSSQLSGMERSSLHYFWNEF 406

Query: 555  GVTSNVDFFDPRLVFVQDSERLKH------FFRHASLYAESHLLQLVGFGDPRNPFALLF 608
                ++++   R   V    R K       +F +A L++   +++ +      NPF    
Sbjct: 407  ANEYHLNYSSLRKP-VNCKYRQKEINYSMFYFNNAPLFSLISIVETIIMNKKLNPFF--- 462

Query: 609  ELPKHLXXXXXXXXXXXXXXXXXXQYDTSIDDDCAFAAPSEFFETIDSTKYIYKFPDDIN 668
                                             C + +  +F   I S          ++
Sbjct: 463  ---------------------------------CVYKSSDDF--EIKSVS--------LS 479

Query: 669  IWKESLSYANVTAMKCSMIVLRKFLHGPLLTALPHLLPWGYFLAATNSRVITIPQDEIRR 728
             WK  +   + T +  + ++ +KFL   +  + P +LPW  F  +  S V  +    +  
Sbjct: 480  NWKILIEQMDDTLLHSNKLLFKKFLMLNVAISQPFILPWLLFYISVASEVANVTDRHVLL 539

Query: 729  FWVALVRQLFPFNTIITFLNVLLLYMNNQTQANFPFDEYFEQFIDMSLADLVGYFCENEE 788
             W  L++ L P++ I+T+LN  +  +N  +  +       +     SL DL+ Y      
Sbjct: 540  LWKDLLQNLLPWDDIVTYLNESIDMVNKHSINSKTLRALIKNIKSCSLYDLLYYMMYESN 599

Query: 789  LPEVWECWGTLWFDALNTKHITNLTDINSTGVKDHMFMDSPIDGISFDHNDESGEKFWKR 848
              E+  C G +WFD+L +K        N + +K   +  S  D + +D +D+   K W R
Sbjct: 600  FQEISMCEGFIWFDSLASKIKQASITTNESLMKFKSYNASE-DSLIYDDDDQVYTKMWTR 658

Query: 849  CARVILLFRALALECPVGLREISGGRNWRSLVFKFEEPPSEWCDMYLEPFT--LVFDTFE 906
               +ILL + +  + P  L ++S          + +   +  C    +  T   +FD   
Sbjct: 659  ALLIILLIKNVINDYP-ELIDVS---------IRGQSLTNSSCIKNSDSLTNDYLFDWGF 708

Query: 907  QISPVNLDQRATPYCGMTPDIDIRTLQGY-RIL----LPDYYCFNRNGDMITGSLYTIGT 961
            +++  N          +  D    TL G  RI     +PD+  F++NGD+  G  Y++  
Sbjct: 709  ELNNNN--------AVIIDD----TLHGRNRIFKFSYIPDFQDFDKNGDITWG--YSL-- 752

Query: 962  LESSGIHGGDDFNGKRLLENGELVSTERRDYNSLIDREEQPIMDEFLRHTHCKNDV---R 1018
            + +      +DFN +   E+G       R                  R     ND    +
Sbjct: 753  ISNYDYIYSNDFNSE---EDGNFFQRYSR------------------RLLSAHNDYSEDK 791

Query: 1019 WEQMLPRGDLHCFADTHVTYFVLDATTWLRHFGHVYKLAANNILKFAICLTTFQELRFLR 1078
             ++ LP+            YF++D   WL+H   + +  A   +K  + ++   +L  L+
Sbjct: 792  SKKYLPK--------LENNYFMVDTLAWLKHSNKLKRFIAEEKVKVILSVSILNDLNELK 843

Query: 1079 K-SKDESVLEAATRAVITVRQLY 1100
              S+ ESV  +A+R +I +  LY
Sbjct: 844  NYSEHESVRSSASRVMIVINYLY 866

>TPHA0D00810 Chr4 (162899..166549) [3651 bp, 1216 aa] {ON} Anc_8.78
            YPL012W
          Length = 1216

 Score = 36.2 bits (82), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 44/98 (44%), Gaps = 14/98 (14%)

Query: 647  PSEFFETIDSTKYIYKFPDDINIWKESLSYANVTAMKCSMIVLRKFLHGPLLTALPHLLP 706
            PS   E  D+ + +Y   +   I K ++ Y  V    C + +  + +H  +   LP LL 
Sbjct: 918  PSMLLEIYDTIQ-LYLTSNSREIAKSAIGYIKV----CILGLPVELMHDKVPELLPKLLR 972

Query: 707  W-----GYFLAATNSRVITIPQDEIRRFWVALVRQLFP 739
            W     G+F A    +V  I +  IRRF   LV Q FP
Sbjct: 973  WSNEHTGHFKA----KVKNIIERMIRRFGYELVEQAFP 1006

>NCAS0D04940 Chr4 (948608..949591) [984 bp, 327 aa] {ON} 
          Length = 327

 Score = 35.4 bits (80), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 68/174 (39%), Gaps = 33/174 (18%)

