Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AFR288C5.704ON46546521510.0
SAKL0E14960g5.704ON3843357593e-96
KLTH0E01012g5.704ON3863376905e-86
KLLA0A00550g5.704ON3803006662e-82
Kwal_55.196885.704ON3933346611e-81
TDEL0B021605.704ON3753776495e-80
KNAG0C066105.704ON3863296481e-79
ZYRO0G06556g5.704ON3793086331e-77
NDAI0E050505.704ON4513406139e-74
TPHA0D046205.704ON4063196045e-73
KAFR0H002005.704ON3893095992e-72
NCAS0A031905.704ON3983175881e-70
CAGL0G02519g5.704ON3783595756e-69
Kpol_YGOB_Anc_5.7045.704ON2072062874e-29
NDAI0K028706.48ON662104741.6
Ecym_31386.48ON588121714.0
CAGL0L04554g6.48ON560104687.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR288C
         (465 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR288C Chr6 complement(958787..960184) [1398 bp, 465 aa] {ON} N...   833   0.0  
SAKL0E14960g Chr5 complement(1244456..1245610) [1155 bp, 384 aa]...   296   3e-96
KLTH0E01012g Chr5 (96295..97455) [1161 bp, 386 aa] {ON} conserve...   270   5e-86
KLLA0A00550g Chr1 (50099..51241) [1143 bp, 380 aa] {ON} conserve...   261   2e-82
Kwal_55.19688 s55 (79793..80974) [1182 bp, 393 aa] {ON} [contig ...   259   1e-81
TDEL0B02160 Chr2 (384824..385951) [1128 bp, 375 aa] {ON} Anc_5.704    254   5e-80
KNAG0C06610 Chr3 complement(1282191..1283351) [1161 bp, 386 aa] ...   254   1e-79
ZYRO0G06556g Chr7 (518731..519870) [1140 bp, 379 aa] {ON} conser...   248   1e-77
NDAI0E05050 Chr5 complement(1156499..1157854) [1356 bp, 451 aa] ...   240   9e-74
TPHA0D04620 Chr4 complement(1010489..1011709) [1221 bp, 406 aa] ...   237   5e-73
KAFR0H00200 Chr8 (25900..27069) [1170 bp, 389 aa] {ON} Anc_5.704      235   2e-72
NCAS0A03190 Chr1 (626695..627891) [1197 bp, 398 aa] {ON} Anc_5.704    231   1e-70
CAGL0G02519g Chr7 complement(228822..229958) [1137 bp, 378 aa] {...   226   6e-69
Kpol_YGOB_Anc_5.704 s2001 complement(209387..210010) [624 bp, 20...   115   4e-29
NDAI0K02870 Chr11 complement(648772..650760) [1989 bp, 662 aa] {...    33   1.6  
Ecym_3138 Chr3 complement(255001..256767) [1767 bp, 588 aa] {ON}...    32   4.0  
CAGL0L04554g Chr12 complement(526735..528417) [1683 bp, 560 aa] ...    31   7.9  

>AFR288C Chr6 complement(958787..960184) [1398 bp, 465 aa] {ON}
           NOHBY633; No homolog in Saccharomyces cerevisiae;
           Methionine is very probably wrong'
          Length = 465

 Score =  833 bits (2151), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/465 (90%), Positives = 419/465 (90%)

Query: 1   MRRKRIALPDAAAGREQAHXXXXXXXXXXXXXXXXXCELLVRCRGRARHWVHTVCGPLXX 60
           MRRKRIALPDAAAGREQAH                 CELLVRCRGRARHWVHTVCGPL  
Sbjct: 1   MRRKRIALPDAAAGREQAHARRYQRGARTRTGRGGGCELLVRCRGRARHWVHTVCGPLVS 60

Query: 61  XXXXXXXXXXXXXKKCGRRGRQETGVAAGDMKETELFCKEGLEYAVAELWEEGKLRSVEL 120
                        KKCGRRGRQETGVAAGDMKETELFCKEGLEYAVAELWEEGKLRSVEL
Sbjct: 61  SVAAMAARGSRAAKKCGRRGRQETGVAAGDMKETELFCKEGLEYAVAELWEEGKLRSVEL 120

Query: 121 AVXXXXXXXXXXXXXXLVVLDSVRSGAGREPATDFYAKVMGPVLAVLSVEHEYVRTSSAA 180
           AV              LVVLDSVRSGAGREPATDFYAKVMGPVLAVLSVEHEYVRTSSAA
Sbjct: 121 AVREGRGAEARAPGGPLVVLDSVRSGAGREPATDFYAKVMGPVLAVLSVEHEYVRTSSAA 180

Query: 181 SVRELAETFPRTSETTVLVMSGDTTISEFVNALGSGAGVTVYALPLGTANAWAHSVGLGT 240
           SVRELAETFPRTSETTVLVMSGDTTISEFVNALGSGAGVTVYALPLGTANAWAHSVGLGT
Sbjct: 181 SVRELAETFPRTSETTVLVMSGDTTISEFVNALGSGAGVTVYALPLGTANAWAHSVGLGT 240

Query: 241 PAKALQAFVQGRVHAVPFPLYRARFPSGYSIRFFIVLSAGFHANLLHLCNDERYQRLGVE 300
           PAKALQAFVQGRVHAVPFPLYRARFPSGYSIRFFIVLSAGFHANLLHLCNDERYQRLGVE
Sbjct: 241 PAKALQAFVQGRVHAVPFPLYRARFPSGYSIRFFIVLSAGFHANLLHLCNDERYQRLGVE 300

