Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AFR289W5.705ON81812712e-32
KNAG0C066205.705ON101801481e-13
ZYRO0B16368g5.705ON85811367e-12
Kpol_YGOB_1043.725.705ON88791323e-11
KLLA0A00539g5.705ON87781323e-11
TBLA0G010305.705ON89801238e-10
YKR095W-A (PCC1)5.705ON88791151e-08
KAFR0H001905.705ON82791113e-08
NCAS0A031805.705ON88801105e-08
Smik_11.3595.705ON88771105e-08
SAKL0E14982g5.705ON89781106e-08
KLTH0E00990g5.705ON89771106e-08
TPHA0E002005.705ON85771106e-08
Kwal_YGOB_Anc_5.7055.705ON88771098e-08
TDEL0B021505.705ON91791072e-07
Skud_11.3355.705ON94851062e-07
NDAI0E050605.705ON86831011e-06
Suva_11.3325.705ON11177977e-06
Ecym_40165.705ON12572901e-04
NOTE: 1 genes in the same pillar as AFR289W were not hit in these BLAST results
LIST: CAGL0G02535g

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR289W
         (81 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR289W Chr6 (960013..960026,960078..960309) [246 bp, 81 aa] {ON...   108   2e-32
KNAG0C06620 Chr3 (1283525..1283568,1283654..1283915) [306 bp, 10...    62   1e-13
ZYRO0B16368g Chr2 (1328001..1328023,1328088..1328322) [258 bp, 8...    57   7e-12
Kpol_YGOB_1043.72 s1043 (153488..153525,153647..153875) [267 bp,...    55   3e-11
KLLA0A00539g Chr1 complement(49433..49661,49740..49774) [264 bp,...    55   3e-11
TBLA0G01030 Chr7 (258297..258337,258458..258686) [270 bp, 89 aa]...    52   8e-10
YKR095W-A Chr11 (625864..625901,625977..626205) [267 bp, 88 aa] ...    49   1e-08
KAFR0H00190 Chr8 complement(25330..25558,25623..25642) [249 bp, ...    47   3e-08
NCAS0A03180 Chr1 complement(626215..626443,626521..626558) [267 ...    47   5e-08
Smik_11.359 Chr11 (615946..615984,616062..616286) [264 bp, 88 aa...    47   5e-08
SAKL0E14982g Chr5 (1245785..1245822,1245898..1246129) [270 bp, 8...    47   6e-08
KLTH0E00990g Chr5 complement(95824..96055,96120..96157) [270 bp,...    47   6e-08
TPHA0E00200 Chr5 complement(25648..25882,26105..26127) [258 bp, ...    47   6e-08
Kwal_YGOB_Anc_5.705 s55 complement(79302..79530,79607..79644) [2...    47   8e-08
TDEL0B02150 Chr2 complement(384337..384592,384661..384680) [276 ...    46   2e-07
Skud_11.335 Chr11 (607394..607432,607436..607453,607509..607733)...    45   2e-07
NDAI0E05060 Chr5 (1159116..1159376) [261 bp, 86 aa] {ON} Anc_5.7...    44   1e-06
Suva_11.332 Chr11 (610692..610730,610734..610769,610773..611030)...    42   7e-06
Ecym_4016 Chr4 complement(39497..39874) [378 bp, 125 aa] {ON} si...    39   1e-04

>AFR289W Chr6 (960013..960026,960078..960309) [246 bp, 81 aa] {ON}
          Syntenic homolog to Saccharomyces cerevisiae YKR095W-A
          (PCC1); 1-intron
          Length = 81

 Score =  108 bits (271), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 59/81 (72%), Positives = 59/81 (72%)

Query: 1  MDHTLHLHVPFESXXXXXXXXXXXXXXXXXXXXXXSVSFASDGASLNIKLAAIDARVLRV 60
          MDHTLHLHVPFES                      SVSFASDGASLNIKLAAIDARVLRV
Sbjct: 1  MDHTLHLHVPFESARLADIAARALAPDPLLRPEELSVSFASDGASLNIKLAAIDARVLRV 60