Query: 918  TPYCGMTPDIDIRTLQGYRILLPDYYCFNRNGDMITGSLYTIGTLESSGIHGGDDFNG-- 975
            T +  ++ + DI+TLQ Y  LL     F+R  D I    Y IG +   G H   +FNG  
Sbjct: 84   TSFKSVSENTDIKTLQEYNELLNRIVSFSR--DCIGEQKYLIGCIGPWGAHVCAEFNGDY 141

Query: 976  -------------KRLLENGELVSTERRDYNSLIDREEQPIMDEFLRHTHCKNDVRWEQM 1022
                         K  L+N    + E  D   LI  E  P ++E       K  + W++ 
Sbjct: 142  GAHPENIDYYQYFKPQLDN--FFANENLD---LIGFETVPNVNEL------KAILSWDEK 190

Query: 1023 LPRGDLHCFADTHVTYFVLDATTWLRHFGHVYKLAAN----NILKFAICLTTFQ 1072
            +     +     H    + D TT +   G+++K   N    N+L   I   +F 
Sbjct: 191  ILSKPFYIGLSVHENGVLRDGTT-MEEIGNIFKSLGNKVNPNLLLLGINCVSFN 243

>TBLA0D05690 Chr4 complement(1397632..1410426) [12795 bp, 4264 aa]
            {ON} Anc_1.216 YKR054C
          Length = 4264

 Score = 36.2 bits (82), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 32/64 (50%), Gaps = 6/64 (9%)

Query: 403  ISNMLGDIPPKFSIIWLERLGDLSRMAIALYPSGFIDWK----LSAEHWYHEALKYTFGH 458
            + NMLGD+P  F+   + +  D+S   + L  +  ID      L  +HWYHE L  +F  
Sbjct: 2992 MQNMLGDLPLDFTKYTIPK--DISSDLVILRSTSLIDAIFNIFLVIDHWYHETLNLSFRT 3049

Query: 459  GKLY 462
             K +
Sbjct: 3050 TKCF 3053

>NDAI0B01200 Chr2 complement(284935..286449) [1515 bp, 504 aa] {ON}
           Anc_1.490 YEL047C
          Length = 504

 Score = 35.8 bits (81), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 33/108 (30%), Positives = 50/108 (46%), Gaps = 12/108 (11%)

Query: 882 KFEEPPSEWC---DMYLEPFTLVFDTFEQISPVN-----LDQRATPYCG-MTPDIDIRTL 932
           +F+ P SE     D+ L   T   D FE+ S +N     ++     Y G +TP +   T+
Sbjct: 382 EFKLPISEIDFIDDLKLYSSTEAADPFERQSVINTFGSNINHETMIYVGEITPVVHF-TM 440

Query: 933 QGYRILLPDYYCFNRNGDMITGSLYTIGTLESSGIHGGDDFNGKRLLE 980
            G RI        N+ G+++   LY  G + S G+HG +   G  LLE
Sbjct: 441 GGARIN-EKSQVVNKRGEVLAHGLYAAGEV-SGGVHGANRLGGSSLLE 486

>Ecym_2311 Chr2 (604942..607269) [2328 bp, 775 aa] {ON} similar to
           Ashbya gossypii AFR135W
          Length = 775

 Score = 34.3 bits (77), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 36/81 (44%), Gaps = 7/81 (8%)

Query: 271 VPTVAVTAKQSSQALMEKLQEIYRNIVRQETELQQRCSQLTTSQTTDLKNLWIIYKVNAE 330
           V T+ V  K+ S  + +   EI +N V  E E+QQ   +L  S   +L+N W       E
Sbjct: 658 VSTLPVIYKKISDMVKQVESEIKKNNVESEEEIQQSRKKLIKSIKIELENYW-------E 710

Query: 331 LIDNYFMFITTALLPTQPEAD 351
            +D Y       +LP   E D
Sbjct: 711 SVDPYEHVYPITVLPPPREMD 731

>KAFR0I02810 Chr9 (564378..565889) [1512 bp, 503 aa] {ON} Anc_1.490
           YEL047C
          Length = 503

 Score = 34.3 bits (77), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 44/88 (50%), Gaps = 9/88 (10%)

Query: 899 TLVFDTFEQISPVN-----LDQRATPYCG-MTPDIDIRTLQGYRILLPDYYCFNRNGDMI 952
           T V DT  + S VN     +D+ +  Y G +TP +   T+ G +I   +    ++N +++
Sbjct: 403 TTVADTHGRSSKVNTFNIEIDENSPIYVGEITPVVHF-TMGGVKIN-ENSQVLDKNDNIL 460

Query: 953 TGSLYTIGTLESSGIHGGDDFNGKRLLE 980
              LY  G + S G+HG +   G  LLE
Sbjct: 461 ARGLYAAGEV-SGGVHGSNRLGGSSLLE 487

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.137    0.423 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 120,357,137
Number of extensions: 5224477
Number of successful extensions: 12754
Number of sequences better than 10.0: 34
Number of HSP's gapped: 12889
Number of HSP's successfully gapped: 70
Length of query: 1217
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1096
Effective length of database: 39,606,813
Effective search space: 43409067048
Effective search space used: 43409067048
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 72 (32.3 bits)