Query: 301 RFREASTEILDRYALAEHVRVRAADGSEQLAGLYAYFALLNTPHLEETYVPSPLSDPLLK 360
           RFREASTEILDRYALAEHVRVRAADGSEQLAGLYAYFALLNTPHLEETYVPSPLSDPLLK
Sbjct: 301 RFREASTEILDRYALAEHVRVRAADGSEQLAGLYAYFALLNTPHLEETYVPSPLSDPLLK 360

Query: 361 QLHVLAFEAELSRDKLNELLMAGYSTIRGSALSAPGLVYRNLGDSFTLSIENGASDRVAN 420
           QLHVLAFEAELSRDKLNELLMAGYSTIRGSALSAPGLVYRNLGDSFTLSIENGASDRVAN
Sbjct: 361 QLHVLAFEAELSRDKLNELLMAGYSTIRGSALSAPGLVYRNLGDSFTLSIENGASDRVAN 420

Query: 421 ELCVDGHLLNLVDLQAPGDVFDGSIEVGVVPASFGLKALVPAHIS 465
           ELCVDGHLLNLVDLQAPGDVFDGSIEVGVVPASFGLKALVPAHIS
Sbjct: 421 ELCVDGHLLNLVDLQAPGDVFDGSIEVGVVPASFGLKALVPAHIS 465

>SAKL0E14960g Chr5 complement(1244456..1245610) [1155 bp, 384 aa]
           {ON} conserved hypothetical protein
          Length = 384

 Score =  296 bits (759), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 146/335 (43%), Positives = 209/335 (62%), Gaps = 14/335 (4%)

Query: 137 LVVLDSVRSGAGREPATDFYAKVMGPVLAVLSVEHEYVRTSSAASVRELAETFPRTSETT 196
           L++LDSV SG GR+   DF  +V+ P+L  L  EH+ ++T S+ S+ E A     +   T
Sbjct: 55  LIILDSVMSGIGRKTQADFSTQVIKPILEKLGAEHKIIKTQSSTSIAEFAREIEPSKSYT 114

Query: 197 VLVMSGDTTISEFVNAL-----GSGAGVTVYALPLGTANAWAHSVGLGTPAKALQAFVQG 251
           ++ +SGDT+ISEF+N +      S   + +Y +P+GT NAWA S+ L  P ++ Q F++ 
Sbjct: 115 IIFLSGDTSISEFLNHIPTQNSNSKHALNIYPIPMGTGNAWASSLNLKCPVESFQKFLKN 174

Query: 252 RVHAVPFPLYRARFPSGYSIRFFIVLSAGFHANLLHLCNDERYQRLGVERFREASTEILD 311
            + A  FPLYRA FP+GYS  FFI+LS GFHANLLHLCN  +Y+ +GVERF+ AS +I  
Sbjct: 175 DLIASKFPLYRASFPNGYSTIFFIILSIGFHANLLHLCNHSKYKVMGVERFKAASAQIFK 234

Query: 312 RYALAEHVRVRAADGSEQLAGLYAYFALLNTPHLEETYVPSPLSDPLLKQLHVLAFEAEL 371
            Y L   V +       +++G YAYFA++NTP+LE TY PSPLSDPL   LH+L FE+ L
Sbjct: 235 NYDLKYKVSI-----PNRVSGCYAYFAIINTPNLEPTYKPSPLSDPLTSALHLLGFESSL 289

Query: 372 SRDKLNELLMAGYSTIRGSALSAPGLVYRNLGDSFTLSIEN--GASDRVANELCVDGHLL 429
              +L + +  G +  +G  +   G++Y  L   F + +E+   ASDR+  E+C DG LL
Sbjct: 290 KSSELIKRITRGRTAQKGDDIMDTGVIYEKLEKDFDIVVEHSPSASDRIKFEICCDGQLL 349

Query: 430 NLVDLQAPGDVFDGSIEVGVVP--ASFGLKALVPA 462
           NL+D+Q     FDG+I+V  +   + F LK L PA
Sbjct: 350 NLLDMQGTEGSFDGTIKVSFLQDYSPFNLKVLSPA 384

>KLTH0E01012g Chr5 (96295..97455) [1161 bp, 386 aa] {ON} conserved
           hypothetical protein
          Length = 386

 Score =  270 bits (690), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 141/337 (41%), Positives = 209/337 (62%), Gaps = 18/337 (5%)

Query: 137 LVVLDSVRSGAGREPATDFYAKVMGPVLAVLSVEHEYVRTSSAASVRELAETFPRTSETT 196
           ++++DS++SG GR+   +F   V+ P+  +L + H+ VRT  + +  +L  TF  ++E T
Sbjct: 56  ILIVDSIKSGTGRDSRNNFGKNVLEPLFTLLGIPHKVVRTQDSDAAGQLGHTFQPSTENT 115

Query: 197 VLV-MSGDTTISEFVNAL------GSGAGVTVYALPLGTANAWAHSVGLGTPAKALQAFV 249
           +L+ +SGDTTISEF+N L      G    +++  LPLGT NAWA+S+GL  PA +L  F+
Sbjct: 116 ILIFLSGDTTISEFLNGLNRRVFEGLRHTLSLVPLPLGTGNAWANSLGLRCPAASLSCFL 175

Query: 250 QGRVHAVPFPLYRARFPSGYSIRFFIVLSAGFHANLLHLCNDERYQRLGVERFREASTEI 309
           QG++    FPLY+A FP+G+ + FFI+LS GFHANLLHLC  +R+Q LGVERF+ AS EI
Sbjct: 176 QGQLTPRKFPLYKATFPNGFEMIFFIILSIGFHANLLHLCKQQRFQSLGVERFKIASLEI 235