Query: 61 ATNSIFEALKTVVETADELDF 81
          ATNSIFEALKTVVETADELDF
Sbjct: 61 ATNSIFEALKTVVETADELDF 81

>KNAG0C06620 Chr3 (1283525..1283568,1283654..1283915) [306 bp, 101
          aa] {ON} Anc_5.705 YKR095W-A
          Length = 101

 Score = 61.6 bits (148), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 44/80 (55%)

Query: 1  MDHTLHLHVPFESXXXXXXXXXXXXXXXXXXXXXXSVSFASDGASLNIKLAAIDARVLRV 60
          +DHTL L+VPFE+                      +VS+A+ G  L  +    DARVLRV
Sbjct: 11 LDHTLTLNVPFETPRQALIASQVLQPDPILKPQDFAVSYAAQGPCLEARFCGRDARVLRV 70

Query: 61 ATNSIFEALKTVVETADELD 80
            +S+ ++LKT++E+ DELD
Sbjct: 71 GVSSVIDSLKTIIESLDELD 90

>ZYRO0B16368g Chr2 (1328001..1328023,1328088..1328322) [258 bp, 85
          aa] {ON} similar to uniprot|Q3E833 Saccharomyces
          cerevisiae YKR095W-A
          Length = 85

 Score = 57.0 bits (136), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 41/81 (50%)

Query: 1  MDHTLHLHVPFESXXXXXXXXXXXXXXXXXXXXXXSVSFASDGASLNIKLAAIDARVLRV 60
          +DH LHL +PF +                       V + S G  L I   ++D RVLRV
Sbjct: 4  LDHNLHLTIPFPNDRYSEVAVKVLRPDPILRPEDFQVEYKSKGNLLEIDFKSVDDRVLRV 63

Query: 61 ATNSIFEALKTVVETADELDF 81
            +S+ +++KT+VET DELD+
Sbjct: 64 GVSSVIDSVKTIVETIDELDY 84

>Kpol_YGOB_1043.72 s1043 (153488..153525,153647..153875) [267 bp,
          88 aa] {ON} ANNOTATED BY YGOB -
          Length = 88

 Score = 55.5 bits (132), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 42/79 (53%)

Query: 1  MDHTLHLHVPFESXXXXXXXXXXXXXXXXXXXXXXSVSFASDGASLNIKLAAIDARVLRV 60
          MDHTL   +PFE+                       VS++S+   L +K  +ID RVLRV
Sbjct: 9  MDHTLDFEIPFETARQAEIAVQVLKPDPILKPQDFQVSYSSNDNLLIMKFKSIDDRVLRV 68

Query: 61 ATNSIFEALKTVVETADEL 79
            +S+ +++KT++ET DEL
Sbjct: 69 GVSSVIDSVKTIIETMDEL 87

>KLLA0A00539g Chr1 complement(49433..49661,49740..49774) [264 bp,
          87 aa] {ON} highly similar to uniprot|Q3E833
          Saccharomyces cerevisiae YKR095W-A PCC1 Protein
          Length = 87

 Score = 55.5 bits (132), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 40/78 (51%)

Query: 2  DHTLHLHVPFESXXXXXXXXXXXXXXXXXXXXXXSVSFASDGASLNIKLAAIDARVLRVA 61
          +H+LHL +PFES                       V++++    L     ++D R+LRV 
Sbjct: 9  EHSLHLEIPFESIKQADVARKVLLPDPIMKPEDFQVTYSTQDTKLICDFESVDERILRVG 68

Query: 62 TNSIFEALKTVVETADEL 79
           NS+ E++KT+VET DEL
Sbjct: 69 VNSVIESIKTIVETIDEL 86

>TBLA0G01030 Chr7 (258297..258337,258458..258686) [270 bp, 89 aa]
          {ON} Anc_5.705 YKR095W-A
          Length = 89

 Score = 52.0 bits (123), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 42/80 (52%)

