Re-run this search with the SEG filter switched off

Re-run this search as BLASTP i.e. protein query (default)

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AFR288C5.704ON46546520920.0
SAKL0E14960g5.704ON3843357175e-90
KLTH0E01012g5.704ON3863376662e-82
KLLA0A00550g5.704ON3803006313e-77
KNAG0C066105.704ON3863296305e-77
Kwal_55.196885.704ON3933346306e-77
TDEL0B021605.704ON3753756156e-75
ZYRO0G06556g5.704ON3793086001e-72
KAFR0H002005.704ON3893095574e-66
NCAS0A031905.704ON3983095559e-66
TPHA0D046205.704ON4063185542e-65
CAGL0G02519g5.704ON3783515452e-64
NDAI0E050505.704ON4513395423e-63
Kpol_YGOB_Anc_5.7045.704ON2071772743e-27
ZYRO0F02750gsingletonON15943161135e-05
TBLA0F00120singletonON6772741125e-05
KLTH0D03894g4.60ON7063701117e-05
KLTH0A00550gsingletonON12883691101e-04
TBLA0D00480singletonON12543561082e-04
Kwal_33.13192na 1ON7993491029e-04
Suva_3.1256.367ON16652971010.001
ZYRO0C03432g3.11ON21963651000.002
Suva_7.2964.150ON1135322990.002
Kpol_1058.5na 2ON1256294990.002
TBLA0A10760singletonON2329357990.002
KLTH0C09196g3.78ON439219970.003
YIR019C (MUC1)na 3ON1367356980.003
NCAS0F02620singletonON1308363970.004
ZYRO0F02728gna 4ON2302358970.004
KAFR0A04720singletonON639265950.006
NCAS0A07310singletonON677129950.006
Skud_14.3766.367ON725149940.008
Kwal_23.5441singletonON830383920.014
TDEL0E040305.225ON775268900.024
NCAS0H02190singletonON1029349900.025
Suva_10.17singletonON1061287880.043
ZYRO0D17380g6.367ON1382304880.045
KNAG0C032605.524ON1530219880.045
Kwal_26.74844.60ON434322870.045
NCAS0A055306.367ON44995870.046
Suva_8.234.20ON601191870.051
Smik_14.3746.367ON691141860.069
SAKL0D09944gna 5ON1352146860.077
ZYRO0A12100g4.159ON538275850.086
Ecym_62154.20ON563133850.087
YJR151C (DAN4)na 6ON1161221850.100
KLTH0E05940g4.20ON556146840.11
YNL176C (TDA7)2.79ON636334840.12
YJL078C (PRY3)1.292ON881248840.13
ZYRO0G11242g4.150ON1487393840.13
TPHA0F006104.89ON606262830.15
Smik_63.1singletonON331158820.16
YMR317Wna 7ON1140341830.17
TDEL0C00460na 4ON1652211830.18
KLTH0F01254gna 8ON580165820.20
ZYRO0G07942g4.20ON775282820.21
ZYRO0C02398g3.56ON353102810.22
NCAS0G02800singletonON928350820.22
KLTH0D05698g2.485ON703138810.28
KLTH0H09218gna 9ON707112810.28
Kwal_55.206274.20ON577267800.35
NDAI0A07890singletonON665111800.36
ZYRO0G14894g8.201ON1025119790.51
Suva_14.3996.367ON727111780.64
Skud_12.4234.168ON792120780.65
NDAI0B00230singletonON944338780.66
Smik_7.3024.150ON1189150780.68
Suva_3.1056.333ON1225109780.68
NCAS0B00350singletonON429133770.73
ZYRO0A12386g4.168ON743141720.83
YNR044W (AGA1)6.367ON725189770.84
Kwal_26.78142.485ON992345770.88
CAGL0G10175gsingletonON577126761.1
TBLA0H00500singletonON654242761.1
YJL225CsingletonON1758142761.2
YIL177CsingletonON1758142761.2
Suva_4.214na 10ON58183751.4
TDEL0G00100singletonON762273751.5
YBL113CsingletonON792112751.5
Suva_11.2451.291ON336114741.5
Kpol_1028.206.367ON1142306751.5
Suva_10.4284.159ON380109741.6
Suva_6.1singletonON15197711.8
Suva_15.603.78ON54898741.8
AFR473Wna 9ON866101742.0
ACL104C5.406ON947138742.0
KLTH0E08844g4.150ON1520247742.1
KLLA0E01035gsingletonON1878105742.1
ZYRO0G05104g2.90ON467278732.3
Kwal_55.19510singletonON27493722.4
Smik_13.534na 7ON1086120732.7
Kwal_22.2754singletonON41193722.9
Kwal_44.16506singletonON48493723.0
Kpol_1058.6singletonON567101723.2
TBLA0G012904.168ON71579623.7
YIL123W (SIM1)2.239ON476127714.0
Skud_12.3138.408ON478105714.0
YOR009W (TIR4)na 11ON487162714.0
KLTH0B02860g5.225ON828115714.5
SAKL0F03410gna 12ON323104704.6
Kwal_23.64416.367ON1104276714.6
Ecym_73494.150ON1129111714.6
KLTH0H09834g1.292ON362121704.8
Ecym_56685.15ON408115705.0
KLLA0B09746g8.515ON457106705.2
Agos_YGOB_Anc_6.916.91ON25430695.4
Skud_8.164.20ON585104705.5
Kpol_206.17.98ON590107705.5
NDAI0K028706.48ON662104705.7
KLTH0B06556g2.90ON300113695.9
Skud_9.200na 13ON301116695.9
Kwal_56.247055.77ON20157686.0
Skud_11.1852.564ON36367696.4
KAFR0J011102.256ON430201696.8
Smik_7.3094.159ON54787697.2
CAGL0L04554g6.48ON560104697.2
Ecym_31386.48ON588120697.3
YHL028W (WSC4)4.20ON605155697.3
Suva_6.1511.291ON287138687.6
Smik_4.3158.201ON315102688.0
NCAS0E025507.401ON144387698.2
Smik_9.462.239ON48092689.2
Skud_4.7395.586ON51478689.3
KAFR0A048906.80ON58383689.6
NDAI0G026208.318ON59098689.6
CAGL0J11176g2.79ON62995689.7
BLASTX 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= AFR288C
         (1398 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR288C Chr6 complement(958787..960184) [1398 bp, 465 aa] {ON} N...   810   0.0  
SAKL0E14960g Chr5 complement(1244456..1245610) [1155 bp, 384 aa]...   280   5e-90
KLTH0E01012g Chr5 (96295..97455) [1161 bp, 386 aa] {ON} conserve...   261   2e-82
KLLA0A00550g Chr1 (50099..51241) [1143 bp, 380 aa] {ON} conserve...   247   3e-77
KNAG0C06610 Chr3 complement(1282191..1283351) [1161 bp, 386 aa] ...   247   5e-77
Kwal_55.19688 s55 (79793..80974) [1182 bp, 393 aa] {ON} [contig ...   247   6e-77
TDEL0B02160 Chr2 (384824..385951) [1128 bp, 375 aa] {ON} Anc_5.704    241   6e-75
ZYRO0G06556g Chr7 (518731..519870) [1140 bp, 379 aa] {ON} conser...   235   1e-72
KAFR0H00200 Chr8 (25900..27069) [1170 bp, 389 aa] {ON} Anc_5.704      219   4e-66
NCAS0A03190 Chr1 (626695..627891) [1197 bp, 398 aa] {ON} Anc_5.704    218   9e-66
TPHA0D04620 Chr4 complement(1010489..1011709) [1221 bp, 406 aa] ...   218   2e-65
CAGL0G02519g Chr7 complement(228822..229958) [1137 bp, 378 aa] {...   214   2e-64
NDAI0E05050 Chr5 complement(1156499..1157854) [1356 bp, 451 aa] ...   213   3e-63
Kpol_YGOB_Anc_5.704 s2001 complement(209387..210010) [624 bp, 20...   110   3e-27
ZYRO0F02750g Chr6 (229681..234465) [4785 bp, 1594 aa] {ON} some ...    48   5e-05
TBLA0F00120 Chr6 (10892..12925) [2034 bp, 677 aa] {ON}                 48   5e-05
KLTH0D03894g Chr4 (376254..378374) [2121 bp, 706 aa] {ON} some s...    47   7e-05
KLTH0A00550g Chr1 complement(49572..53438) [3867 bp, 1288 aa] {O...    47   1e-04
TBLA0D00480 Chr4 (118608..122372) [3765 bp, 1254 aa] {ON}              46   2e-04
Kwal_33.13192 s33 complement(114016..116415) [2400 bp, 799 aa] {...    44   9e-04
Suva_3.125 Chr3 (184846..189843) [4998 bp, 1665 aa] {ON} YCR089W...    44   0.001
ZYRO0C03432g Chr3 complement(266809..273399) [6591 bp, 2196 aa] ...    43   0.002
Suva_7.296 Chr7 (508904..512311) [3408 bp, 1135 aa] {ON} YGR014W...    43   0.002
Kpol_1058.5 s1058 complement(24653..28423) [3771 bp, 1256 aa] {O...    43   0.002
TBLA0A10760 Chr1 complement(2665056..2672045) [6990 bp, 2329 aa]...    43   0.002
KLTH0C09196g Chr3 complement(763731..765050) [1320 bp, 439 aa] {...    42   0.003
YIR019C Chr9 complement(389572..393675) [4104 bp, 1367 aa] {ON} ...    42   0.003
NCAS0F02620 Chr6 complement(530092..534018) [3927 bp, 1308 aa] {...    42   0.004
ZYRO0F02728g Chr6 (220410..227318) [6909 bp, 2302 aa] {ON} some ...    42   0.004
KAFR0A04720 Chr1 (934307..936226) [1920 bp, 639 aa] {ON}               41   0.006
NCAS0A07310 Chr1 complement(1450943..1452976) [2034 bp, 677 aa] ...    41   0.006
Skud_14.376 Chr14 (671851..672391,672515..672544,672671..672796,...    41   0.008
Kwal_23.5441 s23 (1160364..1162853) [2490 bp, 830 aa] {ON} YIR01...    40   0.014
TDEL0E04030 Chr5 (751781..754108) [2328 bp, 775 aa] {ON} Anc_5.2...    39   0.024
NCAS0H02190 Chr8 complement(425884..428973) [3090 bp, 1029 aa] {...    39   0.025
Suva_10.17 Chr10 complement(30305..33490) [3186 bp, 1061 aa] {ON...    39   0.043
ZYRO0D17380g Chr4 (1432089..1436237) [4149 bp, 1382 aa] {ON} no ...    39   0.045
KNAG0C03260 Chr3 complement(639021..643613) [4593 bp, 1530 aa] {...    39   0.045
Kwal_26.7484 s26 (384745..386046) [1302 bp, 434 aa] {ON} YKR092C...    38   0.045
NCAS0A05530 Chr1 (1088381..1089730) [1350 bp, 449 aa] {ON}             38   0.046
Suva_8.23 Chr8 (50391..50746,50801..50952,51088..51682,51842..52...    38   0.051
Smik_14.374 Chr14 (661623..663698) [2076 bp, 691 aa] {ON} YNR044...    38   0.069
SAKL0D09944g Chr4 (828689..832747) [4059 bp, 1352 aa] {ON} some ...    38   0.077
ZYRO0A12100g Chr1 (967785..969401) [1617 bp, 538 aa] {ON} some s...    37   0.086
Ecym_6215 Chr6 (403041..404732) [1692 bp, 563 aa] {ON} similar t...    37   0.087
YJR151C Chr10 complement(712255..715740) [3486 bp, 1161 aa] {ON}...    37   0.100
KLTH0E05940g Chr5 (536972..538642) [1671 bp, 556 aa] {ON} some s...    37   0.11 
YNL176C Chr14 complement(305070..306980) [1911 bp, 636 aa] {ON} ...    37   0.12 
YJL078C Chr10 complement(291336..293981) [2646 bp, 881 aa] {ON} ...    37   0.13 
ZYRO0G11242g Chr7 (900370..904833) [4464 bp, 1487 aa] {ON} weakl...    37   0.13 
TPHA0F00610 Chr6 (143599..145419) [1821 bp, 606 aa] {ON} Anc_4.8...    37   0.15 
Smik_63.1 Chr63 (64..1056) [993 bp, 331 aa] {ON}  YOL155C (REAL)       36   0.16 
YMR317W Chr13 (907364..910786) [3423 bp, 1140 aa] {ON} Putative ...    37   0.17 
TDEL0C00460 Chr3 (67471..72429) [4959 bp, 1652 aa] {ON}                37   0.18 
KLTH0F01254g Chr6 (98944..100686) [1743 bp, 580 aa] {ON} some si...    36   0.20 
ZYRO0G07942g Chr7 (642460..644787) [2328 bp, 775 aa] {ON} no sim...    36   0.21 
ZYRO0C02398g Chr3 complement(192168..193229) [1062 bp, 353 aa] {...    36   0.22 
NCAS0G02800 Chr7 (515232..518018) [2787 bp, 928 aa] {ON}               36   0.22 
KLTH0D05698g Chr4 (508215..510326) [2112 bp, 703 aa] {ON} some s...    36   0.28 
KLTH0H09218g Chr8 (793572..795695) [2124 bp, 707 aa] {ON} conser...    36   0.28 
Kwal_55.20627 s55 (496681..498414) [1734 bp, 577 aa] {ON} YOR009...    35   0.35 
NDAI0A07890 Chr1 complement(1811865..1813862) [1998 bp, 665 aa] ...    35   0.36 
ZYRO0G14894g Chr7 (1192893..1195970) [3078 bp, 1025 aa] {ON} som...    35   0.51 
Suva_14.399 Chr14 (684887..685388,685433..685442,685510..685523,...    35   0.64 
Skud_12.423 Chr12 complement(743004..745382) [2379 bp, 792 aa] {...    35   0.65 
NDAI0B00230 Chr2 complement(32811..35645) [2835 bp, 944 aa] {ON}       35   0.66 
Smik_7.302 Chr7 (508666..512235) [3570 bp, 1189 aa] {ON} YGR014W...    35   0.68 
Suva_3.105 Chr3 complement(150015..153692) [3678 bp, 1225 aa] {O...    35   0.68 
NCAS0B00350 Chr2 complement(43786..45075) [1290 bp, 429 aa] {ON}       34   0.73 
ZYRO0A12386g Chr1 complement(981181..983412) [2232 bp, 743 aa] {...    32   0.83 
YNR044W Chr14 (703699..705876) [2178 bp, 725 aa] {ON}  AGA1Ancho...    34   0.84 
Kwal_26.7814 s26 (521381..524359) [2979 bp, 992 aa] {ON} YGR189C...    34   0.88 
CAGL0G10175g Chr7 (977483..979216) [1734 bp, 577 aa] {ON} some s...    34   1.1  
TBLA0H00500 Chr8 complement(96289..98253) [1965 bp, 654 aa] {ON}       34   1.1  
YJL225C Chr10 complement(466..4581,4970..6130) [5277 bp, 1758 aa...    34   1.2  
YIL177C Chr9 complement(483..4598,4987..6147) [5277 bp, 1758 aa]...    34   1.2  
Suva_4.214 Chr4 complement(374649..376391) [1743 bp, 581 aa] {ON...    33   1.4  
TDEL0G00100 Chr7 complement(9857..12145) [2289 bp, 762 aa] {ON}        33   1.5  
YBL113C Chr2 complement(280..2658) [2379 bp, 792 aa] {ON} Helica...    33   1.5  
Suva_11.245 Chr11 (447844..448170,448213..448225,448256..448926)...    33   1.5  
Kpol_1028.20 s1028 complement(53777..57205) [3429 bp, 1142 aa] {...    33   1.5  
Suva_10.428 Chr10 (751935..753077) [1143 bp, 380 aa] {ON} YLR332...    33   1.6  
Suva_6.1 Chr6 complement(1..453) [453 bp, 151 aa] {ON}  (NOVEL)        32   1.8  
Suva_15.60 Chr15 complement(93081..94727) [1647 bp, 548 aa] {ON}...    33   1.8  
AFR473W Chr6 (1290077..1290517,1290567..1292726) [2601 bp, 866 a...    33   2.0  
ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON} S...    33   2.0  
KLTH0E08844g Chr5 (804120..808682) [4563 bp, 1520 aa] {ON} some ...    33   2.1  
KLLA0E01035g Chr5 (109821..115457) [5637 bp, 1878 aa] {ON} some ...    33   2.1  
ZYRO0G05104g Chr7 complement(410797..412200) [1404 bp, 467 aa] {...    33   2.3  
Kwal_55.19510 s55 complement(4111..4932) [822 bp, 274 aa] {ON} Y...    32   2.4  
Smik_13.534 Chr13 (890162..893422) [3261 bp, 1086 aa] {ON} YMR31...    33   2.7  
Kwal_22.2754 s22 complement(3903..5135) [1233 bp, 411 aa] {ON} Y...    32   2.9  
Kwal_44.16506 s44 (3436..4890) [1455 bp, 484 aa] {ON} YAR050W (F...    32   3.0  
Kpol_1058.6 s1058 complement(30414..32117) [1704 bp, 567 aa] {ON...    32   3.2  
TBLA0G01290 Chr7 complement(344622..346769) [2148 bp, 715 aa] {O...    28   3.7  
YIL123W Chr9 (128151..129581) [1431 bp, 476 aa] {ON}  SIM1Protei...    32   4.0  
Skud_12.313 Chr12 (559031..560467) [1437 bp, 478 aa] {ON} YLR238...    32   4.0  
YOR009W Chr15 (344335..345798) [1464 bp, 487 aa] {ON}  TIR4Cell ...    32   4.0  
KLTH0B02860g Chr2 (223097..225583) [2487 bp, 828 aa] {ON} some s...    32   4.5  
SAKL0F03410g Chr6 (272918..273889) [972 bp, 323 aa] {ON} no simi...    32   4.6  
Kwal_23.6441 s23 (1584397..1587708) [3312 bp, 1104 aa] {ON} YNL2...    32   4.6  
Ecym_7349 Chr7 complement(722484..725873) [3390 bp, 1129 aa] {ON...    32   4.6  
KLTH0H09834g Chr8 complement(846452..847540) [1089 bp, 362 aa] {...    32   4.8  
Ecym_5668 Chr5 (1358134..1359360) [1227 bp, 408 aa] {ON} similar...    32   5.0  
KLLA0B09746g Chr2 (850402..851775) [1374 bp, 457 aa] {ON} simila...    32   5.2  
Agos_YGOB_Anc_6.91 Chr7 complement(1287909..1288673) [765 bp, 25...    31   5.4  
Skud_8.16 Chr8 (36776..37860,37891..38563) [1758 bp, 585 aa] {ON...    32   5.5  
Kpol_206.1 s206 (199..1971) [1773 bp, 590 aa] {ON} (199..1971) [...    32   5.5  
NDAI0K02870 Chr11 complement(648772..650760) [1989 bp, 662 aa] {...    32   5.7  
KLTH0B06556g Chr2 (528699..529601) [903 bp, 300 aa] {ON} some si...    31   5.9  
Skud_9.200 Chr9 complement(360408..361313) [906 bp, 301 aa] {ON}...    31   5.9  
Kwal_56.24705 s56 (1113032..1113637) [606 bp, 201 aa] {ON} [cont...    31   6.0  
Skud_11.185 Chr11 (336442..337533) [1092 bp, 363 aa] {ON} YKL043...    31   6.4  
KAFR0J01110 Chr10 complement(203049..204341) [1293 bp, 430 aa] {...    31   6.8  
Smik_7.309 Chr7 (520619..522262) [1644 bp, 547 aa] {ON} YGR023W ...    31   7.2  
CAGL0L04554g Chr12 complement(526735..528417) [1683 bp, 560 aa] ...    31   7.2  
Ecym_3138 Chr3 complement(255001..256767) [1767 bp, 588 aa] {ON}...    31   7.3  
YHL028W Chr8 (48763..50580) [1818 bp, 605 aa] {ON}  WSC4ER membr...    31   7.3  
Suva_6.151 Chr6 (260998..261861) [864 bp, 287 aa] {ON} YJL079C (...    31   7.6  
Smik_4.315 Chr4 (567448..568395) [948 bp, 315 aa] {ON} YDR077W (...    31   8.0  
NCAS0E02550 Chr5 (506706..511037) [4332 bp, 1443 aa] {ON} Anc_7....    31   8.2  
Smik_9.46 Chr9 (106005..107447) [1443 bp, 480 aa] {ON} YIL123W (...    31   9.2  
Skud_4.739 Chr4 (1306825..1308369) [1545 bp, 514 aa] {ON} YDR463...    31   9.3  
KAFR0A04890 Chr1 (966960..968711) [1752 bp, 583 aa] {ON} Anc_6.8...    31   9.6  
NDAI0G02620 Chr7 (599890..601662) [1773 bp, 590 aa] {ON}  YGL258W-A    31   9.6  
CAGL0J11176g Chr10 (1088473..1090362) [1890 bp, 629 aa] {ON} som...    31   9.7  

>AFR288C Chr6 complement(958787..960184) [1398 bp, 465 aa] {ON}
            NOHBY633; No homolog in Saccharomyces cerevisiae;
            Methionine is very probably wrong'
          Length = 465

 Score =  810 bits (2092), Expect = 0.0
 Identities = 419/465 (90%), Positives = 419/465 (90%)
 Frame = +1

Query: 1    MRRKRIALPDAAAGREQAHXXXXXXXXXXXXXXXXXCELLVRCRGRARHWVHTVCGPLXX 180
            MRRKRIALPDAAAGREQAH                 CELLVRCRGRARHWVHTVCGPL  
Sbjct: 1    MRRKRIALPDAAAGREQAHARRYQRGARTRTGRGGGCELLVRCRGRARHWVHTVCGPLVS 60

Query: 181  XXXXXXXXXXXXXKKCGRRGRQETGVAAGDMKETELFCKEGLEYAVAELWEEGKLRSVEL 360
                         KKCGRRGRQETGVAAGDMKETELFCKEGLEYAVAELWEEGKLRSVEL
Sbjct: 61   SVAAMAARGSRAAKKCGRRGRQETGVAAGDMKETELFCKEGLEYAVAELWEEGKLRSVEL 120

Query: 361  AVXXXXXXXXXXXXXXLVVLDSVRSGAGREPATDFYAKVMGPVLAVLSVEHEYVRTSSAA 540
            AV              LVVLDSVRSGAGREPATDFYAKVMGPVLAVLSVEHEYVRTSSAA
Sbjct: 121  AVREGRGAEARAPGGPLVVLDSVRSGAGREPATDFYAKVMGPVLAVLSVEHEYVRTSSAA 180

Query: 541  SVRELAETFPRTSETTVLVMSGDTTISEFVNALGSGAGVTVYALPLGTANAWAHSVGLGT 720
            SVRELAETFPRTSETTVLVMSGDTTISEFVNALGSGAGVTVYALPLGTANAWAHSVGLGT
Sbjct: 181  SVRELAETFPRTSETTVLVMSGDTTISEFVNALGSGAGVTVYALPLGTANAWAHSVGLGT 240

Query: 721  PAKALQAFVQGRVHAVPFPLYRARFPSGYSIRFFIVLSAGFHANLLHLCNDERYQRLGVE 900
            PAKALQAFVQGRVHAVPFPLYRARFPSGYSIRFFIVLSAGFHANLLHLCNDERYQRLGVE
Sbjct: 241  PAKALQAFVQGRVHAVPFPLYRARFPSGYSIRFFIVLSAGFHANLLHLCNDERYQRLGVE 300

Query: 901  RFREASTEILDRYALAEHVRVRAADGSEQLAGLYAYFALLNTPHLEETYVPSPLSDPLLK 1080
            RFREASTEILDRYALAEHVRVRAADGSEQLAGLYAYFALLNTPHLEETYVPSPLSDPLLK
Sbjct: 301  RFREASTEILDRYALAEHVRVRAADGSEQLAGLYAYFALLNTPHLEETYVPSPLSDPLLK 360

Query: 1081 QLHVLAFEAELSRDKLNELLMAGYSTIRGSALSAPGLVYRNLGDSFTLSIENGASDRVAN 1260
            QLHVLAFEAELSRDKLNELLMAGYSTIRGSALSAPGLVYRNLGDSFTLSIENGASDRVAN
Sbjct: 361  QLHVLAFEAELSRDKLNELLMAGYSTIRGSALSAPGLVYRNLGDSFTLSIENGASDRVAN 420

Query: 1261 ELCVDGHLLNLVDLQAPGDVFDGSIEVGVVPASFGLKALVPAHIS 1395
            ELCVDGHLLNLVDLQAPGDVFDGSIEVGVVPASFGLKALVPAHIS
Sbjct: 421  ELCVDGHLLNLVDLQAPGDVFDGSIEVGVVPASFGLKALVPAHIS 465

>SAKL0E14960g Chr5 complement(1244456..1245610) [1155 bp, 384 aa] {ON}
            conserved hypothetical protein
          Length = 384

 Score =  280 bits (717), Expect = 5e-90
 Identities = 146/335 (43%), Positives = 209/335 (62%), Gaps = 9/335 (2%)
 Frame = +1

Query: 409  LVVLDSVRSGAGREPATDFYAKVMGPVLAVLSVEHEYVRTSSAASVRELAETFPRTSETT 588
            L++LDSV SG GR+   DF  +V+ P+L  L  EH+ ++T S+ S+ E A     +   T
Sbjct: 55   LIILDSVMSGIGRKTQADFSTQVIKPILEKLGAEHKIIKTQSSTSIAEFAREIEPSKSYT 114

Query: 589  VLVMSGDTTISEFVNAL-----GSGAGVTVYALPLGTANAWAHSVGLGTPAKALQAFVQG 753
            ++ +SGDT+ISEF+N +      S   + +Y +P+GT NAWA S+ L  P ++ Q F++ 
Sbjct: 115  IIFLSGDTSISEFLNHIPTQNSNSKHALNIYPIPMGTGNAWASSLNLKCPVESFQKFLKN 174

Query: 754  RVHAVPFPLYRARFPSGYSIRFFIVLSAGFHANLLHLCNDERYQRLGVERFREASTEILD 933
             + A  FPLYRA FP+GYS  FFI+LS GFHANLLHLCN  +Y+ +GVERF+ AS +I  
Sbjct: 175  DLIASKFPLYRASFPNGYSTIFFIILSIGFHANLLHLCNHSKYKVMGVERFKAASAQIFK 234

Query: 934  RYALAEHVRVRAADGSEQLAGLYAYFALLNTPHLEETYVPSPLSDPLLKQLHVLAFEAEL 1113
             Y L   V +       +++G YAYFA++NTP+LE TY PSPLSDPL   LH+L FE+ L
Sbjct: 235  NYDLKYKVSI-----PNRVSGCYAYFAIINTPNLEPTYKPSPLSDPLTSALHLLGFESSL 289

Query: 1114 SRDKLNELLMAGYSTIRGSALSAPGLVYRNLGDSFTLSIEN--GASDRVANELCVDGHLL 1287
               +L + +  G +  +G  +   G++Y  L   F + +E+   ASDR+  E+C DG LL
Sbjct: 290  KSSELIKRITRGRTAQKGDDIMDTGVIYEKLEKDFDIVVEHSPSASDRIKFEICCDGQLL 349

Query: 1288 NLVDLQAPGDVFDGSIEVGVVP--ASFGLKALVPA 1386
            NL+D+Q     FDG+I+V  +   + F LK L PA
Sbjct: 350  NLLDMQGTEGSFDGTIKVSFLQDYSPFNLKVLSPA 384

>KLTH0E01012g Chr5 (96295..97455) [1161 bp, 386 aa] {ON} conserved
            hypothetical protein
          Length = 386

 Score =  261 bits (666), Expect = 2e-82
 Identities = 141/337 (41%), Positives = 209/337 (62%), Gaps = 12/337 (3%)
 Frame = +1

Query: 409  LVVLDSVRSGAGREPATDFYAKVMGPVLAVLSVEHEYVRTSSAASVRELAETFPRTSETT 588
            ++++DS++SG GR+   +F   V+ P+  +L + H+ VRT  + +  +L  TF  ++E T
Sbjct: 56   ILIVDSIKSGTGRDSRNNFGKNVLEPLFTLLGIPHKVVRTQDSDAAGQLGHTFQPSTENT 115

Query: 589  VLV-MSGDTTISEFVNAL------GSGAGVTVYALPLGTANAWAHSVGLGTPAKALQAFV 747
            +L+ +SGDTTISEF+N L      G    +++  LPLGT NAWA+S+GL  PA +L  F+
Sbjct: 116  ILIFLSGDTTISEFLNGLNRRVFEGLRHTLSLVPLPLGTGNAWANSLGLRCPAASLSCFL 175