Query: 310 LDRYALAEHVRVRAADGSEQLAGLYAYFALLNTPHLEETYVPSPLSDPLLKQLHVLAFEA 369
           L +Y L   ++V      +     Y+YFAL+NTP+LE +Y PSP S+ L  QLHVL + +
Sbjct: 236 LQKYPLEYRLQVSGLPTRD-----YSYFALINTPNLEASYKPSPQSNSLHFQLHVLGYSS 290

Query: 370 ELSRDKLNELLMAGYSTIRGSALSAPGLVYRNLGDSFTLSIENGASDRVAN---ELCVDG 426
           +L +  L   +M GYS   G  +S  G++Y     +  +  +    + V+N   E+C DG
Sbjct: 291 KLQQASLVSKIMKGYSNRAGDDISGDGVIYEPYNHALEVVFDQ-VPENVSNTYFEICCDG 349

Query: 427 HLLNLVDLQAPGDVFDGSIEVGVVP--ASFGLKALVP 461
           HLLN++ LQ     FDG I +  +   +SF L  +VP
Sbjct: 350 HLLNMLSLQPQDQKFDGRIRIQFLKNFSSFELNVMVP 386

>KLLA0A00550g Chr1 (50099..51241) [1143 bp, 380 aa] {ON} conserved
           hypothetical protein
          Length = 380

 Score =  261 bits (666), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 133/300 (44%), Positives = 188/300 (62%), Gaps = 6/300 (2%)

Query: 137 LVVLDSVRSGAGREPATDFYAKVMGPVLAVLSVEHEYVRTSSAASVRELAETFPRTSETT 196
           L+++DSV SG+GR+   DF   V+      + V +  ++T+S +SV ELA +   T + T
Sbjct: 61  LLIVDSVFSGSGRDKDCDFATNVIAQFFEQVIVPYRLIKTTSKSSVIELASSIDSTRQYT 120

Query: 197 VLVMSGDTTISEFVNALG-SGAGVTVYALPLGTANAWAHSVGLGTPAKALQAFVQGRVHA 255
           VL +SGDT+ISEFVN L  +   ++V   P+GT NAWA S+ L  PA     FV G++  
Sbjct: 121 VLFLSGDTSISEFVNNLPLNHDCISVLPFPMGTGNAWASSLKLMDPAVIFSQFVNGKLSC 180

Query: 256 VPFPLYRARFPSGYSIRFFIVLSAGFHANLLHLCNDERYQRLGVERFREASTEILDRYAL 315
             FPLYRA F +GY ++FFI+LS GFHANLLHLC ++ YQ++G+ERFR AS  IL  Y L
Sbjct: 181 NDFPLYRATFDNGYVLKFFIILSLGFHANLLHLCEEDEYQKMGIERFRVASQRILREYKL 240

Query: 316 AEHVRVRAADGSEQLAGLYAYFALLNTPHLEETYVPSPLSDPLLKQLHVLAFEAELSRDK 375
              V +      + L G ++YFAL+NT +LE TY+PSP SDPL  QLHVLA+++ L R +
Sbjct: 241 ESRVSI-----PDILEGSFSYFALINTTNLEPTYMPSPDSDPLESQLHVLAYQSSLDRVE 295

Query: 376 LNELLMAGYSTIRGSALSAPGLVYRNLGDSFTLSIENGASDRVANELCVDGHLLNLVDLQ 435
             + +  GYS  + S +   G  YR L   F + + +  S +   E+C DG LLNL++L+
Sbjct: 296 FQKRVFMGYSNTKHSNILQNGTFYRPLPFCFNVEVLDDPSQKSNFEVCCDGQLLNLLELE 355

>Kwal_55.19688 s55 (79793..80974) [1182 bp, 393 aa] {ON} [contig
           159] FULL
          Length = 393

 Score =  259 bits (661), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 143/334 (42%), Positives = 200/334 (59%), Gaps = 16/334 (4%)

Query: 137 LVVLDSVRSGAGREPATDFYAKVMGPVLAVLSVEHEYVRTSSAASVRELAETF-PRTSET 195
           ++V+DS++SG GR+   DF   V+ PV   L +++  V+T +  SV EL   F P    T
Sbjct: 57  ILVVDSIKSGTGRDVKNDFCTNVIQPVFTELGLDYRVVKTENENSVAELGRNFRPCGQNT 116

Query: 196 TVLVMSGDTTISEFVNALGSGA------GVTVYALPLGTANAWAHSVGLGTPAKALQAFV 249
           TV+ +SGDT+ISEFVN L           V + ALPLGT NAWA+S+G  T A AL  F+
Sbjct: 117 TVIFLSGDTSISEFVNNLTQEQQGTIRPTVNLLALPLGTGNAWANSLGFRTAATALAEFL 176

Query: 250 QGRVHAVPFPLYRARFPSGYSIRFFIVLSAGFHANLLHLCNDERYQRLGVERFREASTEI 309
           QG +    FPLY+A FP+GY I FFI+LS GFHANLLHLC+  R+++LGVERFR AS EI
Sbjct: 177 QGFLKPKNFPLYKAIFPNGYEIVFFIILSIGFHANLLHLCDQPRFKKLGVERFRLASKEI 236

Query: 310 LDRYALAEHVRVRAADGSEQLAGLYAYFALLNTPHLEETYVPSPLSDPLLKQLHVLAFEA 369
            + Y L   ++V     +++    Y+YFAL+NTP+LE+ Y PSP S+PL  +LH+L + +
Sbjct: 237 FEDYILDYPLQV-----TQRPLEHYSYFALINTPNLEQNYKPSPKSNPLTSELHLLGYSS 291