Query: 1  MDHTLHLHVPFESXXXXXXXXXXXXXXXXXXXXXXSVSFASDGASLNIKLAAIDARVLRV 60
          M+HTL L++PF +                       V + S G  L ++  +ID RVLRV
Sbjct: 10 MEHTLTLNIPFATSKQADIACQVLRPDPILRPQDFQVKYTSKGNELVMEFQSIDDRVLRV 69

Query: 61 ATNSIFEALKTVVETADELD 80
            +S+ +++KT++ET DEL+
Sbjct: 70 GVSSVIDSVKTIIETFDELE 89

>YKR095W-A Chr11 (625864..625901,625977..626205) [267 bp, 88 aa]
          {ON}  PCC1Component of the EKC/KEOPS protein complex
          with Kae1p, Gon7p, Bud32p, and Cgi121p; EKC/KEOPS
          complex is required for t6A tRNA modification and may
          have roles in telomere maintenance and transcription
          Length = 88

 Score = 48.9 bits (115), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 40/79 (50%)

Query: 1  MDHTLHLHVPFESXXXXXXXXXXXXXXXXXXXXXXSVSFASDGASLNIKLAAIDARVLRV 60
          +DHTL L +PFE+                       V ++S+   + ++  +ID RVLRV
Sbjct: 9  LDHTLELKIPFETERQATIATKVLSPDPILKPQDFQVDYSSEKNVMLVQFRSIDDRVLRV 68

Query: 61 ATNSIFEALKTVVETADEL 79
            +SI +++KT+VE  D L
Sbjct: 69 GVSSIIDSIKTIVEAMDVL 87

>KAFR0H00190 Chr8 complement(25330..25558,25623..25642) [249 bp,
          82 aa] {ON} Anc_5.705 YKR095W-A
          Length = 82

 Score = 47.4 bits (111), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 38/79 (48%)

Query: 1  MDHTLHLHVPFESXXXXXXXXXXXXXXXXXXXXXXSVSFASDGASLNIKLAAIDARVLRV 60
          +DHTL L +PFE                        VS+ +       +  +ID RVLRV
Sbjct: 3  LDHTLKLEIPFEDAKQANIAVDVLKPDPILRPQDFQVSYKARDNVFVAEFESIDDRVLRV 62

Query: 61 ATNSIFEALKTVVETADEL 79
            +++ ++LKT++ET DEL
Sbjct: 63 GVSNVIDSLKTIIETMDEL 81

>NCAS0A03180 Chr1 complement(626215..626443,626521..626558) [267
          bp, 88 aa] {ON} Anc_5.705 YKR095W-A
          Length = 88

 Score = 47.0 bits (110), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 38/80 (47%)

Query: 1  MDHTLHLHVPFESXXXXXXXXXXXXXXXXXXXXXXSVSFASDGASLNIKLAAIDARVLRV 60
          +D+ L+L +PF +                       V + S    L +    ID RVLRV
Sbjct: 9  LDYVLNLEIPFTTSRQAQIAAKVLVPDPILKPQDFQVEYLSQDNILAVHFRGIDDRVLRV 68

Query: 61 ATNSIFEALKTVVETADELD 80
            +S+ +++KT++ET DELD
Sbjct: 69 GVSSVIDSIKTIIETIDELD 88

>Smik_11.359 Chr11 (615946..615984,616062..616286) [264 bp, 88 aa]
          {ON} YKR095W-A (REAL)
          Length = 88

 Score = 47.0 bits (110), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 39/77 (50%)

Query: 3  HTLHLHVPFESXXXXXXXXXXXXXXXXXXXXXXSVSFASDGASLNIKLAAIDARVLRVAT 62
          HTL L VPF++                       + ++S+   + ++  +ID RVLRV  
Sbjct: 11 HTLELKVPFKTEQQAVIATRVLSPDPILKPQDFQIDYSSEKNVMLVQFRSIDDRVLRVGV 70