Query: 748  QGRVHAVPFPLYRARFPSGYSIRFFIVLSAGFHANLLHLCNDERYQRLGVERFREASTEI 927
            QG++    FPLY+A FP+G+ + FFI+LS GFHANLLHLC  +R+Q LGVERF+ AS EI
Sbjct: 176  QGQLTPRKFPLYKATFPNGFEMIFFIILSIGFHANLLHLCKQQRFQSLGVERFKIASLEI 235

Query: 928  LDRYALAEHVRVRAADGSEQLAGLYAYFALLNTPHLEETYVPSPLSDPLLKQLHVLAFEA 1107
            L +Y L   ++V      +     Y+YFAL+NTP+LE +Y PSP S+ L  QLHVL + +
Sbjct: 236  LQKYPLEYRLQVSGLPTRD-----YSYFALINTPNLEASYKPSPQSNSLHFQLHVLGYSS 290

Query: 1108 ELSRDKLNELLMAGYSTIRGSALSAPGLVYRNLGDSFTLSIENGASDRVAN---ELCVDG 1278
            +L +  L   +M GYS   G  +S  G++Y     +  +  +    + V+N   E+C DG
Sbjct: 291  KLQQASLVSKIMKGYSNRAGDDISGDGVIYEPYNHALEVVFDQ-VPENVSNTYFEICCDG 349

Query: 1279 HLLNLVDLQAPGDVFDGSIEVGVVP--ASFGLKALVP 1383
            HLLN++ LQ     FDG I +  +   +SF L  +VP
Sbjct: 350  HLLNMLSLQPQDQKFDGRIRIQFLKNFSSFELNVMVP 386

>KLLA0A00550g Chr1 (50099..51241) [1143 bp, 380 aa] {ON} conserved
            hypothetical protein
          Length = 380

 Score =  247 bits (631), Expect = 3e-77
 Identities = 133/300 (44%), Positives = 187/300 (62%), Gaps = 1/300 (0%)
 Frame = +1

Query: 409  LVVLDSVRSGAGREPATDFYAKVMGPVLAVLSVEHEYVRTSSAASVRELAETFPRTSETT 588
            L+++DSV SG+GR+   DF   V+      + V +  ++T+S +SV ELA +   T + T
Sbjct: 61   LLIVDSVFSGSGRDKDCDFATNVIAQFFEQVIVPYRLIKTTSKSSVIELASSIDSTRQYT 120

Query: 589  VLVMSGDTTISEFVNALGSGAG-VTVYALPLGTANAWAHSVGLGTPAKALQAFVQGRVHA 765
            VL +SGDT+ISEFVN L      ++V   P+GT NAWA S+ L  PA     FV G++  
Sbjct: 121  VLFLSGDTSISEFVNNLPLNHDCISVLPFPMGTGNAWASSLKLMDPAVIFSQFVNGKLSC 180

Query: 766  VPFPLYRARFPSGYSIRFFIVLSAGFHANLLHLCNDERYQRLGVERFREASTEILDRYAL 945
              FPLYRA F +GY ++FFI+LS GFHANLLHLC ++ YQ++G+ERFR AS  IL  Y L
Sbjct: 181  NDFPLYRATFDNGYVLKFFIILSLGFHANLLHLCEEDEYQKMGIERFRVASQRILREYKL 240

Query: 946  AEHVRVRAADGSEQLAGLYAYFALLNTPHLEETYVPSPLSDPLLKQLHVLAFEAELSRDK 1125
               V +      + L G ++YFAL+NT +LE TY+PSP SDPL  QLHVLA+++ L R +
Sbjct: 241  ESRVSI-----PDILEGSFSYFALINTTNLEPTYMPSPDSDPLESQLHVLAYQSSLDRVE 295

Query: 1126 LNELLMAGYSTIRGSALSAPGLVYRNLGDSFTLSIENGASDRVANELCVDGHLLNLVDLQ 1305
              + +  GYS  + S +   G  YR L   F + + +  S +   E+C DG LLNL++L+
Sbjct: 296  FQKRVFMGYSNTKHSNILQNGTFYRPLPFCFNVEVLDDPSQKSNFEVCCDGQLLNLLELE 355

>KNAG0C06610 Chr3 complement(1282191..1283351) [1161 bp, 386 aa] {ON}
            Anc_5.704
          Length = 386

 Score =  247 bits (630), Expect = 5e-77
 Identities = 136/329 (41%), Positives = 203/329 (61%), Gaps = 10/329 (3%)
 Frame = +1

Query: 409  LVVLDSVRSGAGREPATDFYAKVMGPVLAVLSVEHEYVRTSSAASVRELAETFPRTSETT 588
            L+VLDSV SG GR    D    V+ PVL  L   ++ V++ ++ SV E       T   T
Sbjct: 53   LIVLDSVHSGTGRTSGNDITVNVIEPVLRRLHARYQVVKSQNSKSVAEFGNQLDPTQSYT 112

Query: 589  VLVMSGDTTISEFVNALGSG-----AGVTVYALPLGTANAWAHSVGLGTPAKALQAFVQG 753
            +L +SGDT++SEF N +G+G     + +T+  + +GT NA A+S+ L  P +A  +F++G
Sbjct: 113  ILFVSGDTSVSEFFNGVGAGVPSPRSSLTILPIAMGTGNALANSLNLNCPVEAFASFLRG 172

Query: 754  RVHAVPFPLYRARFPSGY-SIRFFIVLSAGFHANLLHLCNDERYQRLGVERFREASTEIL 930
             +    FPLYRA  P G  S+ FFIVLS GFHANLLH   +E+Y+ +GVERF+EAS +IL
Sbjct: 173  ELVTAEFPLYRAILPDGETSVVFFIVLSLGFHANLLHAAENEKYKSMGVERFQEASGDIL 232

Query: 931  DRYALAEHVRVRAADGSEQLAGLYAYFALLNTPHLEETYVPSPLSDPLLKQLHVLAFEAE 1110
              Y L E + +      + +AG YAYFAL+N P+LE +Y+PSP SDP   +LH+LA+ + 
Sbjct: 233  QNYKLQEQITL----DKQGVAGSYAYFALVNVPNLEASYIPSPQSDPFKHELHLLAYSSS 288

Query: 1111 LSRDKLNELLMAGYSTIRGSALSA-PGLVYRNLGDSFTLSIEN---GASDRVANELCVDG 1278
            L+R +L E +MAGY   RG  L+A P   Y+ + + F + ++N   G +D  A ELC+DG
Sbjct: 289  LNRKQLLERIMAGYKNRRGDELTADPYTTYKRISEGFEIKLQNKQEGPND-PAFELCLDG 347

Query: 1279 HLLNLVDLQAPGDVFDGSIEVGVVPASFG 1365
             L NL+  ++     + +I+V ++ ++ G
Sbjct: 348  QLYNLLQYKSDQHQEELTIQVELIDSALG 376

>Kwal_55.19688 s55 (79793..80974) [1182 bp, 393 aa] {ON} [contig 159]
            FULL
          Length = 393

 Score =  247 bits (630), Expect = 6e-77
 Identities = 143/334 (42%), Positives = 200/334 (59%), Gaps = 11/334 (3%)
 Frame = +1

Query: 409  LVVLDSVRSGAGREPATDFYAKVMGPVLAVLSVEHEYVRTSSAASVRELAETF-PRTSET 585
            ++V+DS++SG GR+   DF   V+ PV   L +++  V+T +  SV EL   F P    T
Sbjct: 57   ILVVDSIKSGTGRDVKNDFCTNVIQPVFTELGLDYRVVKTENENSVAELGRNFRPCGQNT 116

Query: 586  TVLVMSGDTTISEFVNALGSGAGVTV------YALPLGTANAWAHSVGLGTPAKALQAFV 747
            TV+ +SGDT+ISEFVN L      T+       ALPLGT NAWA+S+G  T A AL  F+
Sbjct: 117  TVIFLSGDTSISEFVNNLTQEQQGTIRPTVNLLALPLGTGNAWANSLGFRTAATALAEFL 176

Query: 748  QGRVHAVPFPLYRARFPSGYSIRFFIVLSAGFHANLLHLCNDERYQRLGVERFREASTEI 927
            QG +    FPLY+A FP+GY I FFI+LS GFHANLLHLC+  R+++LGVERFR AS EI
Sbjct: 177  QGFLKPKNFPLYKAIFPNGYEIVFFIILSIGFHANLLHLCDQPRFKKLGVERFRLASKEI 236

Query: 928  LDRYALAEHVRVRAADGSEQLAGLYAYFALLNTPHLEETYVPSPLSDPLLKQLHVLAFEA 1107
             + Y L   ++V     +++    Y+YFAL+NTP+LE+ Y PSP S+PL  +LH+L + +
Sbjct: 237  FEDYILDYPLQV-----TQRPLEHYSYFALINTPNLEQNYKPSPKSNPLTSELHLLGYSS 291

Query: 1108 ELSRDKLNELLMAGYSTIRGSALSAPGLVYRNLGDSFTLSIENGAS--DRVANELCVDGH 1281
             L +  L   +M GYS    + ++  G+ Y+   +   +          R A ++C DGH
Sbjct: 292  GLPQPMLINRIMKGYSNQPETDINEEGVTYQAFSNDLDVVFAQDPELVPRSAFDICCDGH 351

Query: 1282 LLNLVDLQAPGDVFDGSIEVGVVP--ASFGLKAL 1377
            LLN++  Q     FDG I V  +   +SF LK L
Sbjct: 352  LLNMLSQQPAHGSFDGRIHVKFLKEHSSFHLKVL 385

>TDEL0B02160 Chr2 (384824..385951) [1128 bp, 375 aa] {ON} Anc_5.704
          Length = 375

 Score =  241 bits (615), Expect = 6e-75
 Identities = 146/375 (38%), Positives = 210/375 (56%), Gaps = 7/375 (1%)
 Frame = +1

Query: 274  KETELFCKEGLEYAVAELWEEGKLRSVELAVXXXXXXXXXXXXXXLVVLDSVRSGAGREP 453
            +E +L    G+ Y+V     E + + V+ A               L+V+DSV SG GR  
Sbjct: 5    EEIKLLNIHGICYSVISEPSESRFQLVKTATTTEDDRTVQNQPN-LIVIDSVHSGKGRTA 63

Query: 454  ATDFYAKVMGPVLAVLSVEHEYVRTSSAASVRELAETFPRTSETTVLVMSGDTTISEFVN 633
              D Y  VM P+   ++++H  ++T+S  ++   A T   +   TVL +SGDT+ISEF+N
Sbjct: 64   QNDLYTIVMKPIFEAVNIDHRLIKTTSRDTIASYASTLDISQSHTVLFLSGDTSISEFIN 123

Query: 634  ALGSGA---GVTVYALPLGTANAWAHSVGLGTPAKALQAFVQGRVHAVPFPLYRARFPSG 804
             L  GA    +++ + P+G+ NAWA S+G+  P K    F++G +   PFPLY+A FP+G
Sbjct: 124  NLPQGAPSANLSILSFPMGSGNAWASSLGIMCPVKTFGQFIRGEMSHSPFPLYKAVFPNG 183

Query: 805  YSIRFFIVLSAGFHANLLHLCNDERYQRLGVERFREASTEILDRYALAEHVRVRAADGSE 984
            YSI FFI+LS GFHANL+H C    YQR+G+E+F+ A + IL  Y L   + V +     
Sbjct: 184  YSIVFFIILSMGFHANLVHACERPEYQRMGIEKFQLAGSVILKEYELDLKITVNS----- 238

Query: 985  QLAGLYAYFALLNTPHLEETYVPSPLSDPLLKQLHVLAFEAELSRDKLNELLMAGYSTIR 1164
             LA  Y+YFAL+NTP+LE  Y PSP SDPL ++L++L + + LS+D+    +M GY    
Sbjct: 239  -LAASYSYFALINTPNLEPAYRPSPESDPLKEELYLLGYSSGLSKDQFLTKVMKGYELGP 297

Query: 1165 GSAL---SAPGLVYRNLGDSFTLSIENGASDRVANELCVDGHLLNLVDLQAPGDVFDG-S 1332
               L   S    V    G   TL      S R  +E+C DG LLNL DLQA  +V +  S
Sbjct: 298  SDKLPLDSDTIYVPFTKGFDVTLDFPLLESPRYKSEICCDGVLLNLQDLQADLEVSNKFS 357

Query: 1333 IEVGVVPASFGLKAL 1377
            IE     + F +KA+
Sbjct: 358  IEFLNHYSKFNIKAM 372

>ZYRO0G06556g Chr7 (518731..519870) [1140 bp, 379 aa] {ON} conserved
            hypothetical protein
          Length = 379

 Score =  235 bits (600), Expect = 1e-72
 Identities = 127/308 (41%), Positives = 190/308 (61%), Gaps = 7/308 (2%)
 Frame = +1

Query: 409  LVVLDSVRSGAGREPATDFYAKVMGPVLAVLSVEHEYVRTSSAASVRELAETFPRTSETT 588
            L+VLDS++SG GR    DFY+ V+ P+L  L+  H Y++T+S  SV + A++     +  
Sbjct: 51   LIVLDSLKSGIGRTENNDFYSIVIAPILEELNWNHNYIKTTSHDSVSQFAQSLDPLQDYE 110

Query: 589  VLVMSGDTTISEFVNALGSGA----GVTVYALPLGTANAWAHSVGLGTPAKALQAFVQGR 756
            + ++SGDTTISEF N L +       + +  LP+GT NAWA+S+G  +P  A + ++   
Sbjct: 111  IWIISGDTTISEFCNNLPNKKITRNPLRILPLPMGTGNAWANSLGFDSPITAFRNYLNHN 170

Query: 757  VHAVPFPLYRARFPSGYSIRFFIVLSAGFHANLLHLCNDERYQRLGVERFREASTEILDR 936
            +     PLYRA  P+GYSI FF++ S GFHANLLH C D +Y ++G ERF+ A+  IL+ 
Sbjct: 171  LKPRDIPLYRAALPNGYSIIFFMIFSLGFHANLLHACEDPKYAKMGAERFQIAAQSILES 230

Query: 937  YALAEHVRVRAADGSEQLAGLYAYFALLNTPHLEETYVPSPLSDPLLKQLHVLAFEAELS 1116
            Y+L   +   + DG   L   YAYFAL+NTP+LE TY PSP S+PL ++L +L + + L 
Sbjct: 231  YSLDLDI---SLDG---LRRSYAYFALINTPNLEATYKPSPRSNPLERELRLLGYSSSLG 284

Query: 1117 RDKLNELLMAGY-STIRGSALSAPGLVYRNLGDSFTLSIENGASDRVAN--ELCVDGHLL 1287
            R +L E +M GY +   G   +   ++Y+++   FTL + +   D   +  E+C DG LL
Sbjct: 285  RQELVEKIMQGYQNKPNGDLPTNEDMIYKSITHDFTLVLNDSLEDSSMHKFEICCDGILL 344

Query: 1288 NLVDLQAP 1311
            NL+D Q+P
Sbjct: 345  NLLDYQSP 352

>KAFR0H00200 Chr8 (25900..27069) [1170 bp, 389 aa] {ON} Anc_5.704
          Length = 389

 Score =  219 bits (557), Expect = 4e-66
 Identities = 116/309 (37%), Positives = 185/309 (59%), Gaps = 11/309 (3%)
 Frame = +1

Query: 409  LVVLDSVRSGAGREPATDFYAKVMGPVLAVLSVEHEYVRTSSAASVRELAETFPRTSETT 588
            +VV+DSV SG GR     FY  V+ P+  +  ++H Y +T+   S+   A++   +   T
Sbjct: 55   VVVIDSVSSGTGRNKNNHFYNIVIKPIFDIFKIQHHYFKTTGPKSISTYAKSLDLSKSYT 114

Query: 589  VLVMSGDTTISEFVNAL--------GSGAGVTVYALPLGTANAWAHSVGLGTPAKALQAF 744
            V+ +SGDT+ISEF+N L        G    +++  LP+GT NA++ S+G   P + L +F
Sbjct: 115  VIFISGDTSISEFINNLPPLLETSNGLKHTISILPLPMGTGNAFSSSIGHKCPIQTLSSF 174

Query: 745  VQGRVHAVPFPLYRARFPSGYSIRFFIVLSAGFHANLLHLC-NDERYQRLGVERFREAST 921
            +  R     FPLY   FP+G ++ FFI+LS G HAN+LHLC ND +Y++ G ERF+ A  
Sbjct: 175  LHNRTQPSHFPLYEVIFPNGKTVIFFIILSLGLHANVLHLCENDPQYKKYGEERFKLAFE 234

Query: 922  EILDRYALAEHVRVRAADGSEQLAGLYAYFALLNTPHLEETYVPSPLSDPLLKQLHVLAF 1101
            +++  Y L   +++   D    L+G ++YF L+NTP+LE +Y+PSPLSDP L+QLHVL +
Sbjct: 235  KVMTTYDLNVRLQIPELD----LSGAFSYFILINTPNLESSYIPSPLSDPFLEQLHVLGY 290

Query: 1102 EAELSRDKLNELLMAGYSTIRGSAL-SAPGLVYRNLGDSFTLSI-ENGASDRVANELCVD 1275
             + L+ + L   +  GYS   G  L  +  +VY+ +  + ++ + E+  S++   ++C D
Sbjct: 291  SSSLNNEDLLNYVTQGYSNKLGDELVESSNMVYKPISRNVSIVLTEDEESEKYKYDICCD 350

Query: 1276 GHLLNLVDL 1302
            G L NL D+
Sbjct: 351  GLLFNLRDM 359

>NCAS0A03190 Chr1 (626695..627891) [1197 bp, 398 aa] {ON} Anc_5.704
          Length = 398

 Score =  218 bits (555), Expect = 9e-66
 Identities = 119/309 (38%), Positives = 172/309 (55%), Gaps = 12/309 (3%)
 Frame = +1

Query: 409  LVVLDSVRSGAGREPATDFYAKVMGPVLAVLSVEHEYVRTSSAASVRELAETFPRTSETT 588
            L+V+DS+ SG GR    DFY  VM P+   L++ H  V+T+S  SV   A     T    
Sbjct: 58   LIVIDSIHSGGGRTSDNDFYRNVMEPIFIKLNLTHLLVKTTSKDSVENFASKLDLTKHYE 117

Query: 589  VLVMSGDTTISEFVNALGSGA--------GVTVYALPLGTANAWAHSVGLGTPAKALQAF 744
            +  +SGDTTISEF+N L   +         +++   P GT NA A+S+GL  P      +
Sbjct: 118  IFFLSGDTTISEFINGLPKQSLDVNDAKNSLSILPFPFGTGNALANSLGLTCPTTIFSNY 177

Query: 745  VQGRVHAVPFPLYRARFPSGYSIRFFIVLSAGFHANLLHLCNDERYQRLGVERFREASTE 924
            +        FPLY+A FP+G  I FF++LS GFHANLLH C    Y++LGVERFR AS +
Sbjct: 178  LTSNYSINNFPLYKAIFPNGNEIVFFVILSLGFHANLLHCCEAPHYKKLGVERFRIASED 237

Query: 925  ILDRYALAEHVRVRAADGSEQL--AGLYAYFALLNTPHLEETYVPSPLSDPLLKQLHVLA 1098
            IL  Y L  ++ + +  G   +  +  Y+YF ++NTP LE  Y+PSP S+PL  QLH++A
Sbjct: 238  ILANYDLDLNISIESPRGLSPIVPSREYSYFVVVNTPKLEAKYIPSPQSNPLRSQLHIIA 297

Query: 1099 FEAELSRDKLNELLMAGYSTIRGSALSAPGLVYRNLGDSFTLSIENGA--SDRVANELCV 1272
            + + L +D+L   ++ GY    G  ++  G+ Y  + D+F + +      S     +LC 
Sbjct: 298  YSSSLPKDELMARILKGYENNIGDVVNNTGVTYLPIEDNFIIKLNYSQEYSPSSKFQLCC 357

Query: 1273 DGHLLNLVD 1299
            DG L NL D
Sbjct: 358  DGLLFNLND 366

>TPHA0D04620 Chr4 complement(1010489..1011709) [1221 bp, 406 aa] {ON}
            Anc_5.704
          Length = 406

 Score =  218 bits (554), Expect = 2e-65
 Identities = 123/318 (38%), Positives = 183/318 (57%), Gaps = 20/318 (6%)
 Frame = +1

Query: 409  LVVLDSVRSGAGREPATDFYAKVMGPVLAVLSVEHEYVRTSSAASVRELAETFPRTSETT 588
            LVV+DS+ SG GR    DFY  VM PV    + +H+Y+RT    S+++LA  F  + + T
Sbjct: 60   LVVIDSICSGVGRTGQNDFYNNVMKPVFKEANFKHKYIRTEGEDSIKDLATKFEASKDYT 119

Query: 589  VLVMSGDTTISEFVNALG------------SGAGVTVYALPLGTANAWAHSVGLGTPAKA 732
            ++ +SGDT++SEF+N L             +   + ++ +PLGT NA A S+ L +P + 
Sbjct: 120  IIFLSGDTSVSEFINNLTKVQKENFISCSENKRQMNIFTIPLGTGNALASSIHLSSPHQV 179

Query: 733  LQAFVQGRVHAVPFPLYRARFPSGYSIRFFIVLSAGFHANLLHLCNDERYQRLGVERFRE 912
             Q F+   +    FPLY    P+  +I FFI+ S GFHANLLH C+ + YQ++G ERF +
Sbjct: 180  FQKFLNNELIIKDFPLYTVTLPNKKTIIFFIIFSMGFHANLLHACDSDEYQKMGTERFAK 239

Query: 913  ASTEILDRYALAEHVRVRAADGSEQLAGLYAYFALLNTPHLEETYVPSPLSDPLLKQLHV 1092
            AS  I   Y L  ++ +   +GSE ++  YAYFA++NTP+LE  Y+PSP SD    +LH+
Sbjct: 240  ASENIFKNYDL--NIGLTTKNGSESISRNYAYFAIINTPNLELNYMPSPDSDVFKNELHL 297

Query: 1093 LAFEAELSRDKLNELLMAGYS-TIRGSALSAPGLVYR---NL-GDSFTLSIENGASDRVA 1257
            L ++A LS +KL   +MAGYS   R    +   L Y    NL G    + +E  +  ++ 
Sbjct: 298  LGYDASLSTEKLVNKIMAGYSYKEREKINNKDNLTYYYPVNLSGTGLQIILETDSDKKLE 357

Query: 1258 N---ELCVDGHLLNLVDL 1302
                ++C DG LLNL D+
Sbjct: 358  KYKYDICCDGLLLNLDDI 375

>CAGL0G02519g Chr7 complement(228822..229958) [1137 bp, 378 aa] {ON}
            similar to KLLA0A00550g Kluyveromyces lactis
          Length = 378

 Score =  214 bits (545), Expect = 2e-64
 Identities = 124/351 (35%), Positives = 194/351 (55%), Gaps = 12/351 (3%)
 Frame = +1

Query: 283  ELFCKEGLEYAVAELWEEGKLRSVELAVXXXXXXXXXXXXXX---LVVLDSVRSGAGREP 453
            EL    G++Y+V  +  +GK+ S +L                   ++V+DSV+SG  R  
Sbjct: 6    ELCRNNGIKYSVEIVEVKGKVESYKLIKANDRSTDCFLKFDRDTQIIVIDSVKSGTSRND 65

Query: 454  ATDFYAKVMGPVLAVLSVEHEYVRTSSAASVRELAE--TFPRTSETTVLVMSGDTTISEF 627
             +D Y  V+ P+   L VE++Y++T S  S+R+ A   +F    +  +L +SGDT+ISEF
Sbjct: 66   RSDLYKLVIEPLFQSLGVEYKYIKTESENSIRDFARRTSFQSGFKYDILFLSGDTSISEF 125

Query: 628  VNALGSGA------GVTVYALPLGTANAWAHSVGLGTPAKALQAFVQGRVHAVPFPLYRA 789
            +NAL +         +++  +PLG+ NA A S+G  TP +AL  ++       P PLY A
Sbjct: 126  INALDTTILRSAKYRISILPVPLGSGNALATSLGFKTPLQALITYLNSNKKCSPLPLYDA 185

Query: 790  RFPSGYSIRFFIVLSAGFHANLLHLCNDERYQRLGVERFREASTEILDRYALAEHVRVRA 969
            + P+  S+ FFI+LS GFHANLLH   D +Y+ +GVERF+ AS  + + Y L   + V  
Sbjct: 186  QLPNSTSMIFFIILSLGFHANLLHCAEDPKYKSMGVERFQVASKTVFESYDLNVGIAVNG 245

Query: 970  ADGSEQLAGLYAYFALLNTPHLEETYVPSPLSDPLLKQLHVLAFEAELSRDKLNELLMAG 1149
                      Y+YFA++  P+LE TY PSP S  L K+LH+L ++A +  + L + +M G
Sbjct: 246  LQSQS-----YSYFAVIAAPNLEPTYKPSPKSSVLKKELHILGYKAGICLEDLQDKIMRG 300

Query: 1150 YSTIRGSALSAPGLVYRNLGDSFTLSIENG-ASDRVANELCVDGHLLNLVD 1299
            Y    G  +   G +Y+    +  LSI+ G  + +   ++C+DG+LLNL D
Sbjct: 301  YHNKDGEDIQEIGTIYQCFQKNLELSIKTGHNAPKYRYDMCIDGYLLNLED 351

>NDAI0E05050 Chr5 complement(1156499..1157854) [1356 bp, 451 aa] {ON}
            Anc_5.704
          Length = 451

 Score =  213 bits (542), Expect = 3e-63
 Identities = 132/339 (38%), Positives = 193/339 (56%), Gaps = 40/339 (11%)
 Frame = +1

Query: 409  LVVLDSVRSGAGREPATDFYAKVMGPVLAVLSVEHEYVRTSSAASVRELAETFP-RTSET 585
            L+++DS  SG GR    DFYA +M P+L+ L+++ E  +T+S  S++  A  F  +T +T
Sbjct: 84   LIIIDSTHSGLGRNKENDFYAIIMEPILSKLNIKFELFKTTSKDSIKSFANNFSIKTKDT 143

Query: 586  T-----VLVMSGDTTISEFVNALG------SGAGVTVYALPLGTANAWAHSVGLGTPAKA 732
            T     ++ +SGDTTISEF N L       S   + +  +P+GTANAW++S+ L  P   
Sbjct: 144  TKIDYNLIFLSGDTTISEFFNNLPPQQPQTSKINLNILTIPMGTANAWSNSLNLNCPIDI 203

Query: 733  LQAFVQGRVHAVPFPLYRARFPSGYS-------------IRFFIVLSAGFHANLLHLC-N 870
             Q F+  ++   PFPLY    P   S             I FFIVLS GFHANLLHLC N
Sbjct: 204  FQKFLLNKLTVSPFPLYSLILPHSPSSSSSSGKTGGKNTIYFFIVLSMGFHANLLHLCSN 263

Query: 871  DERYQRLGVERFREASTEILDRYALAEHVRVRAADGSEQ--LAGLYAYFALLNTPHLEET 1044
            DE+Y  LG+ERF+ AS EIL  Y L  ++ + + +      L   ++YF L+NTP LE  
Sbjct: 264  DEKYSNLGLERFKLASDEILSNYNLNLNITIESCNDKSHIILNDSFSYFNLMNTPKLEYN 323

Query: 1045 YVPSPLSDPLLKQLHVLAFEAE-LSRDKLNELLMAGYSTIRGSA----LSAPGLVYRNLG 1209
            Y+PSPLSDPL   LHVLA+++   ++ +L + +M GYS   G      +   G++Y  + 
Sbjct: 324  YIPSPLSDPLKNNLHVLAYKSHPYNKQQLIKNIMKGYSNELGQKNIQNIDEDGIIYFPIN 383

Query: 1210 D-SFTLSIEN----GASDRVAN--ELCVDGHLLNLVDLQ 1305
            D  F +++ N     +S  +++  ELC DG L NL++ Q
Sbjct: 384  DKKFKITLNNPSPISSSLSLSHNYELCCDGMLFNLLNYQ 422

>Kpol_YGOB_Anc_5.704 s2001 complement(209387..210010) [624 bp, 207 aa]
            {ON} ANNOTATED BY YGOB -
          Length = 207

 Score =  110 bits (274), Expect = 3e-27
 Identities = 65/177 (36%), Positives = 97/177 (54%), Gaps = 6/177 (3%)
 Frame = +1

Query: 787  ARFPSGYSIRFFIVLSAGFHANLLHLCNDERYQRLGVERFREASTEILDRYALAEHVRVR 966
            A FP    I FFI+LS GFHA LLH C+     ++G ERF+ A+ EIL+ Y L  +++V 
Sbjct: 2    ATFPDDSRIYFFIILSLGFHATLLHACSRPELLKMGTERFQLAAKEILETYDLDLNIKVN 61