Query: 370 ELSRDKLNELLMAGYSTIRGSALSAPGLVYRNLGDSFTLSIENGAS--DRVANELCVDGH 427
            L +  L   +M GYS    + ++  G+ Y+   +   +          R A ++C DGH
Sbjct: 292 GLPQPMLINRIMKGYSNQPETDINEEGVTYQAFSNDLDVVFAQDPELVPRSAFDICCDGH 351

Query: 428 LLNLVDLQAPGDVFDGSIEVGVVP--ASFGLKAL 459
           LLN++  Q     FDG I V  +   +SF LK L
Sbjct: 352 LLNMLSQQPAHGSFDGRIHVKFLKEHSSFHLKVL 385

>TDEL0B02160 Chr2 (384824..385951) [1128 bp, 375 aa] {ON} Anc_5.704
          Length = 375

 Score =  254 bits (649), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 146/377 (38%), Positives = 212/377 (56%), Gaps = 18/377 (4%)

Query: 92  KETELFCKEGLEYAVAELWEEGKLRSVELAVXXXXXXXXXXXXXXLVVLDSVRSGAGREP 151
           +E +L    G+ Y+V     E + + V+ A               L+V+DSV SG GR  
Sbjct: 5   EEIKLLNIHGICYSVISEPSESRFQLVKTATTTEDDRTVQNQPN-LIVIDSVHSGKGRTA 63

Query: 152 ATDFYAKVMGPVLAVLSVEHEYVRTSSAASVRELAETFPRTSETTVLVMSGDTTISEFVN 211
             D Y  VM P+   ++++H  ++T+S  ++   A T   +   TVL +SGDT+ISEF+N
Sbjct: 64  QNDLYTIVMKPIFEAVNIDHRLIKTTSRDTIASYASTLDISQSHTVLFLSGDTSISEFIN 123

Query: 212 ALGSGA---GVTVYALPLGTANAWAHSVGLGTPAKALQAFVQGRVHAVPFPLYRARFPSG 268
            L  GA    +++ + P+G+ NAWA S+G+  P K    F++G +   PFPLY+A FP+G
Sbjct: 124 NLPQGAPSANLSILSFPMGSGNAWASSLGIMCPVKTFGQFIRGEMSHSPFPLYKAVFPNG 183

Query: 269 YSIRFFIVLSAGFHANLLHLCNDERYQRLGVERFREASTEILDRYALAEHVRVRAADGSE 328
           YSI FFI+LS GFHANL+H C    YQR+G+E+F+ A + IL  Y L   + V +     
Sbjct: 184 YSIVFFIILSMGFHANLVHACERPEYQRMGIEKFQLAGSVILKEYELDLKITVNS----- 238

Query: 329 QLAGLYAYFALLNTPHLEETYVPSPLSDPLLKQLHVLAFEAELSRDKLNELLMAGYSTIR 388
            LA  Y+YFAL+NTP+LE  Y PSP SDPL ++L++L + + LS+D+    +M GY    
Sbjct: 239 -LAASYSYFALINTPNLEPAYRPSPESDPLKEELYLLGYSSGLSKDQFLTKVMKGYEL-- 295

Query: 389 GSALSAP---GLVYRNLGDSF--TLSIENGASDRVANELCVDGHLLNLVDLQAPGDVFDG 443
           G +   P     +Y      F  TL      S R  +E+C DG LLNL DLQA  +V + 
Sbjct: 296 GPSDKLPLDSDTIYVPFTKGFDVTLDFPLLESPRYKSEICCDGVLLNLQDLQADLEVSNK 355

Query: 444 -SIEVGVVPASFGLKAL 459
            SIE     + F +KA+
Sbjct: 356 FSIEFLNHYSKFNIKAM 372

>KNAG0C06610 Chr3 complement(1282191..1283351) [1161 bp, 386 aa]
           {ON} Anc_5.704
          Length = 386

 Score =  254 bits (648), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 136/329 (41%), Positives = 203/329 (61%), Gaps = 15/329 (4%)

Query: 137 LVVLDSVRSGAGREPATDFYAKVMGPVLAVLSVEHEYVRTSSAASVRELAETFPRTSETT 196
           L+VLDSV SG GR    D    V+ PVL  L   ++ V++ ++ SV E       T   T
Sbjct: 53  LIVLDSVHSGTGRTSGNDITVNVIEPVLRRLHARYQVVKSQNSKSVAEFGNQLDPTQSYT 112

Query: 197 VLVMSGDTTISEFVNALGSG-----AGVTVYALPLGTANAWAHSVGLGTPAKALQAFVQG 251
           +L +SGDT++SEF N +G+G     + +T+  + +GT NA A+S+ L  P +A  +F++G
Sbjct: 113 ILFVSGDTSVSEFFNGVGAGVPSPRSSLTILPIAMGTGNALANSLNLNCPVEAFASFLRG 172

Query: 252 RVHAVPFPLYRARFPSG-YSIRFFIVLSAGFHANLLHLCNDERYQRLGVERFREASTEIL 310
            +    FPLYRA  P G  S+ FFIVLS GFHANLLH   +E+Y+ +GVERF+EAS +IL
Sbjct: 173 ELVTAEFPLYRAILPDGETSVVFFIVLSLGFHANLLHAAENEKYKSMGVERFQEASGDIL 232