Query: 63 NSIFEALKTVVETADEL 79
          +S+ +++KTVVE  DEL
Sbjct: 71 SSVIDSIKTVVEAMDEL 87

>SAKL0E14982g Chr5 (1245785..1245822,1245898..1246129) [270 bp, 89
          aa] {ON} similar to uniprot|Q3E833 Saccharomyces
          cerevisiae YKR095W-A PCC1 Proposed transcription factor
          involved in the expression of genes regulated by
          alpha-factor and galactose
          Length = 89

 Score = 47.0 bits (110), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 38/78 (48%)

Query: 1  MDHTLHLHVPFESXXXXXXXXXXXXXXXXXXXXXXSVSFASDGASLNIKLAAIDARVLRV 60
          +DH L+L +P E+                       V +++    L +   +ID RVLRV
Sbjct: 9  LDHHLYLEIPLETPSQAIIAMKALKPDPVLKPEDFQVEYSAADYKLCVSFKSIDDRVLRV 68

Query: 61 ATNSIFEALKTVVETADE 78
            +S+ E++KT++ET DE
Sbjct: 69 GVSSVIESVKTIIETMDE 86

>KLTH0E00990g Chr5 complement(95824..96055,96120..96157) [270 bp,
          89 aa] {ON} similar to uniprot|Q3E833 Saccharomyces
          cerevisiae YKR095W-A PCC1 Protein
          Length = 89

 Score = 47.0 bits (110), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 38/77 (49%)

Query: 3  HTLHLHVPFESXXXXXXXXXXXXXXXXXXXXXXSVSFASDGASLNIKLAAIDARVLRVAT 62
          +TL+L VPF++                       V ++S   +L +    +D RVLRV  
Sbjct: 11 YTLYLEVPFKTAKQAETAVKVLKPDPILKPQDFHVEYSSKAHNLCVSFEGVDDRVLRVGV 70

Query: 63 NSIFEALKTVVETADEL 79
          +S+ E++KT++ET DE 
Sbjct: 71 SSVIESIKTIIETIDEF 87

>TPHA0E00200 Chr5 complement(25648..25882,26105..26127) [258 bp,
          85 aa] {ON} Anc_5.705 YKR095W-A
          Length = 85

 Score = 47.0 bits (110), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 40/77 (51%), Gaps = 1/77 (1%)

Query: 6  HLHVPFESXXXXXXXXXXXXXXXXXXXXXXSVSFASDGASLNIKLAAIDARVLRVATNSI 65
           L++PFE+                       V ++S G+ L +   ++D RVLRV  +++
Sbjct: 9  KLNIPFETSKQASIAAQVLKPDPQLRPEEFKVDYSSQGSDLVVNFQSVDDRVLRVGVSNV 68

Query: 66 FEALKTVVETADEL-DF 81
           +++KT++ET DEL DF
Sbjct: 69 IDSIKTIIETIDELQDF 85

>Kwal_YGOB_Anc_5.705 s55 complement(79302..79530,79607..79644)
          [267 bp, 88 aa] {ON} ANNOTATED BY YGOB -
          Length = 88

 Score = 46.6 bits (109), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 37/77 (48%)

Query: 3  HTLHLHVPFESXXXXXXXXXXXXXXXXXXXXXXSVSFASDGASLNIKLAAIDARVLRVAT 62
          +TL+L VPF++                       V + S   +L +    +D RVLRV  
Sbjct: 11 YTLYLEVPFQNDKQAATAVQVLKPDPILKPQDFHVEYTSSANNLCVLFEGVDDRVLRVGV 70

Query: 63 NSIFEALKTVVETADEL 79
          +S+ E++KT+VET DE 
Sbjct: 71 SSVIESIKTIVETIDEF 87

>TDEL0B02150 Chr2 complement(384337..384592,384661..384680) [276
          bp, 91 aa] {ON} Anc_5.705 YKR095W-A
          Length = 91

 Score = 45.8 bits (107), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 39/79 (49%)

Query: 1  MDHTLHLHVPFESXXXXXXXXXXXXXXXXXXXXXXSVSFASDGASLNIKLAAIDARVLRV 60
          ++H+L L +PF++                       V + +    L +   +ID RVLRV
Sbjct: 3  LNHSLKLEIPFQTAAQANIAKQVLLPDPILKPQDFQVDYTTTDNVLVVGFQSIDDRVLRV 62