Query: 967  AADGSEQLAGLYAYFALLNTPHLEETYVPSPLSDPLLKQLHVLAFEAELSRDKLNELLMA 1146
             +         YAYFA++NT +LE TY PSP S+ L   L +L + ++LSR +L + +M 
Sbjct: 62   KS------TRRYAYFAIINTSNLELTYCPSPKSNVLENSLQLLGYSSKLSRAELVDKIMK 115

Query: 1147 GYSTIRGSALSAPGLVYRNLGDSFTLSIENGASDRVAN------ELCVDGHLLNLVD 1299
            GY   +G  +      Y    D     I+    +++ N      E+C DG LL+L++
Sbjct: 116  GYIIRKGDVIKTDEYTYYETLDLSQSGIDIIVDEKMNNSNTHKFEICCDGLLLDLME 172

>ZYRO0F02750g Chr6 (229681..234465) [4785 bp, 1594 aa] {ON} some
            similarities with uniprot|P08640 Saccharomyces cerevisiae
            YIR019C MUC1 GPI-anchored cell surface glycoprotein
            required for diploid pseudohyphal formation and haploid
            invasive growth transcriptionally regulated by the MAPK
            pathway (via Ste12p and Tec1p) and the cAMP pathway (via
            Flo8p)
          Length = 1594

 Score = 48.1 bits (113), Expect = 5e-05
 Identities = 71/316 (22%), Positives = 120/316 (37%), Gaps = 7/316 (2%)
 Frame = -2

Query: 1277 PSTHNSLATRSEAPFSMDNVKLSPKFRYTNPGALNALPRIVE*PAINNSFSLSRDSSASN 1098
            PST++   + + AP S  +  L  K    +P   +  P            S S  SSA+ 
Sbjct: 212  PSTNSCFQSSTSAPTSSQSDTLQNK----DPVGYSTAP----------ISSASSSSSAAQ 257

Query: 1097 ANTCSCLRSGSDKGDGTYVSSRCGVFSRAK*AYNPANCSEPSAARTLTCSANAYRSRISV 918
             +  S   S +   D +  SS          +  P+N +  S + +    AN   S  S 
Sbjct: 258  TSAASSGPSAAPVTDASSTSSSAPTSGATSGSSAPSNDANSSTSGSSAAQANTVSSSSSA 317

Query: 917  LASRKRSTPSRWYLSSLQRCSKFAWNPADSTMKKRIE*PLGKRARYSGNGTACTRPCTNA 738
              +   S+ S    SS       + + A S          G  +  SG+  A     +++
Sbjct: 318  APATDASSSS----SSAPTSGTTSGSSAPSN---------GANSSTSGSSAAQANTVSSS 364

Query: 737  CSAFAGVPRPTE*AHALAVPSGSAYTVTPAPEPRALTNSEIVVSPDITSTVVSDVRGNVS 558
             SA       +  + A A  + S    + AP   A ++S      D +ST  S      +
Sbjct: 365  SSAAPATDASSSSSSAPATDASSTSGSSAAPTNAASSSSSAAPVTDASSTSSSAPTSGAT 424

Query: 557  ASSRTLAAEEVRTYSCSTLSTANT-------GPITFA*KSVAGSRPAPDRTESSTTSGPP 399
            + S   + +   + S S+ + ANT        P T A  S + S PA D + SS+++   
Sbjct: 425  SGSSAPSNDANSSTSGSSAAQANTVSSSSSAAPATDA-SSSSSSAPATDASSSSSSAPTS 483

Query: 398  GARASAPLPSRTASST 351
            G+ + +  PS  A+S+
Sbjct: 484  GSTSGSSAPSNDANSS 499

 Score = 44.3 bits (103), Expect = 7e-04
 Identities = 61/272 (22%), Positives = 106/272 (38%), Gaps = 9/272 (3%)
 Frame = -2

Query: 1139 NNSFSLSRDSSASNANTCSCLRSGSDKGDGTYVSSRCGVFSRAK*AYNPANCSEPSAART 960
            N++ S +  SSA+ ANT S   S +   D +  SS          +  P+N +  S + +
Sbjct: 294  NDANSSTSGSSAAQANTVSSSSSAAPATDASSSSSSAPTSGTTSGSSAPSNGANSSTSGS 353

Query: 959  LTCSANAYRSRISVLASRKRSTPSRWYLSSLQRCSKFAWNPADSTMKKRIE*PLGKRARY 780
                AN   S  S   +   S+ S          S      A ST               
Sbjct: 354  SAAQANTVSSSSSAAPATDASSSS----------SSAPATDASST--------------- 388

Query: 779  SGNGTACTRPCTNACSAFAGVPRPTE*AHALAVPSGSAYTVTPAPEPRALTNSE------ 618
            SG+  A   P   A S+ +  P     + + + P+  A + + AP   A +++       
Sbjct: 389  SGSSAA---PTNAASSSSSAAPVTDASSTSSSAPTSGATSGSSAPSNDANSSTSGSSAAQ 445

Query: 617  -IVVSPDITSTVVSDVRGNVSASSRTLAAEEVRTYSCSTLSTANTGPITFA*KSVAGSRP 441
               VS   ++   +D   + S++  T A+    +   S  ++ ++ P   A  S +GS  
Sbjct: 446  ANTVSSSSSAAPATDASSSSSSAPATDASSSSSSAPTSGSTSGSSAPSNDANSSTSGSSA 505

Query: 440  APDRTESSTTSGPP--GARASAPLPSRTASST 351
            A   T SS++S  P  G+ + +  PS  A+S+
Sbjct: 506  AQTNTASSSSSSAPTSGSTSGSSAPSNDANSS 537

>TBLA0F00120 Chr6 (10892..12925) [2034 bp, 677 aa] {ON} 
          Length = 677

 Score = 47.8 bits (112), Expect = 5e-05
 Identities = 63/274 (22%), Positives = 108/274 (39%), Gaps = 12/274 (4%)
 Frame = -2

Query: 1136 NSFSLSRDSSASNANT---CSCLRSGSDKGDGTYVSSRCGVFSRAK*AYNPANCSEPSAA 966
            +S S S+ S++S ++T   C  + + S     +  SS+    S  K      + S  S +
Sbjct: 236  SSTSTSKSSTSSKSSTTSDCKTIDASSTSTSKSSTSSKSSTTSDCK----TIDASSTSTS 291

Query: 965  RTLTCSANAYRSRISVLASRKRSTPSRWYLSSLQRCSKFAWNPADSTMKKRIE*PLGKRA 786
            ++ T S ++  S  S   S + ST S    ++    S    +   ST          + +
Sbjct: 292  KSFTSSESSTISSESSTTSSESSTTSSEPSTTSSESS--TTSSESSTTSSESSTTSSESS 349

Query: 785  RYSGNGTACTRPCTNACSAFAGVPRPTE*AHALAVPSGSAYTVTPAPEPRA----LTNSE 618
              S   +  +  CT + S                +PS S+ T +  P   +     T+SE
Sbjct: 350  TTSSESSTTSNICTFSDSTTTYTSECRTLDPTSVLPSTSSTTTSSEPSTTSSESSTTSSE 409

Query: 617  IVVSPDITSTVVSDVRGNVSASSRTLA-----AEEVRTYSCSTLSTANTGPITFA*KSVA 453
               +   +ST  S+     S SS T +     + E  T S  + +T++    T +  S  
Sbjct: 410  SSTTSSESSTTSSESSTTSSESSTTSSESSTTSSEPSTTSSESSTTSSESSTTSSESSTT 469

Query: 452  GSRPAPDRTESSTTSGPPGARASAPLPSRTASST 351
             S P+   +ESSTTS      +S P  + + SST
Sbjct: 470  SSEPSTTSSESSTTSSESSTTSSEPSTTSSESST 503

 Score = 39.7 bits (91), Expect = 0.017
 Identities = 55/251 (21%), Positives = 99/251 (39%), Gaps = 8/251 (3%)
 Frame = -2

Query: 1136 NSFSLSRDSSASNANT---CSCLRSGSDKGDGTYVSSRCGVFSRAK*AYNPANCSEPSAA 966
            +S S S+ S++S ++T   C  + + S     ++ SS     S      +  + +  S  
Sbjct: 261  SSTSTSKSSTSSKSSTTSDCKTIDASSTSTSKSFTSSESSTISSESSTTSSESSTTSSEP 320

Query: 965  RTLTCSANAYRSRISVLASRKRSTPSRWYLSSLQRCSK-----FAWNPADSTMKKRIE*P 801
             T +  ++   S  S  +S   +T S    +S +  +      F+ +    T + R   P
Sbjct: 321  STTSSESSTTSSESSTTSSESSTTSSESSTTSSESSTTSNICTFSDSTTTYTSECRTLDP 380

Query: 800  LGKRARYSGNGTACTRPCTNACSAFAGVPRPTE*AHALAVPSGSAYTVTPAPEPRALTNS 621
                   S   T+     T++ S+       T  + +    S S+ T + +    + T+S
Sbjct: 381  TSVLPSTSSTTTSSEPSTTSSESSTTSSESSTTSSESSTTSSESSTTSSES----STTSS 436

Query: 620  EIVVSPDITSTVVSDVRGNVSASSRTLAAEEVRTYSCSTLSTANTGPITFA*KSVAGSRP 441
            E   +    ST  S+     S SS T  + E  T S    +T++    T +  S   S P
Sbjct: 437  ESSTTSSEPSTTSSESSTTSSESSTT--SSESSTTSSEPSTTSSESSTTSSESSTTSSEP 494

Query: 440  APDRTESSTTS 408
            +   +ESSTTS
Sbjct: 495  STTSSESSTTS 505

 Score = 35.8 bits (81), Expect = 0.27
 Identities = 71/374 (18%), Positives = 126/374 (33%), Gaps = 41/374 (10%)
 Frame = -2

Query: 1349 TTPTSMLPSNTSPGACRSTRLSR------------------------WPSTHNSLATRSE 1242
            T+PTS     TS  +C S+  S+                          S+ ++  T S+
Sbjct: 92   TSPTSDCEETTSTESCTSSTTSKVCTFSDSTTTYTSECCTTYSASSCSTSSESTCTTSSK 151

Query: 1241 APFSMDNVKLSPKFRYTNPGALNALPRIVE*PAINNSFSLS--RDSSASNANTCSCLRSG 1068
            +  S     +S                    P+ ++S  +    DS+ +  + C  + + 
Sbjct: 152  SSCSSGICTVSDSTTTYTTDCPTTTTTTTTQPSSSSSGKVCTYSDSTTTYTSDCKTIDAS 211

Query: 1067 SDKGDGTYVSSRCGVFSRAK*AYNPANCSEPSAARTLTCSANAYRSRISVLASRKRSTPS 888
            S     +  SS+    S  K      + S  S +++ T S ++  S    + +   ST  
Sbjct: 212  STSTSKSSTSSKSSTTSDCK----TIDASSTSTSKSSTSSKSSTTSDCKTIDASSTSTSK 267

Query: 887  RWYLSSLQRCSKFAWNPADSTMKKRIE*PLGKRARYSGNGTACTRPCTNACSAFAGVPRP 708
                S     S      A ST          K    S + T  +   T +  +      P
Sbjct: 268  SSTSSKSSTTSDCKTIDASST-------STSKSFTSSESSTISSESSTTSSESSTTSSEP 320

Query: 707  TE*AHALAVPSGSAYTV----------TPAPEPRALTNSEIVVSPDITSTVVSDVR---- 570
            +  +   +  S  + T           +      + T S I    D T+T  S+ R    
Sbjct: 321  STTSSESSTTSSESSTTSSESSTTSSESSTTSSESSTTSNICTFSDSTTTYTSECRTLDP 380

Query: 569  -GNVSASSRTLAAEEVRTYSCSTLSTANTGPITFA*KSVAGSRPAPDRTESSTTSGPPGA 393
               + ++S T  + E  T S  + +T++    T +  S   S  +   +ESSTTS     
Sbjct: 381  TSVLPSTSSTTTSSEPSTTSSESSTTSSESSTTSSESSTTSSESSTTSSESSTTSSESST 440

Query: 392  RASAPLPSRTASST 351
             +S P  + + SST
Sbjct: 441  TSSEPSTTSSESST 454

>KLTH0D03894g Chr4 (376254..378374) [2121 bp, 706 aa] {ON} some
            similarities with uniprot|P08068 Saccharomyces cerevisiae
            YIR019C GPI-anchored cell surface glycoprotein required
            for diploid pseudohyphal formation and haploid invasive
            growth
          Length = 706

 Score = 47.4 bits (111), Expect = 7e-05
 Identities = 79/370 (21%), Positives = 137/370 (37%), Gaps = 35/370 (9%)
 Frame = -2

Query: 1355 AGTTPTSMLPSNTSPGACRSTRLSRWPSTHNSLATRSEAPFSMDNVKLSPKFRYTNPGAL 1176
            +  TP+S +PS+ +P +  +T  S   ST  S  T S +  S   +  S     T P ++
Sbjct: 162  SSATPSSAMPSSATPSS-TTTASSTASSTTISTTTSSSSASSSSTIS-SFTISSTTPSSI 219

Query: 1175 ---NALPRIVE*PAINNSFSLSRDSSASNANTCSCLRSGSDKGDGTYVSSRCGVFSRAK* 1005
               NA P I+   +  +S S    +S+S A T S     S  G  T  +      +  + 
Sbjct: 220  ASSNATPSIITISSDTSSSSTLSSASSSVARTSSGNVESSPSGPKTTTTLNKSTTTETE- 278

Query: 1004 AYNPANC-----SEPSAARTLTCSANAYRSRISVLASRKRSTPSRWYLSSLQRCSKFAWN 840
                 +C     S  S   TL  + +   S  +  +++  +T     LSS    SK + +
Sbjct: 279  ---SCDCTTYPGSSISTTTTLVSTISTSSSATTQSSTQSSTTSGTSSLSSEMSSSKSSAS 335

Query: 839  PADSTMKKRIE*PLGKRARYSGNGTACTRPC------TNACSAFAGVPRPTE*AHALAVP 678
                +   ++    G  +  +   T  +         +N  +    +P     +   +  
Sbjct: 336  SVSLSSSSKVSSRTGFSSTETSRATTVSETQHSLSSESNTPTTLTSIPGSLSTSATFSSF 395

Query: 677  SGSAYTVTPAPEPRALTNSEIVVS------------------PDITSTVVSDVRGNVSAS 552
            S +A++      P A + S +V S                  P + S+V S   GNV +S
Sbjct: 396  SSTAFSSVSTSSPTAESVSSLVSSTPSVGSQTSSTLTSSTSFPGVPSSVTSS--GNVPSS 453

Query: 551  SRTLAAEEVRTYSCSTLSTANTGPITFA*KSVAGSRPAPDRTESSTTSGPPGA---RASA 381
               +        + +T ST N+G  +    + +  R       S+  S  P +    +S 
Sbjct: 454  FSDIGTSSTSVLT-TTYSTTNSGSTSITLTTDSSFRTLESSASSTPASSTPASSTPASST 512

Query: 380  PLPSRTASST 351
            P  S TASST
Sbjct: 513  PASSTTASST 522

 Score = 36.6 bits (83), Expect = 0.16
 Identities = 84/367 (22%), Positives = 136/367 (37%), Gaps = 34/367 (9%)
 Frame = -2

Query: 1349 TTPTSMLPSNTSPGACRSTRLSRWPSTHNSLATRSEAPFSMDNVKLSPKFRYTNPGALNA 1170
            TT  S + +++S     ST+ S    T +  +  S +  S  +V LS   + ++    ++
Sbjct: 294  TTLVSTISTSSSATTQSSTQSSTTSGTSSLSSEMSSSKSSASSVSLSSSSKVSSRTGFSS 353

Query: 1169 LPRIVE*PAINNSFSLSRDSSASNANTCSCLRS--GSDKGDGTYVSSRCGVFSRAK*AYN 996
                    +   + S ++ S +S +NT + L S  GS     T+ S     FS    A++
Sbjct: 354  TET-----SRATTVSETQHSLSSESNTPTTLTSIPGSLSTSATFSS-----FSST--AFS 401

Query: 995  PANCSEPSAARTLTCSANAYRSRISVLASRKRSTPSRWYLSSLQRCSKFAWNPADSTMKK 816
              + S P+A              +S L S   S  S+   S+L   + F   P+  T   
Sbjct: 402  SVSTSSPTA------------ESVSSLVSSTPSVGSQTS-STLTSSTSFPGVPSSVTSSG 448

Query: 815  RIE*PLGKRARYSGNGTACTRPCTNACSAFAGVP-----RPTE*AHALAVPSGSAYTVTP 651
             +          S +    T   TN+ S    +      R  E + +    S +  + TP
Sbjct: 449  NVPSSFSDIGTSSTSVLTTTYSTTNSGSTSITLTTDSSFRTLESSASSTPASSTPASSTP 508

Query: 650  APE-PRALTNSEIVVSPDITSTVVSDVRG---NVSASSRTLAAEEVRTYSCSTLSTANTG 483
            A   P + T +    +   T TV S + G   + + SS TL +        ST ST+ TG
Sbjct: 509  ASSTPASSTTASSTTASSTTVTVSSSLPGLNMSTTLSSSTLLSTTSPGQPISTASTS-TG 567

Query: 482  PITFA*KS-----------------------VAGSRPAPDRTESSTTSGPPGARASAPLP 372
            P+T    S                          S PAP  T +  +S    A  S  +P
Sbjct: 568  PLTIPTASNSLPVLLVSTSCTAANDTNCAVPTTDSAPAPTSTSTPPSSSSSNASKSEEVP 627

Query: 371  SRTASST 351
            S  ASS+
Sbjct: 628  SSAASSS 634

>KLTH0A00550g Chr1 complement(49572..53438) [3867 bp, 1288 aa] {ON}
            some similarities with uniprot|P08640 Saccharomyces
            cerevisiae YIR019C MUC1 GPI-anchored cell surface
            glycoprotein required for diploid pseudohyphal formation
            and haploid invasive growth transcriptionally regulated
            by the MAPK pathway (via Ste12p and Tec1p) and the cAMP
            pathway (via Flo8p)
          Length = 1288

 Score = 47.0 bits (110), Expect = 1e-04
 Identities = 88/369 (23%), Positives = 134/369 (36%), Gaps = 24/369 (6%)
 Frame = -2

Query: 1385 AGTSAFRPKEAGTTPTSMLPSNTSP-----GACRSTRLSRWPSTHNSLATRSEAPFSMDN 1221
            A +S+    E  +TP S  PS+++P       C++   S    +     T    P S   
Sbjct: 500  APSSSAPVSEFSSTPVSSAPSSSAPVSESSSTCQTVVTSTVSGSTTVYTTTCSTPVS--- 556

Query: 1220 VKLSPKFRYTNPGALNALPRIVE*PAINNSFSLSRDSSASNANTCSCLRSGSDKGDGTYV 1041
             + S     T P +   +      P  +   S +  S  S+    S   S +   + +  
Sbjct: 557  -ETSSTPETTAPSSSAPVSEFSSTPVSSAPSSSAPVSEFSSTPVSSAPSSSAPVSEFSST 615

Query: 1040 SSRCGVFSRAK*AYNPANCSEPSAARTLTCSANAYRSRISVLASRKRSTP------SRWY 879
                   S A  + + + C +     T++ S   Y +  S   S   STP      S   
Sbjct: 616  PVSSAPSSSAPVSESSSTC-QTVVTSTVSGSTTVYTTTCSTPVSETSSTPVSSAPSSSAP 674

Query: 878  LSSLQRCSKFAWN--PADSTMKKRIE*PLGKRARYSGNGTACTRPCTNACS----AFAGV 717
            +SS+   + +  N   A  T        L      SG+GT  T     A S    A +G 
Sbjct: 675  VSSVPHSTPYYHNTTTAAGTGSTSYPVSLSSTPVTSGSGTPATSGSVPATSGSVPATSGT 734

Query: 716  PRPTE*AHALAVPSGSAYTVTPAPEPRALTNSEIVVSPDITSTVVSDVRGNVSASSRTLA 537
            P     A + +VP+ S    TPA      T+  +      TS       G+V A+S T A
Sbjct: 735  P-----ATSGSVPATS--ETTPATSGTPATSGSV----PATSETTPATSGSVPATSGTPA 783

Query: 536  AE-EVRTYSCSTLSTANTGPITFA*KSVAGSRPAPDRTESST------TSGPPGARASAP 378
                V   S +T +T+ + P T    + +GS PA   T  +T      TSG P    S P
Sbjct: 784  TSGSVPATSETTPATSGSVPATSGTPATSGSVPATSETTPATSGSIPATSGTPATSGSVP 843

Query: 377  LPSRTASST 351
              S T  +T
Sbjct: 844  ATSETTPAT 852

>TBLA0D00480 Chr4 (118608..122372) [3765 bp, 1254 aa] {ON} 
          Length = 1254

 Score = 46.2 bits (108), Expect = 2e-04
 Identities = 74/356 (20%), Positives = 147/356 (41%), Gaps = 10/356 (2%)
 Frame = -2

Query: 1385 AGTSAFRPKEAGTTPTSMLPSNTSPGACR-STRLSRWPSTHNSLATRSEAPFSMDNVKLS 1209
            +G+S+       T+ +SM  S +S G+   S+  S   S+  S +  S  P ++ +   S
Sbjct: 533  SGSSSVPSTIPSTSDSSMSSSASSSGSSSASSSASSSASSSASSSGSSSVPSTIPSTSDS 592

Query: 1208 PKFRYTNPGALNALPRIV---E*PAINNSFSLSRDSSASNANTCSCLRSGSDKGDGTYVS 1038
                  +    +++P  +      ++++S S S  SSAS++ + S   SGS     +  S
Sbjct: 593  SMSSSASSSGSSSVPYTIPSTSDSSMSSSASSSGSSSASSSASSSASSSGSSSASSSASS 652

Query: 1037 SRCGVFSRAK*AYNPANCSEPSAARTLTCSANAYRSRISVLASRKRSTPSRWYLSSLQRC 858
            S          A +  + S PS   + + S+ +  +  S  +S   S  S    S+    
Sbjct: 653  S----------ASSSGSSSVPSTIPSTSDSSMSSSASSSGSSSASSSASS----SASSSA 698

Query: 857  SKFAWNPADSTMKKRIE*PLGKRARYSGNGTACTRPCTNACSAFAGVPRPTE*AHALAVP 678
            S    +   ST+    +  +   A  SG+ +A +   ++A S+ +        + + +VP
Sbjct: 699  SSSGSSSVPSTIPSTSDSSMSSSASSSGSSSASSSASSSASSSASS-------SGSSSVP 751

Query: 677  SGSAYTVTPAPEPRALTNSEIVVSPDITSTVVSDVRGNVSASSRTLAAEEVRTYSCSTLS 498
            S    T   +    A ++    V   I ST  S +  + S+S  + A+    + + S+ S
Sbjct: 752  STIPSTSDSSMSSSASSSGSSSVPYTIPSTSDSSMSSSASSSGSSSASSSASSSASSSAS 811

Query: 497  TANTGPITFA*KSVAGSRPAPDRTESSTTSGPPGARASA------PLPSRTASSTD 348
            ++ +  +     S + S  +   + S ++S    A +SA       +PS   S++D
Sbjct: 812  SSGSSSVPSTIPSTSDSSMSSSASSSGSSSASSSASSSASSSGSSSVPSTIPSTSD 867

 Score = 46.2 bits (108), Expect = 2e-04
 Identities = 76/351 (21%), Positives = 147/351 (41%), Gaps = 15/351 (4%)
 Frame = -2

Query: 1355 AGTTPTSMLPSNTSPGACRSTRLSRWPSTHNSLATRSEAPFSMDNVKLSPKFRYTNPGAL 1176
            +G++  S   S+++  +  S+  S  PST  S +  S +  S  +   S    YT P   
Sbjct: 725  SGSSSASSSASSSASSSASSSGSSSVPSTIPSTSDSSMS--SSASSSGSSSVPYTIPSTS 782

Query: 1175 NALPRIVE*PAINNSFSLSRDSSASNANTCSCLRSGSDKGDGTYVSSRCGVFSRAK*AYN 996
            ++        + ++S S S  SSAS++ + S   SGS     T  S+     S +  +  
Sbjct: 783  DSSMS----SSASSSGSSSASSSASSSASSSASSSGSSSVPSTIPSTSDSSMSSSASSSG 838

Query: 995  PANCSEPSAARTLTCSANAYRSRI------SVLASRKRSTPSRWYLSSLQRCSKFAWNPA 834
             ++ S  +++   +  +++  S I      S+ +S   S  S    S+    S    +  
Sbjct: 839  SSSASSSASSSASSSGSSSVPSTIPSTSDSSMSSSASSSASSSASSSASSSASSSGSSSV 898

Query: 833  DSTMKKRIE*PLGKRARYSGNGTACTRPCTNACSAFAGVPRPTE*AHALAVPSGSAYTVT 654
             ST+    +  +   A  SG+ +A +   ++A S+ +     +       +PS S  +++
Sbjct: 899  PSTIPSTSDSSMSSSASSSGSSSASSSASSSASSSASSSGSSSV---PSTIPSTSDSSMS 955

Query: 653  PAPEPRALTNSEIVVSPDITSTVVSDVRGNVSASSRTLAAEEVRTYSCST---------L 501
             +      ++    V   I ST  S +  + S+S  + A+    + + S+          
Sbjct: 956  SSASSSGSSSGSSSVPSTIPSTSDSSMSSSASSSGSSSASSSASSSASSSGSSSVPSTIP 1015

Query: 500  STANTGPITFA*KSVAGSRPAPDRTESSTTSGPPGARASAPLPSRTASSTD 348
            ST+++   + A  S++GSR AP  T  S       +R+S+   SR  SS+D
Sbjct: 1016 STSDSSMSSSASSSLSGSRFAPYTTSVS-------SRSSSSSASRFVSSSD 1059

 Score = 45.1 bits (105), Expect = 4e-04
 Identities = 69/335 (20%), Positives = 143/335 (42%)
 Frame = -2

Query: 1355 AGTTPTSMLPSNTSPGACRSTRLSRWPSTHNSLATRSEAPFSMDNVKLSPKFRYTNPGAL 1176
            A +TPTS   + T+     +T +   PS+ +S +    +  S  ++  S     T P   
Sbjct: 451  AVSTPTSSDIATTT----YTTSVPSGPSSASSSSASVPSSSSSTSISSSSSVPSTIPSTS 506

Query: 1175 NALPRIVE*PAINNSFSLSRDSSASNANTCSCLRSGSDKGDGTYVSSRCGVFSRAK*AYN 996
            ++        ++++S S S  SSAS++ + S   SGS     T  S+     S +    +
Sbjct: 507  DS--------SMSSSASSSGSSSASSSASSSASSSGSSSVPSTIPSTSDSSMSSSA---S 555

Query: 995  PANCSEPSAARTLTCSANAYRSRISVLASRKRSTPSRWYLSSLQRCSKFAWNPADSTMKK 816
             +  S  S++ + + S++A  S  S + S   ST      SS    S    +    T+  
Sbjct: 556  SSGSSSASSSASSSASSSASSSGSSSVPSTIPSTSDSSMSSS---ASSSGSSSVPYTIPS 612

Query: 815  RIE*PLGKRARYSGNGTACTRPCTNACSAFAGVPRPTE*AHALAVPSGSAYTVTPAPEPR 636
              +  +   A  SG+ +A +   ++A S+ +     +  + A +  S S  +  P+    
Sbjct: 613  TSDSSMSSSASSSGSSSASSSASSSASSSGSSSASSSASSSASSSGSSSVPSTIPSTSDS 672

Query: 635  ALTNSEIVVSPDITSTVVSDVRGNVSASSRTLAAEEVRTYSCSTLSTANTGPITFA*KSV 456
            ++++S    S   +S+  S    + S+S+ +  +  V +   ST  ++ +   + +  S 
Sbjct: 673  SMSSS---ASSSGSSSASSSASSSASSSASSSGSSSVPSTIPSTSDSSMSSSASSSGSSS 729

Query: 455  AGSRPAPDRTESSTTSGPPGARASAPLPSRTASST 351
            A S  +   + S+++SG     ++ P  S ++ S+
Sbjct: 730  ASSSASSSASSSASSSGSSSVPSTIPSTSDSSMSS 764

 Score = 37.0 bits (84), Expect = 0.13
 Identities = 57/283 (20%), Positives = 119/283 (42%), Gaps = 13/283 (4%)
 Frame = -2

Query: 1355 AGTTPTSMLPSNTSPGACRSTRLSRWPSTHNSLATRSEAPFSMDNVKLSPKFRYTNPGAL 1176
            + ++  S   S+++  +  S+  S  PST +S  + S +     +   S     ++ G+ 
Sbjct: 797  SASSSASSSASSSASSSGSSSVPSTIPSTSDSSMSSSASSSGSSSASSSASSSASSSGSS 856