Query: 311 DRYALAEHVRVRAADGSEQLAGLYAYFALLNTPHLEETYVPSPLSDPLLKQLHVLAFEAE 370
             Y L E + +      + +AG YAYFAL+N P+LE +Y+PSP SDP   +LH+LA+ + 
Sbjct: 233 QNYKLQEQITL----DKQGVAGSYAYFALVNVPNLEASYIPSPQSDPFKHELHLLAYSSS 288

Query: 371 LSRDKLNELLMAGYSTIRGSALSA-PGLVYRNLGDSFTLSIEN---GASDRVANELCVDG 426
           L+R +L E +MAGY   RG  L+A P   Y+ + + F + ++N   G +D  A ELC+DG
Sbjct: 289 LNRKQLLERIMAGYKNRRGDELTADPYTTYKRISEGFEIKLQNKQEGPNDP-AFELCLDG 347

Query: 427 HLLNLVDLQAPGDVFDGSIEVGVVPASFG 455
            L NL+  ++     + +I+V ++ ++ G
Sbjct: 348 QLYNLLQYKSDQHQEELTIQVELIDSALG 376

>ZYRO0G06556g Chr7 (518731..519870) [1140 bp, 379 aa] {ON} conserved
           hypothetical protein
          Length = 379

 Score =  248 bits (633), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 127/308 (41%), Positives = 189/308 (61%), Gaps = 13/308 (4%)

Query: 137 LVVLDSVRSGAGREPATDFYAKVMGPVLAVLSVEHEYVRTSSAASVRELAETFPRTSETT 196
           L+VLDS++SG GR    DFY+ V+ P+L  L+  H Y++T+S  SV + A++     +  
Sbjct: 51  LIVLDSLKSGIGRTENNDFYSIVIAPILEELNWNHNYIKTTSHDSVSQFAQSLDPLQDYE 110

Query: 197 VLVMSGDTTISEFVNALGSGA----GVTVYALPLGTANAWAHSVGLGTPAKALQAFVQGR 252
           + ++SGDTTISEF N L +       + +  LP+GT NAWA+S+G  +P  A + ++   
Sbjct: 111 IWIISGDTTISEFCNNLPNKKITRNPLRILPLPMGTGNAWANSLGFDSPITAFRNYLNHN 170

Query: 253 VHAVPFPLYRARFPSGYSIRFFIVLSAGFHANLLHLCNDERYQRLGVERFREASTEILDR 312
           +     PLYRA  P+GYSI FF++ S GFHANLLH C D +Y ++G ERF+ A+  IL+ 
Sbjct: 171 LKPRDIPLYRAALPNGYSIIFFMIFSLGFHANLLHACEDPKYAKMGAERFQIAAQSILES 230

Query: 313 YALAEHVRVRAADGSEQLAGLYAYFALLNTPHLEETYVPSPLSDPLLKQLHVLAFEAELS 372
           Y+L   + +   DG   L   YAYFAL+NTP+LE TY PSP S+PL ++L +L + + L 
Sbjct: 231 YSLDLDISL---DG---LRRSYAYFALINTPNLEATYKPSPRSNPLERELRLLGYSSSLG 284

Query: 373 RDKLNELLMAGYSTI-RGSALSAPGLVYRNLGDSFTLSIENGASDRVAN--ELCVDGHLL 429
           R +L E +M GY     G   +   ++Y+++   FTL + +   D   +  E+C DG LL
Sbjct: 285 RQELVEKIMQGYQNKPNGDLPTNEDMIYKSITHDFTLVLNDSLEDSSMHKFEICCDGILL 344

Query: 430 NLVDLQAP 437
           NL+D Q+P
Sbjct: 345 NLLDYQSP 352

>NDAI0E05050 Chr5 complement(1156499..1157854) [1356 bp, 451 aa]
           {ON} Anc_5.704
          Length = 451

 Score =  240 bits (613), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 130/340 (38%), Positives = 190/340 (55%), Gaps = 40/340 (11%)

Query: 137 LVVLDSVRSGAGREPATDFYAKVMGPVLAVLSVEHEYVRTSSAASVRELAETFP-RTSET 195
           L+++DS  SG GR    DFYA +M P+L+ L+++ E  +T+S  S++  A  F  +T +T
Sbjct: 84  LIIIDSTHSGLGRNKENDFYAIIMEPILSKLNIKFELFKTTSKDSIKSFANNFSIKTKDT 143

Query: 196 T-----VLVMSGDTTISEFVNAL------GSGAGVTVYALPLGTANAWAHSVGLGTPAKA 244
           T     ++ +SGDTTISEF N L       S   + +  +P+GTANAW++S+ L  P   
Sbjct: 144 TKIDYNLIFLSGDTTISEFFNNLPPQQPQTSKINLNILTIPMGTANAWSNSLNLNCPIDI 203

Query: 245 LQAFVQGRVHAVPFPLYRARFPSGY-------------SIRFFIVLSAGFHANLLHLC-N 290
            Q F+  ++   PFPLY    P                +I FFIVLS GFHANLLHLC N
Sbjct: 204 FQKFLLNKLTVSPFPLYSLILPHSPSSSSSSGKTGGKNTIYFFIVLSMGFHANLLHLCSN 263

Query: 291 DERYQRLGVERFREASTEILDRYALAEHVRVRAADGSEQ--LAGLYAYFALLNTPHLEET 348
           DE+Y  LG+ERF+ AS EIL  Y L  ++ + + +      L   ++YF L+NTP LE  
Sbjct: 264 DEKYSNLGLERFKLASDEILSNYNLNLNITIESCNDKSHIILNDSFSYFNLMNTPKLEYN 323