Query: 61 ATNSIFEALKTVVETADEL 79
            +S+ +++KT+VET DEL
Sbjct: 63 GVSSVIDSIKTIVETIDEL 81

>Skud_11.335 Chr11 (607394..607432,607436..607453,607509..607733)
          [282 bp, 94 aa] {ON} YKR095W-A (REAL)
          Length = 94

 Score = 45.4 bits (106), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 42/85 (49%), Gaps = 6/85 (7%)

Query: 1  MDHTL------HLHVPFESXXXXXXXXXXXXXXXXXXXXXXSVSFASDGASLNIKLAAID 54
          +D+TL       L +PFE+                       V ++S+   + ++  +ID
Sbjct: 9  LDYTLVEQVFQELQIPFETEGQASIATKVLSPDPILKPQDFQVDYSSEKNIMLVRFRSID 68

Query: 55 ARVLRVATNSIFEALKTVVETADEL 79
           RVLRV  +S+ +++KT+VET DEL
Sbjct: 69 DRVLRVGVSSVIDSIKTIVETIDEL 93

>NDAI0E05060 Chr5 (1159116..1159376) [261 bp, 86 aa] {ON}
          Anc_5.705 YKR095W-A
          Length = 86

 Score = 43.5 bits (101), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 37/83 (44%), Gaps = 4/83 (4%)

Query: 1  MDHTLHLHVPFESXXXXXXXXXXXXXXXXXXXXXXSVSFASDGASLN----IKLAAIDAR 56
          +D+TL + +PF                         V +       N    +K  +ID R
Sbjct: 4  LDYTLEIRIPFPEERMATIAQQVLSPDPILKPEDFQVEYLKPATQHNNVLLVKFQSIDER 63

Query: 57 VLRVATNSIFEALKTVVETADEL 79
          VLRV  +S+ +++KT++ET DEL
Sbjct: 64 VLRVGVSSVLDSIKTILETMDEL 86

>Suva_11.332 Chr11 (610692..610730,610734..610769,610773..611030)
           [333 bp, 111 aa] {ON} YKR095W-A (REAL)
          Length = 111

 Score = 42.0 bits (97), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 37/77 (48%)

Query: 3   HTLHLHVPFESXXXXXXXXXXXXXXXXXXXXXXSVSFASDGASLNIKLAAIDARVLRVAT 62
           +T  L +PFE+                         ++S+   +  +  +ID RVLRV  
Sbjct: 34  NTRELKIPFETEKQANIATRVLSPDPILKPQDFQADYSSENNVMLARFRSIDDRVLRVGV 93

Query: 63  NSIFEALKTVVETADEL 79
           +S+ +++KT++ET DEL
Sbjct: 94  SSVIDSIKTIIETMDEL 110

>Ecym_4016 Chr4 complement(39497..39874) [378 bp, 125 aa] {ON}
           similar to Ashbya gossypii AFR289W
          Length = 125

 Score = 39.3 bits (90), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 32/72 (44%)

Query: 7   LHVPFESXXXXXXXXXXXXXXXXXXXXXXSVSFASDGASLNIKLAAIDARVLRVATNSIF 66
           L VPFE+                       V +      L +   +IDAR LRV  +S+ 
Sbjct: 51  LEVPFENGKQAEIAREVLHHDPVLRPEDFRVDYTIQHEKLLVNFNSIDARSLRVGVSSVI 110

Query: 67  EALKTVVETADE 78
           E++KTVVET DE
Sbjct: 111 ESIKTVVETMDE 122

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.131    0.350 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 4,592,606
Number of extensions: 79364
Number of successful extensions: 193
Number of sequences better than 10.0: 19
Number of HSP's gapped: 185
Number of HSP's successfully gapped: 19
Length of query: 81
Length of database: 53,481,399
Length adjustment: 53
Effective length of query: 28
Effective length of database: 47,404,101
Effective search space: 1327314828
Effective search space used: 1327314828
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 59 (27.3 bits)