Query: 1175 NALPRI--VE*PAINNSFSLSRDSSASNANTCSCLRSGSDKGDGTYVSSRCGVFSRAK*A 1002
            +    I      ++++S S S  SSAS++ + S   SGS     T  S+     S +  A
Sbjct: 857  SVPSTIPSTSDSSMSSSASSSASSSASSSASSSASSSGSSSVPSTIPSTSDSSMSSS--A 914

Query: 1001 YNPANCSEPSAARTLTCSANAYRSRISVLASRKRSTPSRWYLSSLQRCSKFAWNPADSTM 822
             +  + S  S+A +   S+ +     SV ++   ++ S    S+    S    +   ST+
Sbjct: 915  SSSGSSSASSSASSSASSSASSSGSSSVPSTIPSTSDSSMSSSASSSGSSSGSSSVPSTI 974

Query: 821  KKRIE*PLGKRARYSGNGTACTRPCTNACSAFAG-----VPRPTE*AHALAVPSG----- 672
                +  +   A  SG+ +A +   ++A S+ +      +P  ++ + + +  S      
Sbjct: 975  PSTSDSSMSSSASSSGSSSASSSASSSASSSGSSSVPSTIPSTSDSSMSSSASSSLSGSR 1034

Query: 671  -SAYTVTPAPEPRALTNSEIVVSPDITSTVVSDVRGNVSASSR 546
             + YT + +    + + S  V S D+++T VS     +S   R
Sbjct: 1035 FAPYTTSVSSRSSSSSASRFVSSSDLSTTSVSSGSSGLSGYMR 1077

 Score = 33.5 bits (75), Expect = 1.6
 Identities = 68/355 (19%), Positives = 146/355 (41%), Gaps = 19/355 (5%)
 Frame = -2

Query: 1355 AGTTPTSMLPSNTSPGACRSTRLSRWPST-HNSLATRSEAPFSMDNVKLS-PKFRYTNP- 1185
            A TT T+ +PS  S  +  S  +   PS+  +S A+    P S  +  +S P    T P 
Sbjct: 327  ATTTYTTSVPSGPSSASSSSASVPSGPSSASSSSASVPSGPSSASSSSVSAPSSSVTVPT 386

Query: 1184 ---GALNALPRIVE*PAINNSFSLSRDSSASNANTC--SCLRSGSDKGDGTYVSSRCGVF 1020
                  ++   ++  P + ++ + +     ++ N C  S  ++ +   +     + C V 
Sbjct: 387  HPTAPSSSTSSVITSPGLPHTTTYT-----THYNGCGPSVSKTFNTVIETHCYQTDCTVI 441

Query: 1019 SRAK*AYNPANCSEPSAARTLTCSANAYRSRISVLASRKRSTPSRWYLSSLQRCSKFAWN 840
             + +   + A  +  S+    T    +  S  S  +S   S PS    +S+   S     
Sbjct: 442  VKYEVCESTAVSTPTSSDIATTTYTTSVPSGPSSASSSSASVPSSSSSTSISSSSS---- 497

Query: 839  PADSTMKKRIE*PLGKRARYSGNGTACTRPCTNACSAFAG-----VPRPTE*AHALAVPS 675
               ST+    +  +   A  SG+ +A +   ++A S+ +      +P  ++ + + +  S
Sbjct: 498  -VPSTIPSTSDSSMSSSASSSGSSSASSSASSSASSSGSSSVPSTIPSTSDSSMSSSASS 556

Query: 674  GSAYTVTPAPEPRALTNSEIVVSPDITSTVVSDVRGNVSASSRTLAAEEV-----RTYSC 510
              + + + +    A +++    S  + ST+ S    ++S+S+ +  +  V      T   
Sbjct: 557  SGSSSASSSASSSASSSASSSGSSSVPSTIPSTSDSSMSSSASSSGSSSVPYTIPSTSDS 616

Query: 509  STLSTANTGPITFA*KSVAGSRPAP-DRTESSTTSGPPGARASAPLPSRTASSTD 348
            S  S+A++   + A  S + S  +    + SS+ S    +  S+ +PS   S++D
Sbjct: 617  SMSSSASSSGSSSASSSASSSASSSGSSSASSSASSSASSSGSSSVPSTIPSTSD 671

>Kwal_33.13192 s33 complement(114016..116415) [2400 bp, 799 aa] {ON}
            YIL011W (TIR3) -  [contig 121] FULL
          Length = 799

 Score = 43.9 bits (102), Expect = 9e-04
 Identities = 87/349 (24%), Positives = 141/349 (40%), Gaps = 15/349 (4%)
 Frame = -2

Query: 1355 AGTTPTSMLPSNTSPGACRSTRLSRWPSTHNSLATRSEAP----FSMDNVKLSPKF---- 1200
            A + P S  PS+++  +      +   S+  S +  S AP    FS+     S       
Sbjct: 310  ASSAPISSAPSSSASASNTQASSTLITSSIISSSPISSAPISSSFSIPRSSYSRSVWYSN 369

Query: 1199 ----RYTNPGALNALPRIVE*PAINNSFSLSRDSSASNANTCSCLRSGSDKGDGTYVS-- 1038
                RY++   L +LP      +   S S S  S+ S++   S   S S+       S  
Sbjct: 370  TTTNRYSSTNQLTSLPSSSAPSSSEPSSSASSSSAPSSSEPSSSAPSSSEPSSSAPSSSA 429

Query: 1037 -SRCGVFSRAK*AYNPANCSEPSAARTLTCSANAYRSRISVLASRKRSTPSRWYLSSLQR 861
             S     S A  ++ P++ S PS++   +   ++     S  +S   S PS    SS   
Sbjct: 430  PSSSAPSSSAPSSFAPSS-SAPSSSEPSSSEPSSSEPSSSAPSS---SAPSSSAPSSFAP 485

Query: 860  CSKFAWNPADSTMKKRIE*PLGKRARYSGNGTACTRPCTNACSAFAGVPRPTE*AHALAV 681
             S    + A S+       P       S +  + + P ++A S+ A    P+  A + + 
Sbjct: 486  SSSAPSSSAPSSSAPSSSAP-------SSSAPSSSAPSSSAPSSSA----PSSSAPSSSA 534

Query: 680  PSGSAYTVTPAPEPRALTNSEIVVSPDITSTVVSDVRGNVSASSRTLAAEEVRTYSCSTL 501
            PS SA + + AP   A ++S    S   +S   S    + S+SS TL+  E  T   S  
Sbjct: 535  PSSSAPS-SSAPSSSAPSSSAPSSSAPSSSAPSSSAPSSASSSSATLSTAESTTSLASDP 593

Query: 500  STANTGPITFA*KSVAGSRPAPDRTESSTTSGPPGARASAPLPSRTASS 354
             TA+      A K+ + S  +P  T SS++S    A  S  L + TAS+
Sbjct: 594  ITASE-----AAKTTSFSSQSPTSTTSSSSS---SASTSTTLDAATASA 634

 Score = 38.5 bits (88), Expect = 0.041
 Identities = 78/344 (22%), Positives = 134/344 (38%), Gaps = 10/344 (2%)
 Frame = -2

Query: 1352 GTTPTSMLPSNTSPGACRSTRLSRWPSTHNSLATRSEAPFSMDNVKLSPKFRYTNPGALN 1173
            G+T  + +P ++SP        +   S   S A  S AP S      +P           
Sbjct: 181  GSTSITSIPGSSSPITSEPASSAPASSAAGSSAPGSSAPTSSAPASSAPASSVPASSVPA 240

Query: 1172 ALPRIVE*PAINNSFSLSRDSSASNANT------CSCLRSGSDKGDGTYVSSRCGVFSRA 1011
            +       PA +   S +  SS   ++        S   + S  G  T  SS  G  + A
Sbjct: 241  SSTPESSVPASSAPASSAPGSSVPTSSALGSSVPASSAPASSAPGSSTPASSTPGSSTPA 300

Query: 1010 K*AY--NPANCSEP--SAARTLTCSANAYRSRISVLASRKRSTPSRWYLSSLQRCSKFAW 843
              AY  + A  S P  SA  +   ++N   S   + +S   S+P    +SS    S F  
Sbjct: 301  SSAYVSSSAASSAPISSAPSSSASASNTQASSTLITSSIISSSP----ISSAPISSSF-- 354

Query: 842  NPADSTMKKRIE*PLGKRARYSGNGTACTRPCTNACSAFAGVPRPTE*AHALAVPSGSAY 663
            +   S+  + +        RYS      + P ++A S+      P+  A + + PS S  
Sbjct: 355  SIPRSSYSRSVWYSNTTTNRYSSTNQLTSLPSSSAPSS----SEPSSSASSSSAPSSSEP 410

Query: 662  TVTPAPEPRALTNSEIVVSPDITSTVVSDVRGNVSASSRTLAAEEVRTYSCSTLSTANTG 483
            + + AP     ++S    S   +S   S    + + SS   ++ E  +   S+   +++ 
Sbjct: 411  S-SSAPSSSEPSSSAPSSSAPSSSAPSSSAPSSFAPSSSAPSSSEPSSSEPSSSEPSSSA 469

Query: 482  PITFA*KSVAGSRPAPDRTESSTTSGPPGARASAPLPSRTASST 351
            P + A  S A S  AP  + + ++S P  +  S+  PS +A S+
Sbjct: 470  PSSSAPSSSAPSSFAPS-SSAPSSSAPSSSAPSSSAPSSSAPSS 512

>Suva_3.125 Chr3 (184846..189843) [4998 bp, 1665 aa] {ON} YCR089W
            (REAL)
          Length = 1665

 Score = 43.5 bits (101), Expect = 0.001
 Identities = 77/297 (25%), Positives = 116/297 (39%), Gaps = 22/297 (7%)
 Frame = -2

Query: 1175 NALPRIVE*PAINNSFSLSRDS--------SASNANTCSCLRSGSDKGDGTYVSSRCGVF 1020
            +ALP  +E   I   FS SR+S        SAS   + S   SGS+    T +SS  G+ 
Sbjct: 226  SALPNSMEYSTI---FSKSRESNSISSSTTSASTTTSVSTSLSGSESYGDTTISSLSGLP 282

Query: 1019 SRAK*AYNPANCSEPSAARTLTCSANAYRSRI----------SVLASRKRSTPSRWYLSS 870
            S A      A+  + S+      S+++  S +           V +S   STP+    SS
Sbjct: 283  SSASSLQTSASSIKTSSVPQSVFSSDSMSSTVQMTTSSPKLNEVYSSSSISTPADITSSS 342

Query: 869  L----QRCSKFAWNPADSTMKKRIE*PLGKRARYSGNGTACTRPCTNACSAFAGVPRPTE 702
            L    +  S  + N +DS +            R SGN  A T            VP    
Sbjct: 343  LIPTSELSSVISMNTSDSVIS-----DFSASTRASGNSPASTL-----------VPTTLY 386

Query: 701  *AHALAVPSGSAYTVTPAPEPRALTNSEIVVSPDITSTVVSDVRGNVSASSRTLAAEEVR 522
             + A A+ S  A +++      +   SE + +  +  T  S+    V+A+S T  +  + 
Sbjct: 387  DSSAQALSSSHASSIS------STATSEYLSTSSLDRTTESE---TVNATSTTSISTSI- 436

Query: 521  TYSCSTLSTANTGPITFA*KSVAGSRPAPDRTESSTTSGPPGARASAPLPSRTASST 351
              + ST S  +   + F   S AGS      T  STTS    A + A      +SST
Sbjct: 437  --TLSTASATSEDSVNFTAFSSAGSLTNNSTTHDSTTSITTPATSEATKQQDGSSST 491

>ZYRO0C03432g Chr3 complement(266809..273399) [6591 bp, 2196 aa] {ON}
            some similarities with uniprot|P42835 Saccharomyces
            cerevisiae YNL327W EGT2 Glycosylphosphatidylinositol
            (GPI)- anchored cell wall endoglucanase required for
            proper cell separation after cytokinesis expression is
            activated by Swi5p and tightly regulated in a cell
            cycle-dependent manner
          Length = 2196

 Score = 43.1 bits (100), Expect = 0.002
 Identities = 79/365 (21%), Positives = 138/365 (37%), Gaps = 20/365 (5%)
 Frame = -2

Query: 1385 AGTSAFRPKEAGTTPTSMLPSNTSPGACRSTRLSRWPSTHNSLATRSEAPFSMDNVKLSP 1206
            A +S+F      T P+S    N+S     S+      S  NS AT   +    ++   +P
Sbjct: 827  APSSSFIQNSTTTAPSSSAFYNSSSPVTASSTAPSSSSFQNSTATAPSSSAFQNSTTTAP 886

Query: 1205 KFR--YTNPGALNALPRIVE*PAINNSFSLSRDSSASNANTCSCLRSGSDKGDGTYVSSR 1032
                 Y +   + A        +  NS + +  SSA   +T + L S +     + V++ 
Sbjct: 887  SSSAFYNSSSPVTASSTAPSSSSFQNSTTTAPSSSAFQNSTATALSSSAFYNSSSPVTAS 946

Query: 1031 CGVFSRAK*AYNPANCSEPSAARTLTCSANA----YRSRISVLASRKRSTPSRWYLSSLQ 864
                S +    +       SA +  T +A +    Y S   V AS    T S +  S+  
Sbjct: 947  TTAPSSSSFQNSTTTAPSSSAFQNSTTTAPSSSVFYNSSSPVTASSTAPTSSSFQNSTTA 1006

Query: 863  RCSKFAWNPADSTMKKRIE*PLGKRARYSGNGTACTRPCTNACSAFAGVPRPTE*AHALA 684
              S  A+  + S +              + + TA T       +A A             
Sbjct: 1007 APSGSAFYNSSSPV--------------TASSTAPTSSSFQNSTATA------------- 1039

Query: 683  VPSGSAY--TVTPAPEPRALTNSEIVVSPDITSTVVSDVRGNVSA---------SSRTLA 537
             PS SA+  + T AP      NS   V+   T+   S  + + +A         S+ T  
Sbjct: 1040 -PSSSAFQNSTTAAPSSSVFYNSSSPVTASSTAPSSSAFQNSTTAAPSSSVFQNSTTTAP 1098

Query: 536  AEEVRTYSCSTLSTANTGPITFA*KSVAGSRPAPDRTESSTTSGPPGA---RASAPLPSR 366
            +  V   S S ++ ++T P + + ++   + P+    ++STT+ P  +    +S+P+   
Sbjct: 1099 SSSVFYNSSSPVTASSTAPTSSSFQNSTATAPSSSVFQNSTTTAPSSSVFYNSSSPV--- 1155

Query: 365  TASST 351
            TASST
Sbjct: 1156 TASST 1160

 Score = 42.0 bits (97), Expect = 0.004
 Identities = 80/381 (20%), Positives = 150/381 (39%), Gaps = 36/381 (9%)
 Frame = -2

Query: 1385 AGTSAFRPKEAGTTPTSMLPSNTSPGACRSTRLSRWPSTHNSLATRSEAPFSMDNVKLSP 1206
            A +S+ +   A    TS+ P++ S  A  ST      S+  S  T S +  +  ++  S 
Sbjct: 536  ASSSSSQVPAASANSTSVAPTSGSSIAPNST------SSQQSTITSSASNSTSSSITASS 589

Query: 1205 KFRYTNPG-ALNALPR-----------IVE*PAINNSFSLSRDSSASNA----NTCSCLR 1074
                ++P  A +A P            +    A N+S  ++  S+A  +    NT S + 
Sbjct: 590  ASNSSSPATASSAAPSSGFVQNSTSSSVTASSASNSSSPVTTSSAAPTSSVLYNTTSPVT 649

Query: 1073 SGSDKGDGTYVSSRCGVFSRAK*AYN-----------PANCSEPSAARTLTCSANAYRSR 927
            + S     +++ +       +   YN           P + S  ++  T   S++ Y S 
Sbjct: 650  ASSTAPSSSFIQNSTTTAPSSSDFYNSSSPVTASSTAPTSSSFQNSTTTALSSSDFYNSS 709

Query: 926  ISVLASRKRSTPSRWYLSSLQRCSKFAWNPADSTMKKRIE*PLGKRARYSGNGTACTRPC 747
              V AS      S +  S+    S   +  + S +      P     + S      +   
Sbjct: 710  SPVTASSTAPISSAFQNSTTTAPSSSDFYNSSSPVTASSTAPTSSAFKNSTTTAPSSSAF 769

Query: 746  TNACS---AFAGVPRPTE*AHALAV-PSGSAY--TVTPAPEPRALTNSEIVVSPDITSTV 585
             N+ S   A +  P  +   ++ A  PS SA+  + T AP   A  NS    S  +T++ 
Sbjct: 770  YNSSSPVTASSTAPTSSSFQNSTATAPSSSAFQNSTTTAPSSSAFYNS----SSPVTASS 825

Query: 584  VSDVRGNVSASSRTLAAEEVRTYSCSTLSTANTGPITFA*KSVAGSRPAPDRTESSTTSG 405
             +     +  S+ T  +      S S ++ ++T P + + ++   + P+    ++STT+ 
Sbjct: 826  TAPSSSFIQNSTTTAPSSSAFYNSSSPVTASSTAPSSSSFQNSTATAPSSSAFQNSTTTA 885

Query: 404  PPGA---RASAPLPSRTASST 351
            P  +    +S+P+   TASST
Sbjct: 886  PSSSAFYNSSSPV---TASST 903

 Score = 36.6 bits (83), Expect = 0.18
 Identities = 75/354 (21%), Positives = 140/354 (39%), Gaps = 9/354 (2%)
 Frame = -2

Query: 1385 AGTSAFRPKEAGTTPTSMLPSNTSPGACRSTRLSRWPSTHNSLATRSEAPF-SMDNVKLS 1209
            A +S+ +        TS+ P++ S  A  ST   +   T  + ++ S+ P  S ++  ++
Sbjct: 495  ASSSSSQVPATSANSTSVAPTSGSSIAPNSTSSQQSTITSEASSSSSQVPAASANSTSVA 554

Query: 1208 PKFRYT-NPGALNALPRIVE*PAINNSFSLSRDSSASNANTCSCLRSGSDKGDGTYVSSR 1032
            P    +  P + ++    +   A N++ S    SSASN+++ +   S +        S+ 
Sbjct: 555  PTSGSSIAPNSTSSQQSTITSSASNSTSSSITASSASNSSSPATASSAAPSSGFVQNSTS 614

Query: 1031 CGVFSRAK*AYNPANCSEP----SAARTLTCSANAYRSRISVLASRKRSTPSRWYLSSLQ 864
              V      A + +N S P    SAA T   S+  Y +   V AS    + S    S+  
Sbjct: 615  SSVT-----ASSASNSSSPVTTSSAAPT---SSVLYNTTSPVTASSTAPSSSFIQNSTTT 666

Query: 863  RCSKFAWNPADSTMKKRIE*PLGKRARYSGNGTACTRPCTNACSAFAGVPRPTE*AHALA 684
              S   +  + S +      P     + S      +    N+ S       P   +    
Sbjct: 667  APSSSDFYNSSSPVTASSTAPTSSSFQNSTTTALSSSDFYNSSS-------PVTASSTAP 719

Query: 683  VPSGSAYTVTPAPEPRALTNSEIVVSPDITSTVVSDVRGNVSASSRTLAAEEVRTYSCST 504
            + S    + T AP      NS   V+   T+   S  +     S+ T  +      S S 
Sbjct: 720  ISSAFQNSTTTAPSSSDFYNSSSPVTASSTAPTSSAFKN----STTTAPSSSAFYNSSSP 775

Query: 503  LSTANTGPITFA*KSVAGSRPAPDRTESSTTSGPPGA---RASAPLPSRTASST 351
            ++ ++T P + + ++   + P+    ++STT+ P  +    +S+P+   TASST
Sbjct: 776  VTASSTAPTSSSFQNSTATAPSSSAFQNSTTTAPSSSAFYNSSSPV---TASST 826

>Suva_7.296 Chr7 (508904..512311) [3408 bp, 1135 aa] {ON} YGR014W
            (REAL)
          Length = 1135

 Score = 42.7 bits (99), Expect = 0.002
 Identities = 80/322 (24%), Positives = 124/322 (38%), Gaps = 7/322 (2%)
 Frame = -2

Query: 1058 GDGTYVS---SRCGVFSRAK*AYNPANCSEPSAARTLTCSANAYRSRISVLASRKRSTPS 888
            G+GTY S   ++  + S        +  SE ++++T     +++RS   V A+   S PS
Sbjct: 29   GNGTYASQSKTQDSLTSVVSQDTTTSIASEEASSQT----THSHRSATLVTATIS-SLPS 83

Query: 887  RWY----LSSLQRCSKFAWNPADSTMKKRIE*PLGKRARYSGNGTACTRPCTNACSAFAG 720
             WY     + L   S  A+  A                +Y+ + +  T+P  +A  +FA 
Sbjct: 84   TWYSADSTTQLSASSSTAYAYASD--------------QYTWSSSVDTQPTASADDSFAA 129

Query: 719  VPRPTE*AHALAVPSGSAYTVTPAPEPRALTNSEIVVSPDITSTVVSDVRGNVSASSRTL 540
                T    A    S S  + T             VVS +  ST +S     V ASS +L
Sbjct: 130  KSSTTTNFAASGFDSASDVSTTSV---------YTVVSANSISTTISPTTTPVEASSTSL 180

Query: 539  AAEEVRTYSCSTLSTANTGPITFA*KSVAGSRPAPDRTESSTTSGPPGARASAPLPSRTA 360
             +E       ST +T +   ++ +  S+  +  +PD +ES    G      S PL +  A
Sbjct: 181  TSE---IPIISTSTTPSAAMVSSSEASIMATATSPDNSES---FGETSTAESTPLAASGA 234

Query: 359  SSTDRXXXXXXXXXXXXXXXXLQNNSVSFMSPAATPVSCLPRLPHFFAAREPLAAIAATD 180
            S+T                  LQ+++V   S A+T VS     P   A   PL +   T 
Sbjct: 235  STT-----------------LLQSSTVDDSSSASTVVS-----PSISAV--PLQSSTETT 270

Query: 179  DTNGPHTVCTQCLARPRQRTNS 114
             T+   TV       P Q T S
Sbjct: 271  STDSSITVSPSVSTVPLQATTS 292

>Kpol_1058.5 s1058 complement(24653..28423) [3771 bp, 1256 aa] {ON}
            complement(24653..28423) [3771 nt, 1257 aa]
          Length = 1256

 Score = 42.7 bits (99), Expect = 0.002
 Identities = 61/294 (20%), Positives = 123/294 (41%), Gaps = 3/294 (1%)
 Frame = -2

Query: 1223 NVKLSPKFRYTNPGALNALPRIVE*PAINNSFSLSRDSSASNANTCSCLRSGSDKGDGTY 1044
            N++    F ++N  A  +   +     + +S +++  S A+++ + +   S S+      
Sbjct: 52   NLRAVEPFSFSNTTATASSSSVASSLEVTSSEAVTSSSEAASSESVT---SSSEAASSES 108

Query: 1043 VSSRCGVFSRAK*AYNPANCSEPSAARTLTCSANAYRSRISVLASRKRSTPSRWYLSSLQ 864
            V+S     S A  + +  + SE +++ ++T S+ A  S  SV +S + ++      SS  
Sbjct: 109  VTSS----SEAASSESVTSSSEAASSESVTSSSEAASSE-SVTSSSEAASSEAATSSSEA 163

Query: 863  RCSKFAWNPADSTMKKRIE*PLGKRARYSGNGTACTRPCTN---ACSAFAGVPRPTE*AH 693
              S+   + +++   + +       A  S + T+ +   T+   A S+ A    P   + 
Sbjct: 164  ASSESVTSSSEAASSESVT--SSSEAASSESVTSSSESATSSSEAASSEAASSEPVTSSS 221

Query: 692  ALAVPSGSAYTVTPAPEPRALTNSEIVVSPDITSTVVSDVRGNVSASSRTLAAEEVRTYS 513
              A       +   A    A ++SE   S  +TS+  S    + +ASS   ++E V + S
Sbjct: 222  EAASSESVTSSSEAASSEAATSSSEAASSEPVTSSSESATSSSEAASSEAASSEPVTSSS 281

Query: 512  CSTLSTANTGPITFA*KSVAGSRPAPDRTESSTTSGPPGARASAPLPSRTASST 351
             +  S A T          A S P    +ES+T+S    +  +A     T+ S+
Sbjct: 282  EAASSEAATSS-----SEAASSEPVTSSSESATSSSEAASSEAASSEPVTSESS 330

 Score = 37.0 bits (84), Expect = 0.13
 Identities = 65/289 (22%), Positives = 121/289 (41%), Gaps = 9/289 (3%)
 Frame = -2

Query: 1325 SNTSPGACRSTRLSRWPSTHNSLATRSEAPFSMDNVKLSPKFRYTNPGALNALPRIVE*P 1146
            SNT+  A  S+  S    T +   T S    S ++V  S +   +     ++     E  
Sbjct: 62   SNTTATASSSSVASSLEVTSSEAVTSSSEAASSESVTSSSEAASSESVTSSSEAASSE-S 120

Query: 1145 AINNSFSLSRDS--SASNANTCSCLRSGSDKGDGTYVSSRCGVFSRAK*AYNPANCSEPS 972
              ++S + S +S  S+S A +   + S S+       +S     S A  + +  + SE +
Sbjct: 121  VTSSSEAASSESVTSSSEAASSESVTSSSEAASSEAATSS----SEAASSESVTSSSEAA 176

Query: 971  AARTLTCSANAYRSRISVLASRKRSTPSRWYLSSLQRCSKFAWNPADSTMKKRI---E*P 801
            ++ ++T S+ A  S  SV +S + +T S    SS    S+   + +++   + +      
Sbjct: 177  SSESVTSSSEAASSE-SVTSSSESATSSSEAASSEAASSEPVTSSSEAASSESVTSSSEA 235

Query: 800  LGKRARYSGNGTACTRPCTNACSAFAGVPRPTE*AHALAVPSGSAYTVTPAPEPR----A 633
                A  S +  A + P T++  +       T  + A +  + S+  VT + E      A
Sbjct: 236  ASSEAATSSSEAASSEPVTSSSES------ATSSSEAASSEAASSEPVTSSSEAASSEAA 289

Query: 632  LTNSEIVVSPDITSTVVSDVRGNVSASSRTLAAEEVRTYSCSTLSTANT 486
             ++SE   S  +TS+  S    + +ASS   ++E V + S    ST  T
Sbjct: 290  TSSSEAASSEPVTSSSESATSSSEAASSEAASSEPVTSESSIVASTNAT 338

>TBLA0A10760 Chr1 complement(2665056..2672045) [6990 bp, 2329 aa] {ON}
            
          Length = 2329

 Score = 42.7 bits (99), Expect = 0.002
 Identities = 78/357 (21%), Positives = 135/357 (37%), Gaps = 14/357 (3%)
 Frame = -2

Query: 1379 TSAFRPKEAGTTPTSMLPSNTSPGACRSTRLSRWPSTHNSLATRSEAPFSMDNVKLSPKF 1200
            +S+     +   P+S + S+ S  A  S+  S   S   S +  S A     +  ++   
Sbjct: 1314 SSSVASSASSGAPSSSVASSASNAAASSSVASSASSAAASSSVASSACSGAPSSSVASSA 1373

Query: 1199 RYTNPGALNALPRIVE*PAINNSFSLSRDSSASNANTCSCLRSGSDKGDGTYVSSRCGVF 1020
                P +  A       P+  +S + S  S+A ++   S   S +        +S   V 
Sbjct: 1374 SSATPSSSVASSATSAVPS--SSVASSASSAAPSSRVASAASSAAASSSVASSASSAVVS 1431

Query: 1019 SRAK*AYNPANCSEPSAA--RTLTCSANAYRSRISVLASRKRSTPSRWYLSSLQRCSKFA 846
            S A  + +    S  SAA   ++ CS+++     SV  S     PS    SS    +   
Sbjct: 1432 STAASSTSSGASSASSAAVSSSVACSSSSSNPSSSVAYSASSGAPSSSVGSSASSGA--- 1488

Query: 845  WNPADSTMKKR-IE*PLGKRARYSGNGTACTRPCTNACS----------AFAGVPRPTE* 699
              P+ S +    I  P    A  + +  A +   ++ACS          A +  P  +  
Sbjct: 1489 --PSSSVVSSASIAAPSSSVASSASSAAASSSVASSACSGAPSSSVASSASSATPSSSVA 1546