Query: 349 YVPSPLSDPLLKQLHVLAFEAE-LSRDKLNELLMAGYSTIRGSA----LSAPGLVYRNLG 403
           Y+PSPLSDPL   LHVLA+++   ++ +L + +M GYS   G      +   G++Y  + 
Sbjct: 324 YIPSPLSDPLKNNLHVLAYKSHPYNKQQLIKNIMKGYSNELGQKNIQNIDEDGIIYFPIN 383

Query: 404 D-SFTLSIENGASDRVAN------ELCVDGHLLNLVDLQA 436
           D  F +++ N +    +       ELC DG L NL++ Q 
Sbjct: 384 DKKFKITLNNPSPISSSLSLSHNYELCCDGMLFNLLNYQT 423

>TPHA0D04620 Chr4 complement(1010489..1011709) [1221 bp, 406 aa]
           {ON} Anc_5.704
          Length = 406

 Score =  237 bits (604), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 123/319 (38%), Positives = 183/319 (57%), Gaps = 22/319 (6%)

Query: 137 LVVLDSVRSGAGREPATDFYAKVMGPVLAVLSVEHEYVRTSSAASVRELAETFPRTSETT 196
           LVV+DS+ SG GR    DFY  VM PV    + +H+Y+RT    S+++LA  F  + + T
Sbjct: 60  LVVIDSICSGVGRTGQNDFYNNVMKPVFKEANFKHKYIRTEGEDSIKDLATKFEASKDYT 119

Query: 197 VLVMSGDTTISEFVNALG------------SGAGVTVYALPLGTANAWAHSVGLGTPAKA 244
           ++ +SGDT++SEF+N L             +   + ++ +PLGT NA A S+ L +P + 
Sbjct: 120 IIFLSGDTSVSEFINNLTKVQKENFISCSENKRQMNIFTIPLGTGNALASSIHLSSPHQV 179

Query: 245 LQAFVQGRVHAVPFPLYRARFPSGYSIRFFIVLSAGFHANLLHLCNDERYQRLGVERFRE 304
            Q F+   +    FPLY    P+  +I FFI+ S GFHANLLH C+ + YQ++G ERF +
Sbjct: 180 FQKFLNNELIIKDFPLYTVTLPNKKTIIFFIIFSMGFHANLLHACDSDEYQKMGTERFAK 239

Query: 305 ASTEILDRYALAEHVRVRAADGSEQLAGLYAYFALLNTPHLEETYVPSPLSDPLLKQLHV 364
           AS  I   Y L  ++ +   +GSE ++  YAYFA++NTP+LE  Y+PSP SD    +LH+
Sbjct: 240 ASENIFKNYDL--NIGLTTKNGSESISRNYAYFAIINTPNLELNYMPSPDSDVFKNELHL 297

Query: 365 LAFEAELSRDKLNELLMAGYS-TIRGSALSAPGLVYR---NL-GDSFTLSIENGASDRVA 419
           L ++A LS +KL   +MAGYS   R    +   L Y    NL G    + +E  +  ++ 
Sbjct: 298 LGYDASLSTEKLVNKIMAGYSYKEREKINNKDNLTYYYPVNLSGTGLQIILETDSDKKLE 357

Query: 420 N---ELCVDGHLLNLVDLQ 435
               ++C DG LLNL D+ 
Sbjct: 358 KYKYDICCDGLLLNLDDIN 376

>KAFR0H00200 Chr8 (25900..27069) [1170 bp, 389 aa] {ON} Anc_5.704
          Length = 389

 Score =  235 bits (599), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 116/309 (37%), Positives = 185/309 (59%), Gaps = 15/309 (4%)

Query: 137 LVVLDSVRSGAGREPATDFYAKVMGPVLAVLSVEHEYVRTSSAASVRELAETFPRTSETT 196
           +VV+DSV SG GR     FY  V+ P+  +  ++H Y +T+   S+   A++   +   T
Sbjct: 55  VVVIDSVSSGTGRNKNNHFYNIVIKPIFDIFKIQHHYFKTTGPKSISTYAKSLDLSKSYT 114

Query: 197 VLVMSGDTTISEFVNAL--------GSGAGVTVYALPLGTANAWAHSVGLGTPAKALQAF 248
           V+ +SGDT+ISEF+N L        G    +++  LP+GT NA++ S+G   P + L +F
Sbjct: 115 VIFISGDTSISEFINNLPPLLETSNGLKHTISILPLPMGTGNAFSSSIGHKCPIQTLSSF 174

Query: 249 VQGRVHAVPFPLYRARFPSGYSIRFFIVLSAGFHANLLHLC-NDERYQRLGVERFREAST 307
           +  R     FPLY   FP+G ++ FFI+LS G HAN+LHLC ND +Y++ G ERF+ A  
Sbjct: 175 LHNRTQPSHFPLYEVIFPNGKTVIFFIILSLGLHANVLHLCENDPQYKKYGEERFKLAFE 234

Query: 308 EILDRYALAEHVRVRAADGSEQLAGLYAYFALLNTPHLEETYVPSPLSDPLLKQLHVLAF 367
           +++  Y L   +++   D    L+G ++YF L+NTP+LE +Y+PSPLSDP L+QLHVL +
Sbjct: 235 KVMTTYDLNVRLQIPELD----LSGAFSYFILINTPNLESSYIPSPLSDPFLEQLHVLGY 290