Query: 698  AHAL-AVPSGSAYTVTPAPEPRALTNSEIVVSPDITSTVVSDVRGNVSASSRTLAAEEVR 522
            + A  AVPS +  +   +  P +   S    S    S+ V+    +   SS   ++    
Sbjct: 1547 SSATSAVPSSNDASSASSGAPSSRVAS--AASSGAPSSSVASAASSAGPSSSDASSASSA 1604

Query: 521  TYSCSTLSTANTGPITFA*KSVAGSRPAPDRTESSTTSGPPGARASAPLPSRTASST 351
              S S  S+A++   + +  S A S        SS +SG P +R ++   S  ASS+
Sbjct: 1605 VPSSSVASSASSAAPSSSVASSATSAVPSSNDASSASSGAPSSRVASAASSAAASSS 1661

 Score = 31.6 bits (70), Expect = 6.4
 Identities = 69/359 (19%), Positives = 137/359 (38%), Gaps = 14/359 (3%)
 Frame = -2

Query: 1385 AGTSAFRPKEAGTTPTSMLPSNTSPGA----CRSTRLSRWPSTHNSLATRSEAPFS-MDN 1221
            A +S+     +   P+S + S+ S GA      S   S  PS+  + +  S AP S   +
Sbjct: 1004 APSSSVASSASSAVPSSSVGSSASSGAPSSIVASAASSATPSSSVASSASSGAPSSSFGS 1063

Query: 1220 VKLSPKFRYTNPGALNALPRIVE*PAINNSFSLSRDSSASNANTCSCLRSGSDKGDGTYV 1041
               S     ++  A +++        ++++ + S  S AS+A++ +   SG+        
Sbjct: 1064 SASSGASSASSAAASSSVASSASSAVVSSTAASSASSGASSASSAAASSSGASSASSAVP 1123

Query: 1040 SSR------CGVFSRAK*AYNPANCSEPSAARTLTCSANAYRSRI---SVLASRKRSTPS 888
            SS        G  S +  +   +  S  S+A   +  A++  S +   +  +S     PS
Sbjct: 1124 SSNDASSASSGAPSSSVASSASSGASSASSAAASSSGASSASSAVPSPNDASSASSGVPS 1183

Query: 887  RWYLSSLQRCSKFAWNPADSTMKKRIE*PLGKRARYSGNGTACTRPCTNACSAFAGVPRP 708
                SS    +  A + A   +   +   +        + ++ T   + A SA +G    
Sbjct: 1184 SSVASSASSGASSASSAAHPQVLHLLLLVVLHPPSVGSSASSATPSSSVASSASSG---- 1239

Query: 707  TE*AHALAVPSGSAYTVTPAPEPRALTNSEIVVSPDITSTVVSDVRGNVSASSRTLAAEE 528
                      + S+   + A    A ++     S  + S+ V+    + + SS       
Sbjct: 1240 ----------AASSSVASSASSAAASSSDASSASSGVPSSSVASFASSGAPSS------S 1283

Query: 527  VRTYSCSTLSTANTGPITFA*KSVAGSRPAPDRTESSTTSGPPGARASAPLPSRTASST 351
            V + + S  S+A++   + +  S A S        SS +SG P +  ++   +  ASS+
Sbjct: 1284 VASSASSGASSASSAAASSSDASSASSAVPSSSVASSASSGAPSSSVASSASNAAASSS 1342

>KLTH0C09196g Chr3 complement(763731..765050) [1320 bp, 439 aa] {ON}
            some similarities with uniprot|Q12215 Saccharomyces
            cerevisiae YOL105C WSC3 cell wall integrity and stress
            response component 3 Putative integral membrane protein
            containing novel cysteine motif. Similarity to SLG1
            (WSC1) WSC2 and WSC4
          Length = 439

 Score = 42.0 bits (97), Expect = 0.003
 Identities = 49/219 (22%), Positives = 92/219 (42%), Gaps = 12/219 (5%)
 Frame = -2

Query: 1094 NTCSC----LRSGSDKGDGTYVSSRCGVF-------SRAK*AYNPANCSEPSAARTLTCS 948
            NTC C       G+  GD +  +++C  +       S     Y     S PSA+ + + S
Sbjct: 73   NTCYCGDASALGGASSGDSSNCNTKCAGWPYDTCGGSGYMQVYVREGVSVPSASASSSAS 132

Query: 947  ANAYRSRISVLASRKRSTPSRWYLSSLQRCSKFAWNPADSTMKKRIE*PLGKRARYSGNG 768
            +++  S  S  ++   S+ S    SS    S+ +   + +T            +  S + 
Sbjct: 133  SSSASSTSSSTSTSTSSSSSSSTKSSTSSSSQSSTTSSSTTRSSSTS----ASSSSSSSS 188

Query: 767  TACTRPCTNACSAFAGVPRPTE*AHALAVPSGSAYTVTPAPEPRALTNSEIVVSPDITST 588
            T+ +   T++    +     T  A + + PS S+   + +P   + ++S    +P  TS+
Sbjct: 189  TSSSASSTSSSDTSSSTSAATSSASSSSSPSSSSQPSSSSPASSSTSSS---ATPSSTSS 245

Query: 587  VVSDVRG-NVSASSRTLAAEEVRTYSCSTLSTANTGPIT 474
             VS     +VSA+S TL+   + T S S ++ +N    T
Sbjct: 246  TVSATNSPSVSATSVTLSRTTMVTASVSVVTLSNNNRST 284

>YIR019C Chr9 complement(389572..393675) [4104 bp, 1367 aa] {ON}
            MUC1GPI-anchored cell surface glycoprotein (flocculin);
            required for pseudohyphal formation, invasive growth,
            flocculation, and biofilms; transcriptionally regulated
            by the MAPK pathway (via Ste12p and Tec1p) and the cAMP
            pathway (via Flo8p); required for the formation of
            fibrous interconnections between cells in a colony of a
            wild S. cerevisiae strain
          Length = 1367

 Score = 42.4 bits (98), Expect = 0.003
 Identities = 79/356 (22%), Positives = 141/356 (39%), Gaps = 13/356 (3%)
 Frame = -2

Query: 1376 SAFRPKEAGTTPTSMLPSNTSPGACRSTRLSRWPSTHNSLATRSEAPF-----SMDNVKL 1212
            S+  P  + TT +S  P  T   +  +T  S  P T +S    S AP      S      
Sbjct: 441  SSSAPVTSSTTESSSAPVPTPSSS--TTESSSAPVT-SSTTESSSAPVPTPSSSTTESSS 497

Query: 1211 SPKFRYTNPGALNALPRIVE*PAINNSFSLSRDSSASNANTCSCLRSGSDKGDGTYVSSR 1032
            +P    T   +   +P        ++S      SS++  ++ + + S + +     V + 
Sbjct: 498  APVTSSTTESSSAPVPTPSSSTTESSSAPAPTPSSSTTESSSAPVTSSTTESSSAPVPTP 557

Query: 1031 CGVFSRAK*AYNPANCSEPSAARTLTCSANAYRSRISVLASRKRSTPSRWYLSSLQRCSK 852
                + +      ++ +E S+A   T S++   S     +S    TPS    S+ +  S 
Sbjct: 558  SSSTTESSSTPVTSSTTESSSAPVPTPSSSTTES-----SSAPVPTPSS---STTESSSA 609

Query: 851  FAWNPADSTMKKRIE*PLGKRARYSGNGTACTRPCTNACSAFAGVPRPTE*AHALAVPSG 672
             A  P+ ST +     P+      S +    T   +   S+ A VP           PS 
Sbjct: 610  PAPTPSSSTTESSSA-PVTSSTTESSSAPVPTPSSSTTESSSAPVP----------TPSS 658

Query: 671  SAYTVTPAPEPRALTNSEIVVSPDITSTVVSDVRGNVSASSRTLAAEEVRTYSCSTLSTA 492
            S    + AP P   +++    S  +TS+        V++S+   ++  V T S ST + +
Sbjct: 659  STTESSSAPVPTPSSSTTESSSAPVTSSTTESSSAPVTSSTTESSSAPVPTPSSST-TES 717

Query: 491  NTGPITFA*KSVAGSRPAPDRTESSTTSGPPGA--------RASAPLPSRTASSTD 348
            ++ P+     S   S  AP  T SS+T+    A         +SAP+P+ ++S+T+
Sbjct: 718  SSAPVPTPSSSTTESSSAPVPTPSSSTTESSSAPVTSSTTESSSAPVPTPSSSTTE 773

 Score = 33.5 bits (75), Expect = 1.6
 Identities = 65/350 (18%), Positives = 126/350 (36%), Gaps = 24/350 (6%)
 Frame = -2

Query: 1127 SLSRDSSASNANTCSCLRSGSDKGDGTYVSSRCGVFSRAK*AYNPANCSEPSAARTLTCS 948
            S +  S++ ++ T S     S     T  SS     S    +   ++ + P+   T +C+
Sbjct: 211  STTTSSTSESSTTTSSTSESSTTTSSTSESST--TTSSTSESSTSSSTTAPATPTTTSCT 268

Query: 947  ANAYRSRISVLASRKRSTP--------SRWYLSSLQRCSKFAWNPADSTMKKRIE*PLGK 792
                    +   ++++ TP        ++   ++ + C+K    P  +      E     
Sbjct: 269  KEKPTPPTTTSCTKEKPTPPHHDTTPCTKKKTTTSKTCTKKTTTPVPTPSSSTTE----- 323

Query: 791  RARYSGNGTACTRPCTNACSAFAGVPRPTE*AHALAVPSGSAYTVTPAPEPRALTNSEIV 612
                S +    T   +   S+ A V   T  + +  VP+ S+ T   +  P   + +E  
Sbjct: 324  ----SSSAPVPTPSSSTTESSSAPVTSSTTESSSAPVPTPSSSTTESSSAPVTSSTTESS 379

Query: 611  VSPDITSTVVSDVRGNVSASSRTLAAEEVRTYSCSTLSTA----------NTGPITFA*K 462
             +P  +ST  S      + SS T  +      S +T S++          ++ P+T +  
Sbjct: 380  SAPVTSSTTESSSAPVPTPSSSTTESSSAPVTSSTTESSSAPVTSSTTESSSAPVTSSTT 439

Query: 461  SVAGSRPAPDRTESS-----TTSGPPGARASAPLPSRTASSTDRXXXXXXXXXXXXXXXX 297
              + +      TESS     T S      +SAP+ S T  S+                  
Sbjct: 440  ESSSAPVTSSTTESSSAPVPTPSSSTTESSSAPVTSSTTESSSAPVPTPSSSTTESSSAP 499

Query: 296  LQNNSV-SFMSPAATPVSCLPRLPHFFAAREPLAAIAATDDTNGPHTVCT 150
            + +++  S  +P  TP S         +A  P  + + T+ ++ P T  T
Sbjct: 500  VTSSTTESSSAPVPTPSSSTTESS---SAPAPTPSSSTTESSSAPVTSST 546

>NCAS0F02620 Chr6 complement(530092..534018) [3927 bp, 1308 aa] {ON} 
          Length = 1308

 Score = 42.0 bits (97), Expect = 0.004
 Identities = 87/363 (23%), Positives = 148/363 (40%), Gaps = 25/363 (6%)
 Frame = -2

Query: 1364 PKEAGTTP-TSMLPSNTSPGACRSTRLSRWPSTHNSLATRSEAPFSMDNVKLSP-----K 1203
            P  + ++P  S LPS TSP +  S   S   S+  S +T S +P        SP      
Sbjct: 840  PSSSSSSPDVSSLPS-TSPTSSASLIQSESISSAVS-STISSSPDVSSVPSTSPTSGVSS 897

Query: 1202 FRYTNPGALNALPRIVE*PAINNSFSLSRDSSASNANTCSCLRSGSDKGDGT-YVSSRCG 1026
             +  +P ++++ P +   P+ + +  +S   S S +   S   S +         S   G
Sbjct: 898  IQSPDPSSISSTPPVSSVPSTSPTSGVSSVQSESTSTAVSSTTSSTPTVSSVPSTSPTSG 957

Query: 1025 VFS-----RAK*AYNPANCSEPSAARTLTCSANAYRSRISVLASRKRSTPSRWYLSSLQR 861
            V S      +  + +PA  S PS + T + S     S  + ++S   STP+   +SSL  
Sbjct: 958  VSSIQSSDPSSISSSPAVSSVPSTSPTSSASLIQSESASTAVSSTTSSTPA---VSSLPS 1014

Query: 860  CSKFAWNPADSTMKKRIE*PLGKRARYSGNGTACTRPCTNACSAFAGVPRPTE*AHALAV 681
             S     P  ST   + E                + P TN  S+ + +  P       ++
Sbjct: 1015 TS-----PTSSTSSDQAE----------------SIPSTNPTSSVSSIQSP----DPSSI 1049

Query: 680  PSGSAYTVTPAPEPRALTNSEIVVSPDITSTVVSDV------RGNVSASSRTLAAEEVRT 519
             S  A +  P+  P +  +S   V  + TST VS          +V ++S T     +++
Sbjct: 1050 SSNPAVSSVPSTSPTSGVSS---VQSESTSTAVSSTISSTPDVSSVPSTSPTSGVSSIQS 1106

Query: 518  YSCSTLSTA-------NTGPITFA*KSVAGSRPAPDRTESSTTSGPPGARASAPLPSRTA 360
               S++S++       +T P + A  S+  S  A     S+T+S P  A +S P  S T+
Sbjct: 1107 SDPSSISSSPAVSSVPSTSPTSSA--SLIQSESASTAVSSTTSSTP--AVSSLPSTSPTS 1162

Query: 359  SST 351
            S++
Sbjct: 1163 STS 1165

>ZYRO0F02728g Chr6 (220410..227318) [6909 bp, 2302 aa] {ON} some
            similarities with uniprot|P08640 Saccharomyces cerevisiae
            YIR019C MUC1 GPI-anchored cell surface glycoprotein
            required for diploid pseudohyphal formation and haploid
            invasive growth transcriptionally regulated by the MAPK
            pathway (via Ste12p and Tec1p) and the cAMP pathway (via
            Flo8p)
          Length = 2302

 Score = 42.0 bits (97), Expect = 0.004
 Identities = 82/358 (22%), Positives = 134/358 (37%), Gaps = 27/358 (7%)
 Frame = -2

Query: 1340 TSMLPSNTSPGACRSTRLSRWPSTHNSLATRSEAPFSMDNVKLSPKFRYTNP-GALNALP 1164
            +S  P++TS GA  S       S  + + + S AP    N   S     +   GA ++ P
Sbjct: 930  SSSAPTSTS-GASSSEASGSGNSATSGIVSASSAPSGNGNSATSGASGASGASGASSSAP 988

Query: 1163 RIV------E*PAINNSFSLSRDSSASNANTCSCLRSGSDKGDGTYVSSRCGVFSRAK*A 1002
                     E     NS +     ++S +++     S +     +  S   G  S A  +
Sbjct: 989  TSTSGASSSEASGSGNSATSGATGASSTSSSAPPSGSSASSAPSSGASGASGASSSAPTS 1048

Query: 1001 YNPANCSEPSAARTLTCSANAYRSRISVLASRKRSTPSRWYLSSLQRCSKFAWNPADSTM 822
             + A+ SE S +     SA +  S  S  +    S PS     +    +  + N A S +
Sbjct: 1049 TSGASSSEASGSGN---SATSGASGASGASGASSSAPSSGASGASSSEASGSGNSATSGI 1105

Query: 821  KKRIE*PLGKRARYSGNGTACTRPCTNACSAFAGVPRPTE*AHALAVPSGSAYTVTPAPE 642
                  P       SGNG + T   + A  A +  P  T  A + +  SGS  + T    
Sbjct: 1106 VSASSAP-------SGNGNSATSGASGASGASSSAPTSTSGASS-SEASGSGNSATSGAS 1157

Query: 641  PRALTNSEIVVSPDITSTVVSDVR---GNVSASSRTLAAEEVRTYSCSTLSTANTGPITF 471
              +  +     +P  TS   S      GN SA+S    A    + +  + S+A++ P + 
Sbjct: 1158 GASGASGASSSAPTSTSGASSSEASGSGN-SATSGATGASSTSSSAPPSGSSASSAPSSG 1216

Query: 470  A*KSVAGSRPAPDRTESSTTS-----------------GPPGARASAPLPSRTASSTD 348
            A  +   S  AP  T  +++S                 G  GA +SAP  +  ASS++
Sbjct: 1217 ASGASGASSSAPTSTSGASSSEASGSGNSATSGASGASGASGASSSAPTSTSGASSSE 1274

 Score = 37.0 bits (84), Expect = 0.14
 Identities = 77/343 (22%), Positives = 131/343 (38%), Gaps = 7/343 (2%)
 Frame = -2

Query: 1355 AGTTPTSMLPSNTSP------GACRSTRLSRWPSTHNSLATRSEAPFSMDNVKLSPKFRY 1194
            A +T +S  PS +S       GA  ++  S    T  S A+ SEA  S ++         
Sbjct: 1013 ASSTSSSAPPSGSSASSAPSSGASGASGASSSAPTSTSGASSSEASGSGNSATSGASGAS 1072

Query: 1193 TNPGALNALPRIVE*PAINNSFSLSRDSSASNANTCSCLRSGSDKGDGTYVSSRCGVFSR 1014
               GA ++ P      A ++  S S +S+ S   + S   SG+     +  S   G  S 
Sbjct: 1073 GASGASSSAPSSGASGASSSEASGSGNSATSGIVSASSAPSGNGNSATSGASGASGASSS 1132

Query: 1013 AK*AYNPANCSEPSAARTLTCSANAYRSRISVLASRKRSTPSRWYLSSLQRCSKFAWNPA 834
            A  + + A+ SE S +     S  +  S  S  +S   ++ S    S        A + A
Sbjct: 1133 APTSTSGASSSEASGSGNSATSGASGASGASGASSSAPTSTSGASSSEASGSGNSATSGA 1192

Query: 833  DSTMKKRIE*PLGKRARYSGNGTACTRPCTNACSAFAGVPRPTE*AHALAVPSGSAYTVT 654
                      P       S   +A +   + A  A +  P  T  A + +  SGS  + T
Sbjct: 1193 TGASSTSSSAPPSG----SSASSAPSSGASGASGASSSAPTSTSGASS-SEASGSGNSAT 1247

Query: 653  PAPEPRALTNSEIVVSPDITSTVVS-DVRGNVSASSRTLAAEEVRTYSCSTLSTANTGPI 477
                  +  +     +P  TS   S +  G+ ++++   +     + + S+  T+ +G  
Sbjct: 1248 SGASGASGASGASSSAPTSTSGASSSEASGSGNSATSGASGASGASGASSSAPTSTSG-- 1305

Query: 476  TFA*KSVAGSRPAPDRTESSTTSGPPGARASAPLPSRTASSTD 348
              A  S A        + +S  SG  GA +SAP  +  ASS++
Sbjct: 1306 --ASSSEASGSGNSATSGASGASGASGASSSAPTSTSGASSSE 1346

 Score = 36.2 bits (82), Expect = 0.24
 Identities = 80/350 (22%), Positives = 128/350 (36%), Gaps = 4/350 (1%)
 Frame = -2

Query: 1385 AGTSAFRPKEAGTTPTSMLPSNTSPGACRSTRLSRWPSTHNSLATRSEAPFSMDNVKLSP 1206
            + TS        +  +S  PS+ + GA  S       S  + + + S AP    N   S 
Sbjct: 1063 SATSGASGASGASGASSSAPSSGASGASSSEASGSGNSATSGIVSASSAPSGNGNSATS- 1121

Query: 1205 KFRYTNPGALNALPRIVE*PAINNSFSLSRDSSASNANTCSCLRSGSDKGDGTY-VSSRC 1029
                   GA  A           +  S S  +S S A++     SG+    G    S   
Sbjct: 1122 -------GASGA-----------SGASSSAPTSTSGASSSEASGSGNSATSGASGASGAS 1163

Query: 1028 GVFSRAK*AYNPANCSEPSAARTLTCSANAYRSRISVLASRKRSTP-SRWYLSSLQRCSK 852
            G  S A  + + A+ SE S       S N+  S  +  +S   S P S    SS      
Sbjct: 1164 GASSSAPTSTSGASSSEASG------SGNSATSGATGASSTSSSAPPSGSSASSAPSSGA 1217

Query: 851  FAWNPADSTMKKRIE*PLGKRARYSGNG-TACTRPCTNACSAFAGVPRPTE*AHALAVPS 675
               + A S+            A  SGN  T+     + A  A +  P  T  A + +  S
Sbjct: 1218 SGASGASSSAPTSTSGASSSEASGSGNSATSGASGASGASGASSSAPTSTSGASS-SEAS 1276

Query: 674  GSAYTVTPAPEPRALTNSEIVVSPDITSTVVS-DVRGNVSASSRTLAAEEVRTYSCSTLS 498
            GS  + T      +  +     +P  TS   S +  G+ ++++   +     + + S+  
Sbjct: 1277 GSGNSATSGASGASGASGASSSAPTSTSGASSSEASGSGNSATSGASGASGASGASSSAP 1336

Query: 497  TANTGPITFA*KSVAGSRPAPDRTESSTTSGPPGARASAPLPSRTASSTD 348
            T+ +G    A  S A        + +S  SG  GA +SAP  +  ASS++
Sbjct: 1337 TSTSG----ASSSEASGSGNSATSGASGASGASGASSSAPTSTSGASSSE 1382

>KAFR0A04720 Chr1 (934307..936226) [1920 bp, 639 aa] {ON} 
          Length = 639

 Score = 41.2 bits (95), Expect = 0.006
 Identities = 60/265 (22%), Positives = 103/265 (38%)
 Frame = -2

Query: 1142 INNSFSLSRDSSASNANTCSCLRSGSDKGDGTYVSSRCGVFSRAK*AYNPANCSEPSAAR 963
            I++S S +  SS  +  T S L S   K     + S   +FS      N ++    S   
Sbjct: 55   ISSSLSKTGSSSILSTITSSALSSTEGKSSSASIGSASYIFS------NSSSIVGSSTLS 108

Query: 962  TLTCSANAYRSRISVLASRKRSTPSRWYLSSLQRCSKFAWNPADSTMKKRIE*PLGKRAR 783
            +   S++A  S  +V  S   S+ S    SS    S  A + +  +    +         
Sbjct: 109  SAVSSSSAASSSSAVSGSSAASSSSAVSSSSAVSSSSAASSSSAVSSSSAVS-------- 160

Query: 782  YSGNGTACTRPCTNACSAFAGVPRPTE*AHALAVPSGSAYTVTPAPEPRALTNSEIVVSP 603
                        ++A S+ + V   +  + + AV S SA + + A    +  +S   VS 
Sbjct: 161  -----------SSSAASSSSAVSSSSAVSSSSAVSSSSAVSSSSAVSSSSAASSSSAVSS 209

Query: 602  DITSTVVSDVRGNVSASSRTLAAEEVRTYSCSTLSTANTGPITFA*KSVAGSRPAPDRTE 423
                +  + V   V+ASS    + E  +YS S  S+A +   + +  S   S  A   + 
Sbjct: 210  YAAVSSSAAVTNLVAASSSFPTSSESASYSFSNSSSAASSSSSVSSSSAVSSSSAV--SS 267

Query: 422  SSTTSGPPGARASAPLPSRTASSTD 348
            SS  +    A +S+ + S  AS+ D
Sbjct: 268  SSAAASSSAASSSSAISSSAASALD 292

>NCAS0A07310 Chr1 complement(1450943..1452976) [2034 bp, 677 aa]
           {ON} 
          Length = 677

 Score = 41.2 bits (95), Expect = 0.006
 Identities = 35/129 (27%), Positives = 49/129 (37%), Gaps = 6/129 (4%)
 Frame = -2

Query: 719 VPRPTE*AHALAVPSGSAYTVTPAPEPRALTNSEIVVSPDITSTVVSDVRGNVSASSRTL 540
           +P  T   ++  +P+ S     P PEP +   +  +V PD TS   S++    S S    
Sbjct: 203 LPDTTSIPNSEIIPTSSPSKTAPVPEPPSTAETSAIVEPDTTSIPDSEIIPTSSPSETAP 262

Query: 539 AAEEVRTYSCSTLSTANTGPITFA*KSVAGSRPAPDRTESSTTSGPPGARASA------P 378
             E   T   S +   +T        S+  S   P  + S T S P  A  SA      P
Sbjct: 263 VPEPPSTAETSAIVEPDT-------TSIPDSEIIPTSSPSETASVPEPAITSASSQQIIP 315

Query: 377 LPSRTASST 351
            PS   S T
Sbjct: 316 TPSSRLSET 324

>Skud_14.376 Chr14
           (671851..672391,672515..672544,672671..672796,
           672839..673111,673190..673207,673250..674436) [2175 bp,
           725 aa] {ON} YNR044W (REAL)
          Length = 725

 Score = 40.8 bits (94), Expect = 0.008
 Identities = 35/149 (23%), Positives = 64/149 (42%), Gaps = 8/149 (5%)
 Frame = -2

Query: 773 NGTACTRPCTNACSAFAGVPRPTE*AHALAVPSGSAYTVTPAPE---PRALTNSEIVVSP 603
           + T  +   T + S+ +  P  T  A +    + ++ + T +     P + T S    + 
Sbjct: 175 SSTTDSTSTTTSSSSTSSTPSSTSSAPSSTTTTSTSTSSTSSSTSSTPSSTTTSSSSTTT 234

Query: 602 DITSTVVSDVRGNVSASSRTLAAEEVRTYSCSTLS-----TANTGPITFA*KSVAGSRPA 438
             +ST  S      S+SS T ++    T S ST +     T ++   T +  S + + P+
Sbjct: 235 SSSSTTTSSSSTTTSSSSTTTSSSSTTTSSSSTTTSSSSTTTSSSSTTTSSSSTSTTSPS 294

Query: 437 PDRTESSTTSGPPGARASAPLPSRTASST 351
              T SST+S P     S+   + ++SST
Sbjct: 295 TSSTPSSTSSTPSSTTTSSSSTTTSSSST 323

 Score = 33.9 bits (76), Expect = 1.1
 Identities = 37/137 (27%), Positives = 59/137 (43%)
 Frame = -2

Query: 761 CTRPCTNACSAFAGVPRPTE*AHALAVPSGSAYTVTPAPEPRALTNSEIVVSPDITSTVV 582
           C    TN  S+ + +    E   + +V S S  T T +P     + S    + D TST  
Sbjct: 133 CPTCHTNTISSSSKIETTAE--PSSSVVSSSTSTSTLSP-----STSTFSSTTDSTSTTT 185

Query: 581 SDVRGNVSASSRTLAAEEVRTYSCSTLSTANTGPITFA*KSVAGSRPAPDRTESSTTSGP 402
           S    + + SS + A     T S ST ST+++   T +  S   S  +   + SSTT+  
Sbjct: 186 SSSSTSSTPSSTSSAPSSTTTTSTSTSSTSSSTSSTPS--STTTSSSSTTTSSSSTTTSS 243

Query: 401 PGARASAPLPSRTASST 351
                S+   + ++SST
Sbjct: 244 SSTTTSSSSTTTSSSST 260

>Kwal_23.5441 s23 (1160364..1162853) [2490 bp, 830 aa] {ON} YIR019C
            (MUC1) - cell surface flocculin with structure similar to
            serine/threonine-rich GPI-anchored cell wall proteins
            [contig 8] PARTIAL
          Length = 830

 Score = 40.0 bits (92), Expect = 0.014
 Identities = 94/383 (24%), Positives = 145/383 (37%), Gaps = 49/383 (12%)
 Frame = -2

Query: 1355 AGTTPTSMLPSNTSPGACRSTRLSRWPSTHNSLATRSEAPFSMDNVKLSPKFRYTNPG-- 1182
            + T P+S   S+++P +  +   S   +      + S   ++ D    S     T P   
Sbjct: 424  SSTAPSSAPASSSAPVSSSAPASSTCQTVVTETTSGSTTVYTTDCSSSSAPGSSTAPSSA 483

Query: 1181 -ALNALPRIVE*PA-INNSFSLSRDSSASNANTCSCLRSGSDKGDGTYVSSRCGVFSR-- 1014
             A ++ P     P+    S S    SSA  ++TC  + + +  G  T  ++ C   S   
Sbjct: 484  PASSSAPGSSTAPSSAPASSSAPVSSSAPASSTCQTVVTETTSGSTTVYTTDCSSSSAPG 543

Query: 1013 --AK*AYNPANCSEP---SAARTLTC----------SANAYRSRISVLASRKRST-PSRW 882
                 +  PA+ S P   SA  + TC          S   Y +  S  ++   ST PS  
Sbjct: 544  SSTAPSSAPASSSAPVSSSAPASSTCQTVVTETTSGSTTVYTTDCSSSSAPGSSTAPSSA 603

Query: 881  YLSSLQRCSKFAWNPADSTMKKRIE*PLGKRARYSGNGTACTRPCTNACSAFAGVPRPTE 702
              SS    S  A  PA ST +  +          SG+ T  T  C+++ SA +  P  T 
Sbjct: 604  PASSSAPVSSSA--PASSTCQTVVT------ETTSGSTTVYTTDCSSS-SAPSSAPSSTP 654

Query: 701  *AHALAVPSGSAYTVTPAPEPRALTNSEIVVSPDITS-----------------TVVSDV 573
             A + A  S SA   + AP     ++S  V S   +S                 T  S  
Sbjct: 655  -ASSSAPVSSSAPVSSTAPNSAPASSSAPVSSTAPSSAPASSSAPASSTAPGSSTAPSSA 713

Query: 572  RGNVSA-------SSRTLAAEEVRTYSCSTLSTANTGPITFA*KSVAGSRPAPDRTESST 414
             G+ SA       SS  +++    + +C T+ T  T   T    +   S  AP    SST
Sbjct: 714  PGSSSAPSSAPASSSAPVSSSAPASSTCQTVVTETTSGSTTVYTTDCSSSSAPSSAPSST 773

Query: 413  ---TSGPPGARASAPLPSRTASS 354
               +S P  A +SAP  +  +SS
Sbjct: 774  PASSSAPSSAPSSAPSSTPASSS 796

 Score = 35.4 bits (80), Expect = 0.38
 Identities = 85/369 (23%), Positives = 135/369 (36%), Gaps = 34/369 (9%)
 Frame = -2

Query: 1358 EAGTTPTSMLPSNTSPGACRSTRLSRWPSTHNSLATRSEAPFS------------MDNVK 1215
            E+ TTP S  P+++S  +  +   S  P T +S    S AP S            +    
Sbjct: 326  ESSTTPYSSAPASSSTPSSSAPVSSSTPVTESSSTPYSSAPASSTAPASSTCQTVVTETT 385

Query: 1214 LSPKFRYTNPGALNALPRIV--E*PAINNSFSLSRDSSASNANTCSCLRSGSDKGDGTYV 1041
                  YT   + ++ P       PA +++   S    +S A + +   S +        
Sbjct: 386  SGSTTVYTTDCSSSSAPSSAPSSTPASSSAPVSSSAPGSSTAPSSAPASSSAPVSSSAPA 445

Query: 1040 SSRCGVF-----SRAK*AYNPANCSEPSAARTLTCSANAYRSRISVLASRKRSTPSRWYL 876
            SS C        S +   Y   +CS  SA  + T  ++A  S  +  +S   + PS    
Sbjct: 446  SSTCQTVVTETTSGSTTVYT-TDCSSSSAPGSSTAPSSAPASSSAPGSS---TAPSSAPA 501

Query: 875  SSLQRCSKFAWNPADSTMKKRIE*PLGKRARYSGNGTACTRPCTNACSAFAGVPRPTE*A 696
            SS    S  A  PA ST +  +          SG+ T  T  C+++ +  +     +  A
Sbjct: 502  SSSAPVSSSA--PASSTCQTVVT------ETTSGSTTVYTTDCSSSSAPGSSTAPSSAPA 553

Query: 695  HALAVPSGSAYTVTPAPEPRALTNSEIVVSPDITSTVV-------SDVRGNVSA------ 555
             + A  S SA        P + T   +V      ST V       S   G+ +A      
Sbjct: 554  SSSAPVSSSA--------PASSTCQTVVTETTSGSTTVYTTDCSSSSAPGSSTAPSSAPA 605

Query: 554  -SSRTLAAEEVRTYSCSTLSTANTGPITFA*KSVAGSRPAPDRTESST-TSGPPGARASA 381
             SS  +++    + +C T+ T  T   T    +   S  AP    SST  S      +SA
Sbjct: 606  SSSAPVSSSAPASSTCQTVVTETTSGSTTVYTTDCSSSSAPSSAPSSTPASSSAPVSSSA 665

Query: 380  PLPSRTASS 354
            P+ S   +S
Sbjct: 666  PVSSTAPNS 674

 Score = 33.1 bits (74), Expect = 2.0
 Identities = 35/139 (25%), Positives = 53/139 (38%)
 Frame = -2

Query: 767 TACTRPCTNACSAFAGVPRPTE*AHALAVPSGSAYTVTPAPEPRALTNSEIVVSPDITST 588
           T+CT+     CS+   +  P     + AV   S    + AP   +  +S   VS     T
Sbjct: 297 TSCTKHRPTTCSSKTTLTPPGPDTSS-AVTESSTTPYSSAPASSSTPSSSAPVSSSTPVT 355

Query: 587 VVSDVRGNVSASSRTLAAEEVRTYSCSTLSTANTGPITFA*KSVAGSRPAPDRTESSTTS 408
             S    + + +S T  A      +C T+ T  T   T    +   S  AP    SST +
Sbjct: 356 ESSSTPYSSAPASSTAPASS----TCQTVVTETTSGSTTVYTTDCSSSSAPSSAPSSTPA 411

Query: 407 GPPGARASAPLPSRTASST 351
                 +S+   S TA S+
Sbjct: 412 SSSAPVSSSAPGSSTAPSS 430

>TDEL0E04030 Chr5 (751781..754108) [2328 bp, 775 aa] {ON} Anc_5.225
            YJR004C
          Length = 775

 Score = 39.3 bits (90), Expect = 0.024
 Identities = 59/268 (22%), Positives = 106/268 (39%), Gaps = 14/268 (5%)
 Frame = -2

Query: 1112 SSASNANTCSCLRSGSDKGDGTYVSSRCGVFSRAK*AYNPANCSEPSAARTLTCSANAYR 933
            SS+S+ N+C    S S     + + S     S      + + C   S+  T + + ++  
Sbjct: 346  SSSSSGNSCLQCSSSSSVSSSSSIPSTSSSNSSTMSTVSCSGCQHSSSTITRSTTPSSST 405

Query: 932  SRISVLASRKRSTPSRWYLSSLQRCSKFAWNPADSTMKKRIE*PLGKRARYSGNGTACTR 753
               S L+S   STPS   LSS    S    +   S+       P       S + ++ + 
Sbjct: 406  PSSSTLSS---STPSSSTLSSSTPSSSMPSSSMPSSSMPSSSMPSSSMP--SSSASSISM 460

Query: 752  PCTNACSAFAGVPRPTE*AHALAVPSGS-AYTVTPAPE------PRALTNSEIVVS---- 606
            P ++  S+      P+  A +++  SGS + T TP+        P   T+S    S    
Sbjct: 461  PSSSMPSS----SMPSSSASSISTSSGSTSSTSTPSSSTPSSSTPSRPTSSSFQPSGSSP 516

Query: 605  ---PDITSTVVSDVRGNVSASSRTLAAEEVRTYSCSTLSTANTGPITFA*KSVAGSRPAP 435
                  TST +SD   +   +S  L +  + + S S L ++++ P      +V+ S    
Sbjct: 517  SNSTSSTSTSISDSISSTFTTSSDLTSSSLASQSSSFLPSSSSAPSPTI-STVSSSCTFG 575

Query: 434  DRTESSTTSGPPGARASAPLPSRTASST 351
            + T  S +   P + +  P+   +  ST
Sbjct: 576  ETTNESLSQAIPSSSSRPPIDKTSQDST 603

>NCAS0H02190 Chr8 complement(425884..428973) [3090 bp, 1029 aa] {ON} 
          Length = 1029

 Score = 39.3 bits (90), Expect = 0.025
 Identities = 78/349 (22%), Positives = 141/349 (40%), Gaps = 6/349 (1%)
 Frame = -2

Query: 1385 AGTSAFRPKEAGTTPTSMLPSNTSPGACRSTRLSRWPSTHNSLATRSEAPFSMDNVKLSP 1206
            A  S+   + +  + +S  P+++S     +   S      +S    S AP S  + K S 
Sbjct: 509  APASSSAKESSAVSASSSAPASSSAKESSAVSASSSAPASSSAKESSSAPAS-SSAKASS 567

Query: 1205 KFRYTNPGALNALPRIVE*PAINNSFSLSRDSSASNANTCSCLRSGSDKGDGTYVSSRCG 1026
              + ++    ++  R       ++S   S  +  S+A + S   S +        SS   
Sbjct: 568  SVKESSSVLASSSARASSSVPASSSAKASGSAKESSAVSAS---SSARASSSAKASSSVP 624

Query: 1025 VFSRAK*AYNPANCSEPSAARTLTCSANAYRSRISVLASRKRSTPSRWYLSSLQRCSKFA 846
              S AK + +    S   A+ +   S++A  S  SV AS      S    SS  R S   
Sbjct: 625  ASSSAKASSSVKESSSVLASSSAKASSSAKESS-SVSASSSAKESSSVLASSSARASSSV 683

Query: 845  WNPADSTMKKRIE*PLGKRARYSGNGT-ACTRPCTNACSAFAGVPRPTE*AHALAVPSGS 669
              PA S+ K+         A  S +   + + P +++  A + V    E +  LA  S  
Sbjct: 684  --PASSSAKESSSVSASTSAPASSSAKESSSAPASSSAKASSSVK---ESSSVLASSSAR 738

Query: 668  AYTVTPAPEPR-----ALTNSEIVVSPDITSTVVSDVRGNVSASSRTLAAEEVRTYSCST 504
            A +  PA         A  +S +  S    ++  +    +V ASS   A+  V+  S S 
Sbjct: 739  ASSSVPASSSAKASSSAKESSAVSASSSARASSSAKASSSVPASSSAKASSSVKE-SSSV 797

Query: 503  LSTANTGPITFA*KSVAGSRPAPDRTESSTTSGPPGARASAPLPSRTAS 357
            L++++    + A +S + S  +  + ESS+      ARAS+ +P+ +++
Sbjct: 798  LASSSAKASSSAKESSSVSASSSAK-ESSSVLASSSARASSSVPASSSA 845

>Suva_10.17 Chr10 complement(30305..33490) [3186 bp, 1061 aa] {ON}
            YAL063C (REAL)
          Length = 1061

 Score = 38.5 bits (88), Expect = 0.043
 Identities = 61/287 (21%), Positives = 110/287 (38%), Gaps = 6/287 (2%)
 Frame = -2

Query: 1346 TPTSM----LPSNTSPGACRSTRLSRWPSTHNSLATRSEAPFSMDNVKLSPKFRYTNPGA 1179
            TPTS+    +PS TS     S   S      +S  T S+   S      +     T+   
Sbjct: 325  TPTSVSSSSVPSTTSSDVTSSAATSS--DVSSSSVTFSDTTISSITSSNATSSVTTSSAV 382

Query: 1178 LNALPRIVE*PAINNSFSLSRDSSASNANTCSCLRSGSDKGDGTYVSSRCGVFSRAK*AY 999
             ++   +      ++S + S D ++S+A T S   S +     T  SS     S    + 
Sbjct: 383  TSST--VTPSDVASSSIATSSDVTSSSATTSSTTSSSATTSSTT--SSSATTSSTTSSSA 438

Query: 998  NPANCSEPSAARTLTCSANAYRSRISVLASRKRSTPSRWYLSSLQRCSKFAWNPADSTMK 819
              ++ +  SA  + T S++A  S  +  ++   ST S    +S    S  A   +D T  
Sbjct: 439  TTSSTTSSSATTSSTTSSSATTSSTTSSSATTSSTTSSSATTSSDATSSSATTSSDVTSS 498

Query: 818  KRIE*PLGKRARYSGNGTACTRPCTNACSAFAGVPRPTE*AHALAVPSGSAYTVTPAPEP 639
                  +   A  S + T+ +   ++  ++ A        + + +  + SA T +     
Sbjct: 499  ATTSSDVTSSASTSSDVTSSSIVTSSEVTSSATTSSDVTSSASSSASTSSAVTSSSVTSS 558

Query: 638  RALTN--SEIVVSPDITSTVVSDVRGNVSASSRTLAAEEVRTYSCST 504
              +++  S  V S +ITS+  S    +   SS    +    TYS +T
Sbjct: 559  EVISSASSSSVTSSEITSSTSSSSATSPDVSSSAATSSAPSTYSAAT 605

 Score = 35.8 bits (81), Expect = 0.30
 Identities = 70/302 (23%), Positives = 117/302 (38%), Gaps = 3/302 (0%)
 Frame = -2

Query: 1298 STRLSRWPSTHNSLATRSEAPFSMDNVKLSPKFRYTNPGAL---NALPRIVE*PAINNSF 1128
            S   S  PST +S  T S A  S D    S  F  T   ++   NA   +    A+ +S 
Sbjct: 328  SVSSSSVPSTTSSDVTSSAAT-SSDVSSSSVTFSDTTISSITSSNATSSVTTSSAVTSST 386

Query: 1127 SLSRDSSASNANTCSCLRSGSDKGDGTYVSSRCGVFSRAK*AYNPANCSEPSAARTLTCS 948
                D ++S+  T S + S S     T  SS     + +  A   +  S  +   + T S
Sbjct: 387  VTPSDVASSSIATSSDVTSSSATTSSTTSSSATTSSTTSSSATTSSTTSSSATTSSTTSS 446

Query: 947  ANAYRSRISVLASRKRSTPSRWYLSSLQRCSKFAWNPADSTMKKRIE*PLGKRARYSGNG 768
            +    S  S  A+   +T S    SS    S  A   +D+T            A  S + 
Sbjct: 447  SATTSSTTSSSATTSSTTSSSATTSSTTSSS--ATTSSDATSSS---------ATTSSDV 495

Query: 767  TACTRPCTNACSAFAGVPRPTE*AHALAVPSGSAYTVTPAPEPRALTNSEIVVSPDITST 588
            T+     ++  S+ +     T  + ++   S    + T + +  +  +S    S  +TS+
Sbjct: 496  TSSATTSSDVTSSASTSSDVT--SSSIVTSSEVTSSATTSSDVTSSASSSASTSSAVTSS 553

Query: 587  VVSDVRGNVSASSRTLAAEEVRTYSCSTLSTANTGPITFA*KSVAGSRPAPDRTESSTTS 408
             V+      SASS ++ + E+   + ST S++ T P      S A +  AP    ++T  
Sbjct: 554  SVTSSEVISSASSSSVTSSEI---TSSTSSSSATSPDV---SSSAATSSAPSTYSAATPR 607

Query: 407  GP 402
             P
Sbjct: 608  YP 609

 Score = 34.3 bits (77), Expect = 0.89
 Identities = 71/288 (24%), Positives = 110/288 (38%), Gaps = 12/288 (4%)
 Frame = -2

Query: 1178 LNALPRI-----VE*PAINNSFSLSRDSSA---SNANTCSCLRSGSDKGDGTYVSSRCGV 1023
            LN+LP +     V+ P   +S S+   +S+   S+A T S + S S     T +SS    
Sbjct: 311  LNSLPTVETIIEVKTPTSVSSSSVPSTTSSDVTSSAATSSDVSSSSVTFSDTTISSITSS 370

Query: 1022 FSRAK*AYNPANCSEPSAARTLTCSANAYRSRISVLASRKRSTPSRWYLSSLQRCSKFAW 843
             + +    + A  S       +  S+ A  S ++  ++   ST S    +S    S    
Sbjct: 371  NATSSVTTSSAVTSSTVTPSDVASSSIATSSDVTSSSATTSSTTSSSATTSSTTSSSATT 430

Query: 842  NPADSTMKKRIE*PLGKRARYSGNGTACTRPCTNACSAFAGVPRPTE*AHALAVPSGSAY 663
            +   S+               S   ++ T   T + SA              +  S SA 
Sbjct: 431  SSTTSSSATTSSTTSSSATTSSTTSSSATTSSTTSSSATTS-----------STTSSSAT 479

Query: 662  TVTPAPEPRALTNSEIVVSPDITS--TVVSDVRGNVSASSRTLAAEEVRTYSCSTLSTAN 489
            T + A      T+S    S D+TS  T  SDV  + S SS  + +  + T S  T S   
Sbjct: 480  TSSDA------TSSSATTSSDVTSSATTSSDVTSSASTSS-DVTSSSIVTSSEVTSSATT 532

Query: 488  TGPITFA*KSVAGSRPAPDRTESSTTSGP--PGARASAPLPSRTASST 351
            +  +T +  S A +  A   T SS TS      A +S+   S   SST
Sbjct: 533  SSDVTSSASSSASTSSAV--TSSSVTSSEVISSASSSSVTSSEITSST 578

>ZYRO0D17380g Chr4 (1432089..1436237) [4149 bp, 1382 aa] {ON} no
            similarity
          Length = 1382

 Score = 38.5 bits (88), Expect = 0.045
 Identities = 71/304 (23%), Positives = 119/304 (39%), Gaps = 38/304 (12%)
 Frame = -2

Query: 1148 PAINNSF-SLSRDSSASNANTCSCLRSGSDKGDGTYVSSRCGVFSRAK*AYNPANCSEPS 972
            PA+++S  ++S  + A +++T +   S S       VSS     S +  +   A+ S PS
Sbjct: 515  PAVSSSTPAVSSSTPAVSSSTPAVSSSASS------VSSSASSVSLSAQSSPSASSSTPS 568

Query: 971  AARTLTCSANAYRSRISVLASRKRSTPSRWYLSSLQRCSKFAWN--PADSTMKKRIE*PL 798
            A+ +++  +++  S      S   S P   Y S   R S  A +     S+    +  P+
Sbjct: 569  ASSSISSGSSSAPSSTPSGPSGSSSIPITSYSSLAARSSSSAPSGPSGSSSAPSNVTTPV 628

Query: 797  GKRA---RYSGNGTACTRPCTNACSAFAGVPRPTE*-AHALAVPS-------GSAYTVTP 651
                     SG+ T      T+A   +  +   TE  +H     S        SA + TP
Sbjct: 629  SSSTIGTTTSGSDTTLVGTTTSATEFWKTITVSTEVCSHGGCTKSMITTTSKPSASSSTP 688

Query: 650  APEPRALTNSEIVVSPDI-----TSTVVSDVRG--------------NVSASSRTLAAEE 528
            +  P   ++S    SP +      STVVS + G              + S SS   +   
Sbjct: 689  SSIPSGPSSSSSAPSPSVHTVSSLSTVVSTINGTSTSYTTWCPLTSGSSSPSSAPSSTPS 748

Query: 527  VRTYSCSTLSTANTGPITFA*KSVAGSRPAPDRTESSTTSGPPG-----ARASAPLPSRT 363
              + S S  S+  +GP + +  S+        R+ SS  SGP G     +  + P+ S T
Sbjct: 749  GPSSSSSAPSSTPSGPSSSSSVSITSYSSLAARSSSSAPSGPSGSSSAPSNVTTPVSSST 808

Query: 362  ASST 351
              +T
Sbjct: 809  IGTT 812

 Score = 32.7 bits (73), Expect = 2.7
 Identities = 77/357 (21%), Positives = 143/357 (40%), Gaps = 15/357 (4%)
 Frame = -2

Query: 1379 TSAFRPKEAGTTPTSML--PSNTSPG--------ACRSTRLSRWPSTHNSLATRSEAPFS 1230
            T+  +P  + +TP+S+   PS++S          +  ST +S    T  S  T       
Sbjct: 676  TTTSKPSASSSTPSSIPSGPSSSSSAPSPSVHTVSSLSTVVSTINGTSTSYTTWCPLTSG 735

Query: 1229 MDNVKLSPKFRYTNPGALNALPRIV-E*PAINNSFSLSRDSSASNANTCSCLRSGSDKGD 1053
              +   +P    + P + ++ P      P+ ++S S++  SS +        RS S    
Sbjct: 736  SSSPSSAPSSTPSGPSSSSSAPSSTPSGPSSSSSVSITSYSSLA-------ARSSSSAPS 788

Query: 1052 GTYVSSRCGVFSRAK*AYNPANCSEPSAARTLTCSANAYRSRISVLASRKRSTPSRWYLS 873
            G   SS             P+N + P ++ T+  + +   S  +++ +   +T SR  ++
Sbjct: 789  GPSGSSSA-----------PSNVTTPVSSSTIGTTTSG--SDTTLVGTTTSATESRNTVT 835

Query: 872  -SLQRCSKFAWNPADSTMKKRIE*PLGKRARYSGNGTACTRPCTNACSAFAGVPRPTE*A 696
             S + CS  +   +  T   +   P    +  SG+ ++ T+P  +  S        T   
Sbjct: 836  VSTEVCSHGSCTTSTITSTSK---PSTPSSTPSGSSSS-TKPSGSTSSGSKPASLTTTSE 891

Query: 695  HALAVPSGSAYTVTPAPEPRALTNSEIVVSPDITSTVVSDVRGNVSASSRTLAAEEVR-- 522
             +  V S S      A E   +T+S + V   ++ T  S        +S T+ +      
Sbjct: 892  SSTPVLSSSQ-----ASETTHITSSILTVITTVSGTATSYTTW-CPLTSTTVGSSTGYIP 945

Query: 521  -TYSCSTLSTANTGPITFA*KSVAGSRPAPDRTESSTTSGPPGARASAPLPSRTASS 354
             T + STLS+   G  +    S + S P+   +ESS+++    + +S P  SR  SS
Sbjct: 946  VTSASSTLSSTEAGSSSGPSSSTSSSVPSSTYSESSSSAPSVQSFSSKPASSRPGSS 1002

>KNAG0C03260 Chr3 complement(639021..643613) [4593 bp, 1530 aa] {ON}
           Anc_5.524 YDR420W
          Length = 1530

 Score = 38.5 bits (88), Expect = 0.045
 Identities = 46/219 (21%), Positives = 63/219 (28%), Gaps = 16/219 (7%)
 Frame = -2

Query: 758 TRPCTNACSAFAGVPRPTE*AHALAVPSGSAYTVTPAPEPRALTNSEIV--VSPDITSTV 585
           T P T   +     P  T           +  T TPA E    T SEI+   +P+ T T 
Sbjct: 235 TTPTTTPETTTTFTPETTPTTTPTTTAPITVSTTTPALESMPTTTSEIMATTTPETTPTA 294

Query: 584 VSDVRGNVSASSRTLAAEEVRTYSC--------------STLSTANTGPITFA*KSVAGS 447
                   +A +      E  T                 +T  TA+T P      + A +
Sbjct: 295 TPKTTPTATAETTPTTTPETTTTFTPETTPRTTPKITPETTAETASTTPQEITPTTTAET 354

Query: 446 RPAPDRTESSTTSGPPGARASAPLPSRTASSTDRXXXXXXXXXXXXXXXXLQNNSVSFMS 267
              P+ T ++T    P   A      +T  +T                           +
Sbjct: 355 TTTPETTPTTTPKITPTTTAETTTTPKTTDTTTPETTPTATPTTTAPMTVSTTTPALEST 414

Query: 266 PAATPVSCLPRLPHFFAAREPLAAIAATDDTNGPHTVCT 150
           P  TP S L   P       P      T  T  P TV T
Sbjct: 415 PTTTPESTLTTTPETTTTFTPETTPTTTPTTTAPMTVST 453

>Kwal_26.7484 s26 (384745..386046) [1302 bp, 434 aa] {ON} YKR092C
            (SRP40) - nucleolar protein that is immunologically and
            structurally related to rat Nopp140, a nonribosomal
            protein of the nucleolus and coiled bodies. [contig 51]
            PARTIAL
          Length = 434

 Score = 38.1 bits (87), Expect = 0.045
 Identities = 68/322 (21%), Positives = 118/322 (36%), Gaps = 7/322 (2%)
 Frame = -2

Query: 1349 TTPTSMLPSNTSP--GACRSTRLSRWPSTHNSLATRSEAPFSMDNVKLSPKFRYTNPGAL 1176
            ++ +S++ ++++P   A  ST L   PST +S    S +  S+ +   S K   T+    
Sbjct: 159  SSSSSVITTSSTPLSSAETSTTLPHSPSTSSSAIPSSSS--SVYSSSSSTKSEITSTTTT 216

Query: 1175 NALPRIVE*PAINNSFSLSRDSSASNANTCSCLRSGS---DKGDGTYVSSRCGVFSRAK* 1005
            +        P I+ + +    ++     +C C  S S     G  TY S      S  K 
Sbjct: 217  SP-------PEISTTSTTRESTTTETETSCDCTLSSSLVVSSGTSTYSSESSATVSSTK- 268

Query: 1004 AYNPANCSEPSAARTLTCSANAYRSRISVLASRKRSTPSRWYLSSLQRCSKFAWNPADST 825
                      S +   T S  +  S  S  +S   + P+   LSS+   +  + + A + 
Sbjct: 269  ----------SVSTISTSSTTSSESTSSNTSSPSSTAPASSTLSSVTSSTSHSVSSATT- 317

Query: 824  MKKRIE*PLGKRARYSGNGTACTRPCTNACSAFAGVPRPTE*AHALAVPSGSAYTVTPAP 645
                           S + +  T        +F+  PR +    ++ + S S  TV    
Sbjct: 318  ---------------SKSTSEVTSSSEVTSGSFSSTPRTSTEITSITLSSSSEITVGTTS 362

Query: 644  EPRALTNSEIVVSPDITSTVVSDVRGNVSASSRTLAAEEVRTYS--CSTLSTANTGPITF 471
            +  + T+S    +    S+  S+     S +S T  +E   T+S  CST S  ++     
Sbjct: 363  DISSSTSSGTSSTSSEASSTTSETSSTFSETSST-TSETSSTFSETCSTSSETSS----- 416

Query: 470  A*KSVAGSRPAPDRTESSTTSG 405
                          T SSTTSG
Sbjct: 417  ----------TSSETSSSTTSG 428

 Score = 32.3 bits (72), Expect = 2.9
 Identities = 51/217 (23%), Positives = 87/217 (40%), Gaps = 6/217 (2%)
 Frame = -2

Query: 983 SEPSAARTLTCSANAYRSRISVLASRKRSTPSRWYLSSLQRCSKFAWNPADSTMKKRIE* 804
           S PS   T + S++   S  S+ +S   S+ S    SS    S  + + + ST       
Sbjct: 96  SGPSTIGTSSSSSSVSSSSSSIRSSTLSSSSSSTITSSSSSSSVSSSSSSSSTTTST--- 152

Query: 803 PLGKRARYSGNGTACTRPCTNACSAFAGVPRP-TE*AHALAVPSGSAYTVTPAPEPRALT 627
                   S + +  T   T   SA      P +    + A+PS S+   + +   ++  
Sbjct: 153 --SINTPSSSSSSVITTSSTPLSSAETSTTLPHSPSTSSSAIPSSSSSVYSSSSSTKSEI 210

Query: 626 NSEIVVSPDITSTVVSDVRGNVSASSRT-----LAAEEVRTYSCSTLSTANTGPITFA*K 462
            S    SP   ST  S  R + +  + T     L++  V +   ST S+ ++  ++   K
Sbjct: 211 TSTTTTSPPEISTT-STTRESTTTETETSCDCTLSSSLVVSSGTSTYSSESSATVSST-K 268

Query: 461 SVAGSRPAPDRTESSTTSGPPGARASAPLPSRTASST 351
           SV+        T S+T+S    +  S+P  +  ASST
Sbjct: 269 SVSTIS-----TSSTTSSESTSSNTSSPSSTAPASST 300

>NCAS0A05530 Chr1 (1088381..1089730) [1350 bp, 449 aa] {ON} 
          Length = 449

 Score = 38.1 bits (87), Expect = 0.046
 Identities = 28/95 (29%), Positives = 41/95 (43%)
 Frame = -2

Query: 683 VPSGSAYTVTPAPEPRALTNSEIVVSPDITSTVVSDVRGNVSASSRTLAAEEVRTYSCST 504
           + S S  + + +P P   T S    S  ITS+  S      S +S T     V + S  T
Sbjct: 115 ISSSSIVSSSSSPIPTTSTTSSTSTSTPITSSAESSSVPTTSTTSSTPFTSSVESSSIPT 174

Query: 503 LSTANTGPITFA*KSVAGSRPAPDRTESSTTSGPP 399
            ST ++ PIT + +S +        +ESS  S  P
Sbjct: 175 TSTISSTPITSSLQSSSAPSSTTISSESSLISSAP 209

>Suva_8.23 Chr8 (50391..50746,50801..50952,51088..51682,51842..52544)
            [1806 bp, 601 aa] {ON} YHL028W (REAL)
          Length = 601

 Score = 38.1 bits (87), Expect = 0.051
 Identities = 45/191 (23%), Positives = 77/191 (40%), Gaps = 4/191 (2%)
 Frame = -2

Query: 1385 AGTSAFRPKEAGTTPTSMLPSNTSPGACRS----TRLSRWPSTHNSLATRSEAPFSMDNV 1218
            + TS        TTPTS   S+T+P +  S    T  S   ST  S +T S  P S    
Sbjct: 144  SSTSTTSTTSTSTTPTSTTSSSTTPTSSTSSSTPTSSSTSSSTPTSSSTSSSTPTSSSTS 203