Query: 368 EAELSRDKLNELLMAGYSTIRGSAL-SAPGLVYRNLGDSFTLSI-ENGASDRVANELCVD 425
            + L+ + L   +  GYS   G  L  +  +VY+ +  + ++ + E+  S++   ++C D
Sbjct: 291 SSSLNNEDLLNYVTQGYSNKLGDELVESSNMVYKPISRNVSIVLTEDEESEKYKYDICCD 350

Query: 426 GHLLNLVDL 434
           G L NL D+
Sbjct: 351 GLLFNLRDM 359

>NCAS0A03190 Chr1 (626695..627891) [1197 bp, 398 aa] {ON} Anc_5.704
          Length = 398

 Score =  231 bits (588), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 121/317 (38%), Positives = 174/317 (54%), Gaps = 16/317 (5%)

Query: 137 LVVLDSVRSGAGREPATDFYAKVMGPVLAVLSVEHEYVRTSSAASVRELAETFPRTSETT 196
           L+V+DS+ SG GR    DFY  VM P+   L++ H  V+T+S  SV   A     T    
Sbjct: 58  LIVIDSIHSGGGRTSDNDFYRNVMEPIFIKLNLTHLLVKTTSKDSVENFASKLDLTKHYE 117

Query: 197 VLVMSGDTTISEFVNAL--------GSGAGVTVYALPLGTANAWAHSVGLGTPAKALQAF 248
           +  +SGDTTISEF+N L         +   +++   P GT NA A+S+GL  P      +
Sbjct: 118 IFFLSGDTTISEFINGLPKQSLDVNDAKNSLSILPFPFGTGNALANSLGLTCPTTIFSNY 177

Query: 249 VQGRVHAVPFPLYRARFPSGYSIRFFIVLSAGFHANLLHLCNDERYQRLGVERFREASTE 308
           +        FPLY+A FP+G  I FF++LS GFHANLLH C    Y++LGVERFR AS +
Sbjct: 178 LTSNYSINNFPLYKAIFPNGNEIVFFVILSLGFHANLLHCCEAPHYKKLGVERFRIASED 237

Query: 309 ILDRYALAEHVRVRAADGSEQLAGL--YAYFALLNTPHLEETYVPSPLSDPLLKQLHVLA 366
           IL  Y L  ++ + +  G   +     Y+YF ++NTP LE  Y+PSP S+PL  QLH++A
Sbjct: 238 ILANYDLDLNISIESPRGLSPIVPSREYSYFVVVNTPKLEAKYIPSPQSNPLRSQLHIIA 297

Query: 367 FEAELSRDKLNELLMAGYSTIRGSALSAPGLVYRNLGDSFTLSI----ENGASDRVANEL 422
           + + L +D+L   ++ GY    G  ++  G+ Y  + D+F + +    E   S +   +L
Sbjct: 298 YSSSLPKDELMARILKGYENNIGDVVNNTGVTYLPIEDNFIIKLNYSQEYSPSSKF--QL 355

Query: 423 CVDGHLLNLVDLQAPGD 439
           C DG L NL D     D
Sbjct: 356 CCDGLLFNLNDFIHKND 372

>CAGL0G02519g Chr7 complement(228822..229958) [1137 bp, 378 aa] {ON}
           similar to KLLA0A00550g Kluyveromyces lactis
          Length = 378

 Score =  226 bits (575), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 124/359 (34%), Positives = 197/359 (54%), Gaps = 17/359 (4%)

Query: 95  ELFCKEGLEYAVAELWEEGKLRSVELAVXXXXXXX---XXXXXXXLVVLDSVRSGAGREP 151
           EL    G++Y+V  +  +GK+ S +L                   ++V+DSV+SG  R  
Sbjct: 6   ELCRNNGIKYSVEIVEVKGKVESYKLIKANDRSTDCFLKFDRDTQIIVIDSVKSGTSRND 65

Query: 152 ATDFYAKVMGPVLAVLSVEHEYVRTSSAASVRELAE--TFPRTSETTVLVMSGDTTISEF 209
            +D Y  V+ P+   L VE++Y++T S  S+R+ A   +F    +  +L +SGDT+ISEF
Sbjct: 66  RSDLYKLVIEPLFQSLGVEYKYIKTESENSIRDFARRTSFQSGFKYDILFLSGDTSISEF 125

Query: 210 VNALGSGA------GVTVYALPLGTANAWAHSVGLGTPAKALQAFVQGRVHAVPFPLYRA 263
           +NAL +         +++  +PLG+ NA A S+G  TP +AL  ++       P PLY A
Sbjct: 126 INALDTTILRSAKYRISILPVPLGSGNALATSLGFKTPLQALITYLNSNKKCSPLPLYDA 185

Query: 264 RFPSGYSIRFFIVLSAGFHANLLHLCNDERYQRLGVERFREASTEILDRYALAEHVRVRA 323
           + P+  S+ FFI+LS GFHANLLH   D +Y+ +GVERF+ AS  + + Y L   + V  
Sbjct: 186 QLPNSTSMIFFIILSLGFHANLLHCAEDPKYKSMGVERFQVASKTVFESYDLNVGIAVNG 245

Query: 324 ADGSEQLAGLYAYFALLNTPHLEETYVPSPLSDPLLKQLHVLAFEAELSRDKLNELLMAG 383
                     Y+YFA++  P+LE TY PSP S  L K+LH+L ++A +  + L + +M G
Sbjct: 246 LQSQS-----YSYFAVIAAPNLEPTYKPSPKSSVLKKELHILGYKAGICLEDLQDKIMRG 300