Query: 1217 KLSPKFRYTNPGALNALPRIVE*PAINNSFSLSRDSSASNANTCSCLRSGSDKGDGTYVS 1038
              +P    T+     +       P  +++ S +  SS+++++T +   + S     +  S
Sbjct: 204  SSTPTSSSTSSSTPTSSSTSSSTPTSSSTSSSTPTSSSTSSSTPTSSSTSSSTPTSSSTS 263

Query: 1037 SRCGVFSRAK*AYNPANCSEPSAARTLTCSANAYRSRISVLASRKRSTPSRWYLSSLQRC 858
            S     S    +  P + S  S+    T ++++  S     +S   STP+    SS    
Sbjct: 264  SSTPTSSSTS-SSTPTSSSTSSS----TPTSSSTSSSTPTSSSTSSSTPTSSSTSSSTTS 318

Query: 857  SKFAWNPADST 825
            S F  + + S+
Sbjct: 319  SSFTSSSSTSS 329

 Score = 37.7 bits (86), Expect = 0.067
 Identities = 37/153 (24%), Positives = 59/153 (38%), Gaps = 2/153 (1%)
 Frame = -2

Query: 803 PLGKRARYSGNGTAC--TRPCTNACSAFAGVPRPTE*AHALAVPSGSAYTVTPAPEPRAL 630
           P    A  S   T+   T   T+  S  +    PT    +   P+ S  + TP     + 
Sbjct: 125 PTASSATTSSTSTSIIPTPSSTSTTSTTSTSTTPTSTTSSSTTPTSSTSSSTPTSSSTSS 184

Query: 629 TNSEIVVSPDITSTVVSDVRGNVSASSRTLAAEEVRTYSCSTLSTANTGPITFA*KSVAG 450
           +      +   T T  S      ++SS + +     + S ST ++++T   T    S + 
Sbjct: 185 STPTSSSTSSSTPTSSSTSSSTPTSSSTSSSTPTSSSTSSSTPTSSSTSSSTPTSSSTSS 244

Query: 449 SRPAPDRTESSTTSGPPGARASAPLPSRTASST 351
           S P    T SST +      +S P  S T+SST
Sbjct: 245 STPTSSSTSSSTPTS-SSTSSSTPTSSSTSSST 276

 Score = 37.0 bits (84), Expect = 0.12
 Identities = 35/143 (24%), Positives = 56/143 (39%)
 Frame = -2

Query: 779 SGNGTACTRPCTNACSAFAGVPRPTE*AHALAVPSGSAYTVTPAPEPRALTNSEIVVSPD 600
           S + T+ T   T   S  +    PT    +    S S  + TP     + +      +  
Sbjct: 145 STSTTSTTSTSTTPTSTTSSSTTPTSSTSSSTPTSSSTSSSTPTSSSTSSSTPTSSSTSS 204

Query: 599 ITSTVVSDVRGNVSASSRTLAAEEVRTYSCSTLSTANTGPITFA*KSVAGSRPAPDRTES 420
            T T  S      ++SS + +     + S ST ++++T   T    S + S P    T S
Sbjct: 205 STPTSSSTSSSTPTSSSTSSSTPTSSSTSSSTPTSSSTSSSTPTSSSTSSSTPTSSSTSS 264

Query: 419 STTSGPPGARASAPLPSRTASST 351
           ST +      +S P  S T+SST
Sbjct: 265 STPTS-SSTSSSTPTSSSTSSST 286

 Score = 31.6 bits (70), Expect = 5.6
 Identities = 45/215 (20%), Positives = 89/215 (41%)
 Frame = -2

Query: 995 PANCSEPSAARTLTCSANAYRSRISVLASRKRSTPSRWYLSSLQRCSKFAWNPADSTMKK 816
           P++ S  S   T T   +   S  +  +S   STP+    SS    +  + + + ST   
Sbjct: 143 PSSTSTTSTTSTSTTPTSTTSSSTTPTSSTSSSTPTS---SSTSSSTPTSSSTSSSTP-- 197

Query: 815 RIE*PLGKRARYSGNGTACTRPCTNACSAFAGVPRPTE*AHALAVPSGSAYTVTPAPEPR 636
                       + + T+ + P +++ S+      PT  + + + P+ S+   T +  P 
Sbjct: 198 ------------TSSSTSSSTPTSSSTSSST----PTSSSTSSSTPTSSS---TSSSTP- 237

Query: 635 ALTNSEIVVSPDITSTVVSDVRGNVSASSRTLAAEEVRTYSCSTLSTANTGPITFA*KSV 456
             T+S    S   +S+  S    + S SS T  +    + + ++ ST+++ P +    S 
Sbjct: 238 --TSSSTSSSTPTSSSTSSSTPTSSSTSSSTPTSSSTSSSTPTSSSTSSSTPTS---SST 292

Query: 455 AGSRPAPDRTESSTTSGPPGARASAPLPSRTASST 351
           + S P    T SST +    + ++      ++SST
Sbjct: 293 SSSTPTSSSTSSSTPTSSSTSSSTTSSSFTSSSST 327

>Smik_14.374 Chr14 (661623..663698) [2076 bp, 691 aa] {ON} YNR044W
           (REAL)
          Length = 691

 Score = 37.7 bits (86), Expect = 0.069
 Identities = 36/141 (25%), Positives = 66/141 (46%), Gaps = 2/141 (1%)
 Frame = -2

Query: 767 TACTRPCTN-ACSAFAGVPRPTE*AHALAVPSGSAYTVTPAPEPRALTNSEIVVSPDIT- 594
           T  T  C++  C+  + +P  T     L+V S     V P+    +++++  + +   T 
Sbjct: 100 TLSTEVCSHQVCTLSSTLPTTT-----LSVTSEFTSYVCPSCHSISISSTPKIKTTTATP 154

Query: 593 STVVSDVRGNVSASSRTLAAEEVRTYSCSTLSTANTGPITFA*KSVAGSRPAPDRTESST 414
           S+VV+      + SS  LA+  + T S ST+ + +T P + +  S + S  +   + SST
Sbjct: 155 SSVVASSTSTSTTSSAILASSSMHTTSSSTMISTSTSPSSTS-TSTSTSPSSTSTSTSST 213

Query: 413 TSGPPGARASAPLPSRTASST 351
           ++ P     S    S + SST
Sbjct: 214 STSPSSTSISTSSTSTSPSST 234

 Score = 35.4 bits (80), Expect = 0.36
 Identities = 31/122 (25%), Positives = 54/122 (44%), Gaps = 14/122 (11%)
 Frame = -2

Query: 677 SGSAYTVTPAPEPRALTNSEIVVSPDITSTVVSDVRGNVSASSRTLAAEEVRTYSCSTLS 498
           S S  + + +P   +++ S    SP  TST  S    + S S+ + +     T S ST +
Sbjct: 207 STSTSSTSTSPSSTSISTSSTSTSPSSTSTSTSSTSTSTSTSTTSTSPSSTSTTSISTST 266

Query: 497 TANTGPITFA*KS--------------VAGSRPAPDRTESSTTSGPPGARASAPLPSRTA 360
           + +T P + +  S              V+ S  + D T SS +S  P ++++   PS T 
Sbjct: 267 STSTSPSSTSTTSTSTSSTSTSPSSILVSISSTSIDETYSSVSSVVPSSKSA---PSYTP 323

Query: 359 SS 354
           S+
Sbjct: 324 ST 325

 Score = 31.2 bits (69), Expect = 7.5
 Identities = 53/253 (20%), Positives = 102/253 (40%), Gaps = 17/253 (6%)
 Frame = -2

Query: 1181 ALNALPRIVE*PAINNSFSLSRDSSASNANTCSCLRSGSDKGDGTYVSSRCGVFSRAK*A 1002
            ++++ P+I    A  +S   S  S+++ ++      S       T +S+     S +  +
Sbjct: 140  SISSTPKIKTTTATPSSVVASSTSTSTTSSAILASSSMHTTSSSTMIST-----STSPSS 194

Query: 1001 YNPANCSEPSAARTLTCSANAYRSRISVLASRKRSTPSRWYLSSLQRCSKFAWNPAD--- 831
             + +  + PS+  T T S +   S  S+  S   ++PS    S+    +  + +      
Sbjct: 195  TSTSTSTSPSSTSTSTSSTSTSPSSTSISTSSTSTSPSSTSTSTSSTSTSTSTSTTSTSP 254

Query: 830  --------STMKKRIE*PLGKRARYSGNGTACTRPCTNACSAFAGVPRPTE*AHALAVPS 675
                    ST       P       +   +  T P +   S  +     T  + +  VPS
Sbjct: 255  SSTSTTSISTSTSTSTSPSSTSTTSTSTSSTSTSPSSILVSISSTSIDETYSSVSSVVPS 314

Query: 674  G-SAYTVTPAPEPRAL--TNSEIVVSPDITSTVVSDVRGNVSAS---SRTLAAEEVRTYS 513
              SA + TP+    ++  T+S I+V+   TS+ V    G+ S+S   S+   + +V ++S
Sbjct: 315  SKSAPSYTPSTHVSSVLSTSSHIMVT-STTSSAVETTTGSQSSSKITSQFTTSSKVPSFS 373

Query: 512  CSTLSTANTGPIT 474
             ST  T  +G  T
Sbjct: 374  VSTYFTTVSGVTT 386

>SAKL0D09944g Chr4 (828689..832747) [4059 bp, 1352 aa] {ON} some
            similarities with uniprot|P08640 Saccharomyces cerevisiae
            YIR019C MUC1 GPI-anchored cell surface glycoprotein
            required for diploid pseudohyphal formation and haploid
            invasive growth transcriptionally regulated by the MAPK
            pathway (via Ste12p and Tec1p) and the cAMP pathway (via
            Flo8p)
          Length = 1352

 Score = 37.7 bits (86), Expect = 0.077
 Identities = 35/146 (23%), Positives = 63/146 (43%), Gaps = 3/146 (2%)
 Frame = -2

Query: 782  YSGNGTACTRPCTNACSAFAGVPRPTE*AHALAVPSGSAYTVTPAPEPRALTNSEIVVSP 603
            YSG  T  T PC+ A         P   A   + P  S   V+ AP   A  +SE  VS 
Sbjct: 940  YSGTTTTATVPCSEA---------PVSSAPVSSAPVSSEVPVSSAPVSSAPVSSEAPVSS 990

Query: 602  DITSTVVSDVRGNVSASSRTLAAEEVRTYSCSTLSTANTGPITFA*KSVAGSRPAPDRTE 423
              ++ + ++  G  + ++   +   V +   S+    ++ P++    SV  +    + + 
Sbjct: 991  VCSTVITTEHSGTTTTATVPCSEAPVSSAPVSSEVAVSSAPVS----SVCSTVITTEYSG 1046

Query: 422  SSTTSGPPGAR---ASAPLPSRTASS 354
            ++TT+  P +    +SAP+ S   SS
Sbjct: 1047 TTTTATVPCSEVPVSSAPVSSAPVSS 1072

>ZYRO0A12100g Chr1 (967785..969401) [1617 bp, 538 aa] {ON} some
            similarities with uniprot|P36027 Saccharomyces cerevisiae
            YLR332W MID2 Protein required for mating and to YGR023W
            uniprot|P53214 Saccharomyces cerevisiae YGR023W MTL1
            Protein with both structural and functional similarity to
            Mid2p, which is a plasma membrane sensor required for
            cell integrity signaling during pheromone- induced
            morphogenesis; suppresses rgd1 null mutations
          Length = 538

 Score = 37.4 bits (85), Expect = 0.086
 Identities = 59/275 (21%), Positives = 121/275 (44%), Gaps = 12/275 (4%)
 Frame = -2

Query: 1139 NNSFSLSRDSSASNANTCSCLRSG--SDKGDGTYVSSRCGVFSRAK*AYNPANCSEPSAA 966
            ++ FS +  S + +  T S L S   SD   G+   +     +    +  P + S P ++
Sbjct: 62   SDPFSSASSSDSPSGVTSSTLPSSDSSDSSSGSLSQTSTQPSATGTSSSAPQSSSSPESS 121

Query: 965  RTLTCSANAYRSR----ISVLASRKRSTPSRWYLSSLQRCSKFAWNPADSTMKKRIE*PL 798
             +++ S++ + S     I+  +S   ++ S    SS+ R S    +   ST         
Sbjct: 122  NSVSQSSSGFSSGSSSGITSSSSGFSTSSSPSGSSSVPRSS----SSGSSTPSSSSAVSS 177

Query: 797  GKRARYSGNGTACTRPCTNACSAFAGVPRPTE*AHALAVPSG----SAYTVTPAPEPRAL 630
               +  S +G++ +RP  ++ S+ +G         + + PSG    SA T + AP   + 
Sbjct: 178  SGTSSSSASGSSSSRPSGSSSSSASG--------SSSSRPSGSSSSSASTSSSAPSSSSA 229

Query: 629  TNSEIVVSPDITSTVVSDVRGNVSASSRTLAAEEVRTYSCSTLSTANTGPITFA*KSVAG 450
            ++S   VS   +++  S      S+ S + ++ +  + S ++ S++ +     +  S++ 
Sbjct: 230  SSSSSSVSSSTSNSGSSSSSSRSSSGSSSSSSSQSSSASSASSSSSQSSSSASSSSSISP 289

Query: 449  SRPA--PDRTESSTTSGPPGARASAPLPSRTASST 351
            S  +  P  T SS+TS      +S+   SR++S T
Sbjct: 290  SSTSSLPSSTSSSSTS------SSSSSSSRSSSQT 318

>Ecym_6215 Chr6 (403041..404732) [1692 bp, 563 aa] {ON} similar to
           Ashbya gossypii AFR191C
          Length = 563

 Score = 37.4 bits (85), Expect = 0.087
 Identities = 31/133 (23%), Positives = 59/133 (44%), Gaps = 5/133 (3%)
 Frame = -2

Query: 734 SAFAGVPRPTE*AHALAVPSGSAYTVTPAPEPRALTNSEIVVSPDITSTV-----VSDVR 570
           S   G+ +  E    +     +  TV+ +P    + NS   +S   +S++      S + 
Sbjct: 192 SGLEGIIKTIETTAVIMSTQLTTETVSASPTSSTILNSSPSLSASTSSSISSLSSASSIS 251

Query: 569 GNVSASSRTLAAEEVRTYSCSTLSTANTGPITFA*KSVAGSRPAPDRTESSTTSGPPGAR 390
              S SS +  +    T S S+ S+ ++   T +  S + +  A   + SST+S  P A+
Sbjct: 252 STSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSTASSISSSSTSSFSPTAQ 311

Query: 389 ASAPLPSRTASST 351
            S+   ++ ASS+
Sbjct: 312 VSSTASTQEASSS 324

>YJR151C Chr10 complement(712255..715740) [3486 bp, 1161 aa] {ON}
           DAN4Cell wall mannoprotein with similarity to Tir1p,
           Tir2p, Tir3p, and Tir4p; expressed under anaerobic
           conditions, completely repressed during aerobic growth
          Length = 1161

 Score = 37.4 bits (85), Expect = 0.100
 Identities = 51/221 (23%), Positives = 75/221 (33%), Gaps = 9/221 (4%)
 Frame = -2

Query: 983 SEPSAARTLTCSANAYRSRISVLASRKRSTPSRWYLSSLQRCSKFAWNPADSTMKKRIE* 804
           S  S   T T ++    +  +   S   +TP+    S+    S  +  P  ST       
Sbjct: 132 SSTSTTPTTTITSTTSTTSTTPTTSTTSTTPTTSTTSTTPTTSTTSTTPTTSTTSTT--- 188

Query: 803 PLGKRARYSGNGTACTRPCTNACSAFAGVPRPTE*AHALAVPSGSAYTVTPAPEPRALTN 624
                       T  T P T+  S       PT  +     P+ S  + TP       T+
Sbjct: 189 --------PTTSTTSTTPTTSTTST-----TPTT-STTSTTPTTSTTSTTPTTSTTPTTS 234

Query: 623 SEIVVS--------PDITSTVVSDVRGNVSASSRTLAAEEVRTYSC-STLSTANTGPITF 471
           +    S        P  +ST  +        +S T  A    T S  ST ST +T P T 
Sbjct: 235 TTSTTSQTSTKSTTPTTSSTSTTPTTSTTPTTSTTSTAPTTSTTSTTSTTSTISTAPTTS 294

Query: 470 A*KSVAGSRPAPDRTESSTTSGPPGARASAPLPSRTASSTD 348
              S   +  A   +  STT+      AS   P+ + +STD
Sbjct: 295 TTSSTFSTSSASASSVISTTATTSTTFASLTTPATSTASTD 335

>KLTH0E05940g Chr5 (536972..538642) [1671 bp, 556 aa] {ON} some
           similarities with uniprot|P38739 Saccharomyces
           cerevisiae YHL028W WSC4 cell wall integrity and stress
           response component 4 Putative integral membrane protein
           containing novel cysteine motif. Similarity to SLG1
           (WSC1) WSC2 and WSC3
          Length = 556

 Score = 37.0 bits (84), Expect = 0.11
 Identities = 30/146 (20%), Positives = 65/146 (44%)
 Frame = -2

Query: 788 ARYSGNGTACTRPCTNACSAFAGVPRPTE*AHALAVPSGSAYTVTPAPEPRALTNSEIVV 609
           A  + + ++      ++ S+ A     T  + A +V S ++ T +      + T S +  
Sbjct: 114 ASSTSSASSTVSSTASSVSSTASSVSSTASSTASSVSSAASSTASSVSSAASSTASSVSS 173

Query: 608 SPDITSTVVSDVRGNVSASSRTLAAEEVRTYSCSTLSTANTGPITFA*KSVAGSRPAPDR 429
           +   TS+ +       S++S + ++    + + S  +++ T P + A  S + S P    
Sbjct: 174 AASSTSSSIITSSSTSSSTSSSTSSTSTSSSTSSEATSSATSPASSASSSSSSSSPPTSS 233

Query: 428 TESSTTSGPPGARASAPLPSRTASST 351
             SST+S  P A ++A   S + S++
Sbjct: 234 EPSSTSSTTPTASSAAASASASTSAS 259

 Score = 33.5 bits (75), Expect = 1.4
 Identities = 46/216 (21%), Positives = 90/216 (41%), Gaps = 5/216 (2%)
 Frame = -2

Query: 983 SEPSAARTLTCSANAYRSRISVLASRKRSTPSRWYLSSLQRCSKFAWNPADSTMKKRIE* 804
           S  SA+ T++ +A++  S  S ++S   ST S   +SS    +  + + A S+    +  
Sbjct: 116 STSSASSTVSSTASSVSSTASSVSSTASSTASS--VSSAASSTASSVSSAASSTASSVS- 172

Query: 803 PLGKRARYSGNGTACTRPCTNACSAFAGVPRPTE*AHALAVPSGSAYTVTPAPEPRALTN 624
                A  S + +  T   T++ ++ +     T         S S+   + A  P +  +
Sbjct: 173 ----SAASSTSSSIITSSSTSSSTSSSTSSTSTS-------SSTSSEATSSATSPASSAS 221

Query: 623 SEIVVSPDITSTVVSDVRGNVSASSRTLAAEEVRTYSC-----STLSTANTGPITFA*KS 459
           S    S   TS+  S        +S   A+    T +      ST S+  + P+T +  S
Sbjct: 222 SSSSSSSPPTSSEPSSTSSTTPTASSAAASASASTSASSSATPSTSSSVTSTPLTTSSSS 281

Query: 458 VAGSRPAPDRTESSTTSGPPGARASAPLPSRTASST 351
            + +  +    +++++S  P A +SA L S +  S+
Sbjct: 282 TSQTSSSSSTLQTTSSSSTPQASSSAALSSTSPPSS 317

>YNL176C Chr14 complement(305070..306980) [1911 bp, 636 aa] {ON}
            TDA7Cell cycle-regulated gene of unknown function,
            promoter bound by Fkh2p; null mutant is sensitive to
            expression of the top1-T722A allele
          Length = 636

 Score = 37.0 bits (84), Expect = 0.12
 Identities = 83/334 (24%), Positives = 140/334 (41%), Gaps = 21/334 (6%)
 Frame = -2

Query: 1346 TPTSMLPSNTSPGACRSTRLSRWPSTHNSLATRSEAPFSMDNVKLSPKFRYTNPGALNAL 1167
            TP+  + S+TSP +  S+  S W S  ++  T S +  S+ +   S     ++P +L   
Sbjct: 118  TPSMSIFSSTSPMSSSSSITSEWSSLTSTTPTLSSSATSLSSSWSS----LSSPSSL--- 170

Query: 1166 PRIVE*PAINNSFSLSRDSSASNANTCSCLRSGS--DKGDGTYVS-SRCGVFSRAK*AYN 996
                    +++S SLS  SS S+    S     S       T +S S   + S +  ++ 
Sbjct: 171  -------LVSSSLSLSLSSSYSDTKLFSFDSRSSIFSPSTPTVISPSYTYLSSISATSFQ 223

Query: 995  PANCSEPSAARTLTCSA-NAYRSRISVLASRKRSTPSRWYLSSL---------QRCSKFA 846
             +  SE S++   T S+ +   ++ +   S  R+T + +Y SSL          + SK +
Sbjct: 224  ISTTSELSSSWFSTISSPSTISNKDTTFPSSSRNTSTSFYSSSLSSTNDFSTISKSSKLS 283

Query: 845  WNPADSTMK-KRIE*PLGKRARYSGNGTACTRPCTNACSAFAGVPRPTE*AHALAVPSGS 669
             + + ST+    I  P       S +     RP +++ S        T  A++      S
Sbjct: 284  PSASSSTVSISTISVPTSSSVSSSSSKVPSNRPSSSSSS------DDTTSAYSSTYTFQS 337

Query: 668  AYTVTPA---PEPRALTNSEIVVSPDITST-VVSDVRGNVSASSRTLAAEEVRTYSCSTL 501
              + T +   P  +  + S I  SP  TS+ V + V  + S  S+T+     +TY  +  
Sbjct: 338  LQSTTSSSIPPTTQTPSTSTISTSPIPTSSQVFNTVAISSSEDSKTIYYFYTQTYDITDS 397

Query: 500  STA-NTG-PITFA-*KSVAGSRPAPDRTESSTTS 408
            ST   TG P T A  KS   S  AP  T ++  S
Sbjct: 398  STTFVTGLPTTIAVAKSEVTSFSAPSSTITADMS 431

 Score = 31.2 bits (69), Expect = 7.4
 Identities = 19/70 (27%), Positives = 31/70 (44%)
 Frame = -2

Query: 563 VSASSRTLAAEEVRTYSCSTLSTANTGPITFA*KSVAGSRPAPDRTESSTTSGPPGARAS 384
           +S SS+   +    T S ST+S   +  ++ +   V  +RP+   +   TTS        
Sbjct: 276 ISKSSKLSPSASSSTVSISTISVPTSSSVSSSSSKVPSNRPSSSSSSDDTTSAYSSTYTF 335

Query: 383 APLPSRTASS 354
             L S T+SS
Sbjct: 336 QSLQSTTSSS 345

>YJL078C Chr10 complement(291336..293981) [2646 bp, 881 aa] {ON}
            PRY3Cell wall protein with a role in mating efficiency;
            expression of full-length transcript is daughter
            cell-specific; in response to alpha factor, a short
            transcript starting at +452 is expressed and the long
            form is repressed by Ste12p
          Length = 881

 Score = 37.0 bits (84), Expect = 0.13
 Identities = 54/248 (21%), Positives = 107/248 (43%), Gaps = 6/248 (2%)
 Frame = -2

Query: 1136 NSFSLSRDSSASNANTCSCLRSGS----DKGDGTYVSSRCGVFSRAK*AYNPANCSEPSA 969
            +S S S  S+++ ++T S + S       +G  T VSS     S      NPA  +  +A
Sbjct: 166  SSSSSSSSSTSTTSDTVSTISSSIMPAVAQGYTTTVSSAASSSSLKSTTINPAKTATLTA 225

Query: 968  ARTLTCSANAYRSRISVLASRKRSTPSRWYLSSLQRCSKFAWNPADSTMKKRIE*PLGKR 789
            + +   +++      S ++S   S+ +  Y +S           + +T            
Sbjct: 226  SSSTVITSSTESVGSSTVSSASSSSVTTSYATSSSTVVSSDATSSTTTTS---------- 275

Query: 788  ARYSGNGTACTRPCTNACSAFAGVPRPTE*AHALAVPSGSAYTVTPAPEPRALTNSEIVV 609
            +  + + T  + P ++  +A +  P     A + A  S SA T   A    A+++S  +V
Sbjct: 276  SVATSSSTTSSDPTSSTAAASSSDP-----ASSSAAASSSASTENAASSSSAISSSSSMV 330

Query: 608  SPDITSTVVSDVRGNVSASSRTLAAEEVRT--YSCSTLSTANTGPITFA*KSVAGSRPAP 435
            S  ++ST+ +      +ASSR++ +  V +  ++ +T+ +A T   T +  +   S  A 
Sbjct: 331  SAPLSSTLTTS-----TASSRSVTSNSVNSVKFANTTVFSAQT---TSSVSASLSSSVAA 382

Query: 434  DRTESSTT 411
            D  + ST+
Sbjct: 383  DDIQGSTS 390

 Score = 33.9 bits (76), Expect = 1.1
 Identities = 41/137 (29%), Positives = 58/137 (42%), Gaps = 2/137 (1%)
 Frame = -2

Query: 755 RPCTNACSAFAGVPRPTE*AHALAVPSGSAYTVTPAPEPRALTNSEIVVSPDITSTVVSD 576
           +  T   S+   +   TE   +  V S S+ +VT +      T+S  VVS D TS+  + 
Sbjct: 219 KTATLTASSSTVITSSTESVGSSTVSSASSSSVTTS----YATSSSTVVSSDATSSTTTT 274

Query: 575 VRGNVSASSRTLAAEEVRTYSCSTLSTANTGPITFA*KSVAGSRPAPDRTESSTTS--GP 402
              +V+ SS T       T S  T STA       A  S A S  A     +S++S    
Sbjct: 275 --SSVATSSST-------TSSDPTSSTAAASSSDPASSSAAASSSASTENAASSSSAISS 325

Query: 401 PGARASAPLPSRTASST 351
             +  SAPL S   +ST
Sbjct: 326 SSSMVSAPLSSTLTTST 342

>ZYRO0G11242g Chr7 (900370..904833) [4464 bp, 1487 aa] {ON} weakly
            similar to uniprot|P32334 Saccharomyces cerevisiae
            YGR014W MSB2 Mucin family member at the head of the
            Cdc42p- and MAP kinase-dependent filamentous growth
            signaling pathway also functions as an osmosensor in
            parallel to the Sho1p-mediated pathway potential Cdc28p
            substrate
          Length = 1487

 Score = 37.0 bits (84), Expect = 0.13
 Identities = 79/393 (20%), Positives = 148/393 (37%), Gaps = 13/393 (3%)
 Frame = -2

Query: 1385 AGTSA-FRPKEAGTTPTSMLPSNTSPGACRS---TRLSRWPSTHNSLATR-------SEA 1239
            +G+SA  +     + P++ L SN  P    S   T +S+ PST   LA+        S+A
Sbjct: 119  SGSSAQSQQSSVSSYPSAALTSNYQPSISSSAPGTSISQTPSTSQGLASSIEALTSGSQA 178

Query: 1238 PFSMDNVKLSPKFRY-TNPGALNALPRIVE*PAINNSFSLSRDSSASNANTC-SCLRSGS 1065
            P S    ++S  +   T      + P+    P+ +   +LS    AS++ T  S  +  +
Sbjct: 179  PDSSSQTQISNAYSQGTTTSGFQSSPQT---PSSSQGPTLSSQGPASSSETSPSSSQEPA 235

Query: 1064 DKGDGTYVSSRCGVFSRAK*AYNPANCSEPSAARTLTCSANAYRSRISVLASRKRSTPSR 885
                G   SS+   FS              S   T +   +   S  S   S++ ++ S+
Sbjct: 236  SSSQGLPSSSQAPTFS--------------SQGSTSSTQGSTPSSEASPSGSQEPASSSQ 281

Query: 884  WYLSSLQRCSKFAWNPADSTMKKRIE*PLGKRARYSGNGTACTRPCTNACSAFAGVPRPT 705
               SS Q     +  P  S+            A +S +      P  ++ +  +    PT
Sbjct: 282  APTSSSQGLPSSSQVPTPSS-----------EAPFSSSQV----PTPSSVAPSSSSQAPT 326

Query: 704  E*AHALAVPSGSAYTVTPAPEPRALTNSEIVVSPDITSTVVSDVRGNVSASSRTLAAEEV 525
              +      S + ++ +  P P + T S     P  +S   S       +SS+  A+   
Sbjct: 327  SSSQGPTSSSEAPFSSSQVPTPSSETPSSSSQVPTPSSAAPSSSSEASPSSSQEPASNSQ 386