Query: 384 YSTIRGSALSAPGLVYRNLGDSFTLSIENG-ASDRVANELCVDGHLLNLVDLQAPGDVF 441
           Y    G  +   G +Y+    +  LSI+ G  + +   ++C+DG+LLNL D  +  + +
Sbjct: 301 YHNKDGEDIQEIGTIYQCFQKNLELSIKTGHNAPKYRYDMCIDGYLLNLEDCNSKDNEY 359

>Kpol_YGOB_Anc_5.704 s2001 complement(209387..210010) [624 bp, 207
           aa] {ON} ANNOTATED BY YGOB -
          Length = 207

 Score =  115 bits (287), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 72/206 (34%), Positives = 110/206 (53%), Gaps = 15/206 (7%)

Query: 263 ARFPSGYSIRFFIVLSAGFHANLLHLCNDERYQRLGVERFREASTEILDRYALAEHVRVR 322
           A FP    I FFI+LS GFHA LLH C+     ++G ERF+ A+ EIL+ Y L  +++V 
Sbjct: 2   ATFPDDSRIYFFIILSLGFHATLLHACSRPELLKMGTERFQLAAKEILETYDLDLNIKVN 61

Query: 323 AADGSEQLAGLYAYFALLNTPHLEETYVPSPLSDPLLKQLHVLAFEAELSRDKLNELLMA 382
            +         YAYFA++NT +LE TY PSP S+ L   L +L + ++LSR +L + +M 
Sbjct: 62  KS------TRRYAYFAIINTSNLELTYCPSPKSNVLENSLQLLGYSSKLSRAELVDKIMK 115

Query: 383 GYSTIRGSALSAPGLVYRNLGDSFTLSIENGASDRVAN------ELCVDGHLLNLVDLQA 436
           GY   +G  +      Y    D     I+    +++ N      E+C DG LL+L++ ++
Sbjct: 116 GYIIRKGDVIKTDEYTYYETLDLSQSGIDIIVDEKMNNSNTHKFEICCDGLLLDLME-KS 174

Query: 437 PGDVFDGSIEVGVVPA--SFGLKALV 460
            G   + +I +  V    SF L+ L 
Sbjct: 175 KGRTDNLTIHINSVKDYLSFDLQVLT 200

>NDAI0K02870 Chr11 complement(648772..650760) [1989 bp, 662 aa] {ON}
           Anc_6.48 YLR260W
          Length = 662

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 21/104 (20%), Positives = 47/104 (45%), Gaps = 7/104 (6%)

Query: 139 VLDSVRSGAGREPATDFYAKVMGPVLAVLSVEHEYVRTSSAASVRELAETFPRTSETTVL 198
           +L  +    G+  A+  + K   P+L+  + + E + T+ ++   ++A++   +    + 
Sbjct: 263 ILIIINPHGGKGKASKLFNKWSKPILSTSNCKFEIINTTYSSHATDIAKSLDISKYDIIA 322

Query: 199 VMSGDTTISEFVNAL-------GSGAGVTVYALPLGTANAWAHS 235
             SGD    E +N L        +   +T+  +P G+ NA + S
Sbjct: 323 CASGDGIPYEVINGLYQRPDRVDAFNKLTITQIPCGSGNAMSIS 366

>Ecym_3138 Chr3 complement(255001..256767) [1767 bp, 588 aa] {ON}
           similar to Ashbya gossypii AGR256W
          Length = 588

 Score = 32.0 bits (71), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 44/121 (36%), Gaps = 8/121 (6%)

Query: 139 VLDSVRSGAGREPATDFYAKVMGPVLAVLSVEHEYVRTSSAASVRELAETFPRTSETTVL 198
           +L  +    GR  A   Y     P+L       E  +TS      E+A T        + 
Sbjct: 203 ILVIINPHGGRGRANKIYVTKAKPILIASGCYVEVFQTSYPEHAIEIARTMDIDKYDVIA 262

Query: 199 VMSGDTTISEFVNAL-------GSGAGVTVYALPLGTANAWAHSV-GLGTPAKALQAFVQ 250
             SGD    E +N L        +   V V  LP G+ NA + S  G   PA A  + V+
Sbjct: 263 CASGDGIPYEVLNGLYRREDRAKAFNKVAVTQLPCGSGNAMSVSCHGTNNPAYAALSLVK 322

Query: 251 G 251
            
Sbjct: 323 A 323

>CAGL0L04554g Chr12 complement(526735..528417) [1683 bp, 560 aa]
           {ON} similar to uniprot|Q12246 Saccharomyces cerevisiae
           YOR171c LCB4
          Length = 560

 Score = 30.8 bits (68), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 24/104 (23%), Positives = 40/104 (38%), Gaps = 7/104 (6%)

Query: 139 VLDSVRSGAGREPATDFYAKVMGPVLAVLSVEHEYVRTSSAASVRELAETFPRTSETTVL 198
           +L  +    G+  A   + K + P+L       E + T  +    ++A         T+ 
Sbjct: 170 ILVIINPHGGKGKAMHIFKKRIEPILIASECSFELMETKYSRHATDIAREIDLEEFDTIA 229

Query: 199 VMSGDTTISEFVNAL-------GSGAGVTVYALPLGTANAWAHS 235
             SGD    E +N L        +   +TV  LP G+ NA + S
Sbjct: 230 CASGDGVPYEVINGLYMREDKVDAFNKITVTQLPCGSGNAMSIS 273

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 38,276,988
Number of extensions: 1378644
Number of successful extensions: 2948
Number of sequences better than 10.0: 19
Number of HSP's gapped: 3010
Number of HSP's successfully gapped: 19
Length of query: 465
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 352
Effective length of database: 40,524,141
Effective search space: 14264497632
Effective search space used: 14264497632
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)