Query: 524  RTYSCSTLSTANTGPITFA*KSVAGSRPAPDRTESSTTSGPPGARASAPLPSRTASSTDR 345
               S S   T++   ++ + + V+ S   P  ++S+++S      +  P  S  A ++D 
Sbjct: 387  APTSSSQGLTSSFEGLSSSSQGVSSSSQEPSSSQSTSSS------SQTPYSSSQAPTSDS 440

Query: 344  XXXXXXXXXXXXXXXXLQNNSVSFMSPAATPVS 246
                              ++S + ++ A+TP S
Sbjct: 441  QAPASSSVSQPALSVSQPSSSSAQLAAASTPSS 473

>TPHA0F00610 Chr6 (143599..145419) [1821 bp, 606 aa] {ON} Anc_4.89
            YGL028C
          Length = 606

 Score = 36.6 bits (83), Expect = 0.15
 Identities = 57/262 (21%), Positives = 105/262 (40%), Gaps = 10/262 (3%)
 Frame = -2

Query: 1106 ASNANTCSCLRSGSD---KGDGTYVSSRCGVFSRAK*AYNPANCSEPSAA--RTLTCSAN 942
            ++ ++T S + + +D   K  G+YV S     + A      A+ S PS++  R +T    
Sbjct: 80   SAGSDTTSVVTTYTDAENKNGGSYVQS----LTSASSVTPIASLSSPSSSDSRDITSETG 135

Query: 941  AYRSRISVLASRKRSTPSRWYLSSLQRCSKFAWNPADSTMKKRIE*PL-----GKRARYS 777
               SR + +AS   S       SS    S F  +    T   +   PL        ++ S
Sbjct: 136  VVSSRTANMASSDPSVTG----SSSNSTSVFEISNGSGTTTSKNSSPLTTSSTSSTSKAS 191

Query: 776  GNGTACTRPCTNACSAFAGVPRPTE*AHALAVPSGSAYTVTPAPEPRALTNSEIVVSPDI 597
             + +  T+  T++ S+ +     +  +   +  S S+ + T +    + T+S    S   
Sbjct: 192  TSSSKITKS-TSSASSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTS 250

Query: 596  TSTVVSDVRGNVSASSRTLAAEEVRTYSCSTLSTANTGPITFA*KSVAGSRPAPDRTESS 417
            +++  S      S SS +  +    T S S+ S+A++     +  S +        + SS
Sbjct: 251  STSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSASSTSSASSTSSTSAISSTSSMSSSS 310

Query: 416  TTSGPPGARASAPLPSRTASST 351
            T+S      +SAP  S    ST
Sbjct: 311  TSSVITSINSSAPSSSTVIVST 332

>Smik_63.1 Chr63 (64..1056) [993 bp, 331 aa] {ON}  YOL155C (REAL)
          Length = 331

 Score = 36.2 bits (82), Expect = 0.16
 Identities = 35/158 (22%), Positives = 72/158 (45%), Gaps = 15/158 (9%)
 Frame = -2

Query: 779 SGNGTACTRPC-TNACSAFAGVPRPTE*AHALAVPSGSAYTVTPAPEPRALTNSEIVVSP 603
           S +G++ T P  T + ++ + +  P+    + + PSG+  + + +    +  +   + SP
Sbjct: 55  SSSGSSITSPSGTGSSASGSSITSPSGSGSSSSGPSGTGSSASSSSASSSSASGSSITSP 114

Query: 602 DITSTVVSDVRGNVSASSRTLAAEEVRTYSCSTLSTANTGPITFA*KSVAGSRPAPDRTE 423
             + +  S   G  S++S + A+    T S S   ++++GP      + + S  +   + 
Sbjct: 115 SGSGSSSSGPSGTGSSASSSSASGSSIT-SPSGSGSSSSGPSGTGSSASSSSASSSSASG 173

Query: 422 SSTTS--------------GPPGARASAPLPSRTASST 351
           SS TS               PPG+ +S+P PS + SS+
Sbjct: 174 SSITSPSGSGSSSSGPSITSPPGSGSSSPGPSGSGSSS 211

 Score = 33.1 bits (74), Expect = 1.5
 Identities = 41/161 (25%), Positives = 70/161 (43%), Gaps = 10/161 (6%)
 Frame = -2

Query: 803 PLGKRARYSG-NGTACTRPCTNACSAFAGVPRPTE*AHALAVPSGSAYTVTPAPEPRALT 627
           P G  +  SG +GT  +   ++A S+ A     T  + + +  SG + T + A    A  
Sbjct: 79  PSGSGSSSSGPSGTGSSASSSSASSSSASGSSITSPSGSGSSSSGPSGTGSSASSSSASG 138

Query: 626 NSEIVVSPDITSTVVSDVRGNVSASSRTLAAEEVRTYSCSTL----STANTGPITFA*KS 459
           +S  + SP  + +  S   G  S++S + A+    + S  T      ++++GP   +   
Sbjct: 139 SS--ITSPSGSGSSSSGPSGTGSSASSSSASSSSASGSSITSPSGSGSSSSGPSITSPPG 196

Query: 458 VAGSRPAPDRTESSTTSG-----PPGARASAPLPSRTASST 351
              S P P  + SS+ SG     P G   SAP  S T + +
Sbjct: 197 SGSSSPGPSGSGSSSASGSSITSPSGTGPSAPGSSATITQS 237

>YMR317W Chr13 (907364..910786) [3423 bp, 1140 aa] {ON} Putative
            protein of unknown function with some similarity to
            sialidase from Trypanosoma; YMR317W is not an essential
            gene
          Length = 1140

 Score = 36.6 bits (83), Expect = 0.17
 Identities = 71/341 (20%), Positives = 135/341 (39%), Gaps = 17/341 (4%)
 Frame = -2

Query: 1382 GTSAFRPKEAGTTPTS----MLPSNTSPGACRSTRLSRWPSTHNSLATR---SEAPFSMD 1224
            GT++   KE  ++ TS    +L S +SP +   +    + ST  S+ +    SEAP +  
Sbjct: 210  GTTSDASKEVFSSSTSDVSSLLSSTSSPASSTISETLPFSSTILSITSSPVSSEAPSATS 269

Query: 1223 NVKLSPKFRYTNPGALNALPRIV------E*PAINNSFSLSRDSSASNANTCSCLRS--G 1068
            +V  S     T+    +  P         E P+  +S   S   S+++++  S + S   
Sbjct: 270  SVISSEASWATSSSVSSEAPLATSSVVSSEAPSSTSSVVSSEAPSSTSSSVSSEISSTTS 329

Query: 1067 SDKGDGTYVSSRCGVFSRAK*AYNPANCSEPSAARTLTCSANAYRSRISVLASRKRSTPS 888
            S       +++   V S A  + + +  SE S+  + + S+ A  +  SV++S   S+ S
Sbjct: 330  SSVSSEAPLATSSVVSSEAPSSTSSSVSSEISSTTSSSVSSEAPLATSSVVSSEAPSSTS 389

Query: 887  RWYLSSLQRCSKFAWNPADSTMKKRIE*PLGKRARYSG--NGTACTRPCTNACSAFAGVP 714
                S           P+ ++     E P    +  S   + T  +   +   SA + + 
Sbjct: 390  SSVSSEA---------PSSTSSSVSSEAPSSTSSSVSSEISSTKSSVMSSEVSSATSSL- 439

Query: 713  RPTE*AHALAVPSGSAYTVTPAPEPRALTNSEIVVSPDITSTVVSDVRGNVSASSRTLAA 534
                      V S +   ++     R  ++    V+  + +T  S V  ++  SS TLA+
Sbjct: 440  ----------VSSEAPSAISSLASSRLFSSKNTSVTSTLVATEASSVTSSLRPSSETLAS 489

Query: 533  EEVRTYSCSTLSTANTGPITFA*KSVAGSRPAPDRTESSTT 411
              +   S ST   +     T A  S  GS+ +   +  +T+
Sbjct: 490  NSIIESSLSTGYNSTVSTTTSAASSTLGSKVSSSNSRMATS 530

>TDEL0C00460 Chr3 (67471..72429) [4959 bp, 1652 aa] {ON} 
          Length = 1652

 Score = 36.6 bits (83), Expect = 0.18
 Identities = 45/211 (21%), Positives = 84/211 (39%), Gaps = 2/211 (0%)
 Frame = -2

Query: 740  ACSAFAGVPRPTE*AHALAVPSGSAYTVTPAPEPRALTNSEIVVSP--DITSTVVSDVRG 567
            A S+ A   R +     +  PS SA   + A   R+++ + + +S     +STV S   G
Sbjct: 851  ASSSIASASRSSS---TVNTPSSSALRSSSASATRSVSRNSVSISSLAGSSSTVSSPSDG 907

Query: 566  NVSASSRTLAAEEVRTYSCSTLSTANTGPITFA*KSVAGSRPAPDRTESSTTSGPPGARA 387
            N +ASS  + +    T S ++ S A +   + A  SV+ S        +S +S    A  
Sbjct: 908  N-TASSSVVRSSSPATSSIASSSVATSSTPSSAAHSVSSSAVRSSSANASASSTRDSAAT 966

Query: 386  SAPLPSRTASSTDRXXXXXXXXXXXXXXXXLQNNSVSFMSPAATPVSCLPRLPHFFAARE 207
            ++ + S  +SS D                    +S +  +P+++ +            R+
Sbjct: 967  ASVVSSLRSSSADASRSLTRDSAATSSAVSSLRSSSAVDAPSSSALRASSADASGSLTRD 1026

Query: 206  PLAAIAATDDTNGPHTVCTQCLARPRQRTNS 114
             ++  +A   +    T  T+ L R    T+S
Sbjct: 1027 SVSTSSAAKSSRSSSTSATRSLTRDSADTSS 1057

 Score = 32.0 bits (71), Expect = 4.8
 Identities = 30/139 (21%), Positives = 59/139 (42%)
 Frame = -2

Query: 767  TACTRPCTNACSAFAGVPRPTE*AHALAVPSGSAYTVTPAPEPRALTNSEIVVSPDITST 588
            +A + P     S  +G    T+   ++A    S+    P+    A+ +S        +S+
Sbjct: 795  SATSVPSAKGSSTNSGSLTKTQVTTSVASSLASSSNFYPSSVSSAVRSSSAAAPSVASSS 854

Query: 587  VVSDVRGNVSASSRTLAAEEVRTYSCSTLSTANTGPITFA*KSVAGSRPAPDRTESSTTS 408
            + S  R   S++  T ++  +R+ S S   + +   ++ +  S+AGS           T+
Sbjct: 855  IASASRS--SSTVNTPSSSALRSSSASATRSVSRNSVSIS--SLAGSSSTVSSPSDGNTA 910

Query: 407  GPPGARASAPLPSRTASST 351
                 R+S+P  S  ASS+
Sbjct: 911  SSSVVRSSSPATSSIASSS 929

>KLTH0F01254g Chr6 (98944..100686) [1743 bp, 580 aa] {ON} some
           similarities with uniprot|P39712 Saccharomyces
           cerevisiae YAL063C
          Length = 580

 Score = 36.2 bits (82), Expect = 0.20
 Identities = 46/165 (27%), Positives = 65/165 (39%), Gaps = 17/165 (10%)
 Frame = -2

Query: 797 GKRARYSGNGTACTRPCTNACSAFAGVPRPTE*AHALAVPSGSAYTVTPAPEPRALTN-- 624
           G  + Y+  G A   P T A SA   V +PT     +   SG   +   A E   +T+  
Sbjct: 377 GHESVYTTTGPA---PATGATSAVTTVVQPTTIVKTITSCSGGVCSTQSATETSQVTSVV 433

Query: 623 --SEIVVSPDITSTVVSDVRGN-VSASSRTLAAEEVRTYSCSTLSTANTG----PITFA* 465
             S+   +   T T  + V     + +  T A     T +    ST  TG    P T A 
Sbjct: 434 TVSKSYAAASSTETSATGVESTPATGAESTPATGAESTPATGAESTPATGAESTPATAAT 493

Query: 464 KSVAGSRPAPDRTES---STTSGPPGAR-----ASAPLPSRTASS 354
            + AGS PA     +   S+ S P GA       +AP  + TA+S
Sbjct: 494 GTAAGSSPATGAATTGVESSASAPTGAAETGSGTAAPAATGTAAS 538

>ZYRO0G07942g Chr7 (642460..644787) [2328 bp, 775 aa] {ON} no
            similarity
          Length = 775

 Score = 36.2 bits (82), Expect = 0.21
 Identities = 67/282 (23%), Positives = 125/282 (44%), Gaps = 17/282 (6%)
 Frame = -2

Query: 1145 AINNSFSLSRDSSASNANTCSCLRSGSDKG-DGTYVSSRCG-------------VFSRAK 1008
            ++N + S S D S S++ T +   S    G  G+Y SS                  S + 
Sbjct: 111  SVNAATSSSSDFSPSSSETPTASSSSQTGGTSGSYSSSSAPGPTDSSSSVSNFESSSPSP 170

Query: 1007 *AYNPANC-SEPSAARTLTCSANAYR--SRISVLASRKRSTPSRWYLSSLQRCSKFAWNP 837
             + +PA+  S  SA+ T + S++ Y   S  S +AS   + PS    SS    S  + N 
Sbjct: 171  SSSSPASLFSSSSASPTASDSSSTYPGLSSSSEVASSGSAVPSS--TSSYSSPSSSSANT 228

Query: 836  ADSTMKKRIE*PLGKRARYSGNGTACTRPCTNACSAFAGVPRPTE*AHALAVPSGSAYTV 657
            A  +    +   +   +  S + ++ +   +++ S+F+        + + AVPS S+Y+ 
Sbjct: 229  ASGSSYSSVSSDIYPSSTPSSSSSSSSYSPSSSFSSFS--------SSSSAVPSSSSYSS 280

Query: 656  TPAPEPRALTNSEIVVSPDITSTVVSDVRGNVSASSRTLAAEEVRTYSCSTLSTANTGPI 477
             P       ++S    S   +S+ +S     VS+SS + +A    + S S  S++++ P 
Sbjct: 281  LP-------SSSHSYSSSTPSSSSISSSSSFVSSSSSSSSAP---SSSSSLPSSSSSIP- 329

Query: 476  TFA*KSVAGSRPAPDRTESSTTSGPPGARASAPLPSRTASST 351
                 S + S P+    +SS++S      +S+ +PS + SS+
Sbjct: 330  -----SSSSSAPSSSSYQSSSSSSSSIFSSSSSIPSSSYSSS 366

 Score = 36.2 bits (82), Expect = 0.21
 Identities = 66/313 (21%), Positives = 139/313 (44%), Gaps = 11/313 (3%)
 Frame = -2

Query: 1355 AGTTPTSMLPSNTSPGACRSTRLSRWPSTHNSL-ATRSEAPFSMDNVKLSPKFRYTNPGA 1179
            + +TP+S   S++S     S+  S  PS+ +SL ++ S  P S  +   S  ++ ++  +
Sbjct: 289  SSSTPSSSSISSSSSFVSSSSSSSSAPSSSSSLPSSSSSIPSSSSSAPSSSSYQSSSSSS 348

Query: 1178 LNALPRIVE*PAIN-NSFSLSRDSSASNANTCSCLR-SGSDKGDGTYVSSRCGVFS--RA 1011
             +        P+ + +S S SR  S S++ + S    S S     T  S   G F    +
Sbjct: 349  SSIFSSSSSIPSSSYSSSSTSRSYSPSSSGSSSSFSYSSSWSPTSTASSGSSGAFGYLSS 408

Query: 1010 K*AYNPANCSEPSAARTLTCSANAYRSRISVLASRKRSTPSRWYLS------SLQRCSKF 849
              +Y+P++    S++ + +  A++  S   + A+   S  S  Y S      SL + +  
Sbjct: 409  SSSYSPSS----SSSFSYSSKASSSSSDFILDATSSSSDSSSAYSSIGSSSDSLPKSTTT 464

Query: 848  AWNPADSTMKKRIE*PLGKRARYSGNGTACTRPCTNACSAFAGVPRPTE*AHALAVPSGS 669
            +++P+ S+            + YS + ++ + P +   S++   P  T  + + + PS +
Sbjct: 465  SYSPSSSSSSSVWSPTSSPSSSYSSSSSSYSWPISPTTSSY---PSSTS-SESSSDPSST 520

Query: 668  AYTVTPAPEPRALTNSEIVVSPDITSTVVSDVRGNVSASSRTLAAEEVRTYSCSTLSTAN 489
              + T +    +++++    S   ++ V +    +  +SS TL +  V ++  S  ST +
Sbjct: 521  ITSNTWS----SISSASSYPSSGSSTPVATSSGSSSQSSSDTLKSAFVTSF--SVRSTTS 574

Query: 488  TGPITFA*KSVAG 450
            + PI    +S  G
Sbjct: 575  SSPIKTLTRSAGG 587

>ZYRO0C02398g Chr3 complement(192168..193229) [1062 bp, 353 aa] {ON}
           some similarities with uniprot|P48560 Saccharomyces
           cerevisiae YNL300W
          Length = 353

 Score = 35.8 bits (81), Expect = 0.22
 Identities = 27/102 (26%), Positives = 46/102 (45%), Gaps = 2/102 (1%)
 Frame = -2

Query: 686 AVPSGSAYTVTPAPEPRALTNSEI--VVSPDITSTVVSDVRGNVSASSRTLAAEEVRTYS 513
           + PSG++ + + AP     T++    V S    ST  S+   + S+S+   +A    T+S
Sbjct: 214 STPSGASASASAAPVSTGATSAPASPVSSSSAPSTSASEAESSFSSSATLSSAAASSTFS 273

Query: 512 CSTLSTANTGPITFA*KSVAGSRPAPDRTESSTTSGPPGARA 387
            +  S A     T    +  GS  +   T + + SGP G +A
Sbjct: 274 SAVASGAQNTTHTTHTTNTTGSAGSSLTTSAVSISGPSGVKA 315

>NCAS0G02800 Chr7 (515232..518018) [2787 bp, 928 aa] {ON} 
          Length = 928

 Score = 36.2 bits (82), Expect = 0.22
 Identities = 70/350 (20%), Positives = 146/350 (41%), Gaps = 5/350 (1%)
 Frame = -2

Query: 1385 AGTSAFRPKEAGTTPTSM--LPSNTSPGACRSTRLSRWPSTHNSLATRSEAPFSMDNVKL 1212
            A TS++   E+ +  +S+  + S ++     ++  S   S   SL++ S A  S+ +V +
Sbjct: 131  AETSSYSISESASQSSSLSSIASGSATQVSSASETSSGLSVTPSLSSESTAASSLVSVSI 190

Query: 1211 SPKFRYTNPGALNALPRIVE*PAINNSFSLSRDSSASNANTCSCLRSGSDKGDGTYVSSR 1032
            S    YT   A+++       P++  S S S   ++S+  + S + S S           
Sbjct: 191  SGS--YTILSAVSSSEETT--PSVALSASKSGYFNSSSVQSSSSIASSS----------- 235

Query: 1031 CGVFSRAK*AYNPANCSEPSAARTLTCS---ANAYRSRISVLASRKRSTPSRWYLSSLQR 861
              + S    +   A+ S  S+   LT S   A++  S  +  AS   +  S    SS+ +
Sbjct: 236  --ILSLTSSSSLSASSSSSSSQTVLTSSSSGASSSASESATGASSSTAQTSSGASSSVAQ 293

Query: 860  CSKFAWNPADSTMKKRIE*PLGKRARYSGNGTACTRPCTNACSAFAGVPRPTE*AHALAV 681
             S  + + A S+       P    +  +   +  +   + A  A + V + +  + ++  
Sbjct: 294  TSVASSSVAPSSGASNSVVPSSGASSSAAPSSGVSSSASQASGASSSVAQTSGASSSVVP 353

Query: 680  PSGSAYTVTPAPEPRALTNSEIVVSPDITSTVVSDVRGNVSASSRTLAAEEVRTYSCSTL 501
             SG++ +V P+       +S +V S   +S+      G +S++S+  +         S+ 
Sbjct: 354  SSGASNSVAPSSG----ASSSVVPSSGASSSASQAFSGVLSSASQASSG-------VSSS 402

Query: 500  STANTGPITFA*KSVAGSRPAPDRTESSTTSGPPGARASAPLPSRTASST 351
            +  ++G  +    S   S      + +S++  P    +S+ +PS  ASS+
Sbjct: 403  AAPSSGVSSSVVPSSGASSSVAQTSGASSSVAPSSGASSSVVPSSGASSS 452

>KLTH0D05698g Chr4 (508215..510326) [2112 bp, 703 aa] {ON} some
           similarities with uniprot|P28319 Saccharomyces
           cerevisiae YKL096W CWP1 Cell wall mannoprotein linked to
           a beta-1 3- and beta-1 6-glucan heteropolymer through a
           phosphodiester bond involved in cell wall organization
          Length = 703

 Score = 35.8 bits (81), Expect = 0.28
 Identities = 33/138 (23%), Positives = 63/138 (45%), Gaps = 6/138 (4%)
 Frame = -2

Query: 746 TNACSAFAGVPRPTE*AHALAVPSGSAYTVTPA-PEPRALTNSEIVVSPDI---TSTVVS 579
           ++  S+ + V  PT    + A+PS SA   +PA P   A+ +S ++ S      +S V+S
Sbjct: 306 SSTVSSSSAVSSPTAIPSSSAIPSSSAIPSSPAIPSSSAIPSSSVISSSSAIPSSSVVLS 365

Query: 578 D--VRGNVSASSRTLAAEEVRTYSCSTLSTANTGPITFA*KSVAGSRPAPDRTESSTTSG 405
              V  + +ASS +         S S +S+++    + A  S + +  +   + S   S 
Sbjct: 366 SIIVTSSTTASSSSAIPSSTAASSSSAISSSSAISSSLAASSSSAALSSSAASSSLAASS 425

Query: 404 PPGARASAPLPSRTASST 351
                +S+ + S  A+S+
Sbjct: 426 SSAISSSSAISSSLAASS 443

>KLTH0H09218g Chr8 (793572..795695) [2124 bp, 707 aa] {ON} conserved
           hypothetical protein
          Length = 707

 Score = 35.8 bits (81), Expect = 0.28
 Identities = 25/112 (22%), Positives = 51/112 (45%)
 Frame = -2

Query: 686 AVPSGSAYTVTPAPEPRALTNSEIVVSPDITSTVVSDVRGNVSASSRTLAAEEVRTYSCS 507
           A P  +A +   +  P    ++   V P + S+ V+      + SS + +A      S S
Sbjct: 9   AAPGAAATSTAVSSAPEGQPSAVSPVEPSVASSTVTTPGTEATPSSVSSSASAFSPSSSS 68

Query: 506 TLSTANTGPITFA*KSVAGSRPAPDRTESSTTSGPPGARASAPLPSRTASST 351
           +L   ++   +FA  S + + P+     + TTS    + +S+P+ S  +S++
Sbjct: 69  SLPPLSSASPSFASPSSSSTSPSSPNPPADTTSSSSLSPSSSPVSSLLSSAS 120

>Kwal_55.20627 s55 (496681..498414) [1734 bp, 577 aa] {ON} YOR009W
            (TIR4) -  [contig 143] FULL
          Length = 577

 Score = 35.4 bits (80), Expect = 0.35
 Identities = 58/267 (21%), Positives = 107/267 (40%), Gaps = 2/267 (0%)
 Frame = -2

Query: 1385 AGTSAFRPKEAG--TTPTSMLPSNTSPGACRSTRLSRWPSTHNSLATRSEAPFSMDNVKL 1212
            + T  F    +G  T+ TS      S     S+ L++  ST +S  T S++  S  +   
Sbjct: 153  SSTEVFSGPASGGFTSTTSSSTQLKSSSTLISSDLTKSSSTESSTTTSSQSSSSSGDDSS 212

Query: 1211 SPKFRYTNPGALNALPRIVE*PAINNSFSLSRDSSASNANTCSCLRSGSDKGDGTYVSSR 1032
            +     ++  A +++P        ++S  LS DSS++  ++ S   + S     +  +S 
Sbjct: 213  TSTQSSSSSRASSSVP------LTSSSSPLSTDSSSTAPSSSSSSPNSSSSSSASSTTSS 266

Query: 1031 CGVFSRAK*AYNPANCSEPSAARTLTCSANAYRSRISVLASRKRSTPSRWYLSSLQRCSK 852
                S +  + + +  S  S+A + T S+ +  S  S  +S   S+ S    S+    S 
Sbjct: 267  STSSSSSSSSPSSSTSSSSSSASSTTSSSTSSSSSSSSSSSSSSSSSSS---STSTSSSL 323

Query: 851  FAWNPADSTMKKRIE*PLGKRARYSGNGTACTRPCTNACSAFAGVPRPTE*AHALAVPSG 672
               +   ST ++            S + T+ T   +   S+ +    P+     L     
Sbjct: 324  IITSSTTSTTEES-----------SSSLTSSTTSLSQETSSKSSTKPPSMITSLLY---- 368

Query: 671  SAYTVTPAPEPRALTNSEIVVSPDITS 591
            S  TVT +P P   +N  IV +  IT+
Sbjct: 369  SVQTVTASPTPGGSSNGHIVTTQVITT 395

 Score = 33.9 bits (76), Expect = 1.1
 Identities = 27/94 (28%), Positives = 48/94 (51%)
 Frame = -2

Query: 632 LTNSEIVVSPDITSTVVSDVRGNVSASSRTLAAEEVRTYSCSTLSTANTGPITFA*KSVA 453
           LT+S   +S D +ST  S    + ++SS + A+    + + S+ S+++    T +  S A
Sbjct: 229 LTSSSSPLSTDSSSTAPSSSSSSPNSSSSSSASSTTSSSTSSSSSSSSPSSSTSSSSSSA 288

Query: 452 GSRPAPDRTESSTTSGPPGARASAPLPSRTASST 351
            S      T SST+S    + +S+   S ++SST
Sbjct: 289 SST-----TSSSTSSSSSSSSSSSSSSSSSSSST 317

>NDAI0A07890 Chr1 complement(1811865..1813862) [1998 bp, 665 aa]
           {ON} 
          Length = 665

 Score = 35.4 bits (80), Expect = 0.36
 Identities = 30/111 (27%), Positives = 40/111 (36%), Gaps = 1/111 (0%)
 Frame = -2

Query: 680 PSGSAYTVTPAPEPRALTNSEIVVSPDITSTVVSDVRGNVSASSRTLAAEEVRTYSCSTL 501
           P     T TP P P          +P  T T  S      +  S T       T S ST 
Sbjct: 127 PPSPTPTPTPTPTPTPTPTPTPTPTPTPTPTTTSTSTSTTTTPSTTTTTSTTSTTSTSTT 186

Query: 500 -STANTGPITFA*KSVAGSRPAPDRTESSTTSGPPGARASAPLPSRTASST 351
            ST  T P T    S   +   P  T  +TT+       S+P+ + T ++T
Sbjct: 187 PSTTTTAPTT----STTSTTTTPSTTTPTTTT-----TTSSPIATPTTTTT 228

 Score = 35.0 bits (79), Expect = 0.47
 Identities = 32/125 (25%), Positives = 49/125 (39%), Gaps = 3/125 (2%)
 Frame = -2

Query: 716 PRPTE*AHALAVPSGSAYTVTPAPEPRALTNS---EIVVSPDITSTVVSDVRGNVSASSR 546
           P PT        P+ +  T TP P P   T S       +P  T+T  +    + S +  
Sbjct: 130 PTPTPTPTPTPTPTPTP-TPTPTPTPTPTTTSTSTSTTTTPSTTTTTSTTSTTSTSTTPS 188

Query: 545 TLAAEEVRTYSCSTLSTANTGPITFA*KSVAGSRPAPDRTESSTTSGPPGARASAPLPSR 366
           T       + + +T + + T P T    S   + P    T +ST+S    A  +A   S 
Sbjct: 189 TTTTAPTTSTTSTTTTPSTTTPTTTTTTSSPIATPTTTTTTTSTSSSATIASNAAVETSS 248

Query: 365 TASST 351
            A+ST
Sbjct: 249 AATST 253

>ZYRO0G14894g Chr7 (1192893..1195970) [3078 bp, 1025 aa] {ON} some
           similarities with uniprot|Q01589 Saccharomyces
           cerevisiae YDR077W SED1 Isolated as a suppressor of an
           erd2 deletion mutant (ERD2 is the HDEL receptor that
           sorts ER proteins) SED1 encodes a cell wall protein.
          Length = 1025

 Score = 35.0 bits (79), Expect = 0.51
 Identities = 35/119 (29%), Positives = 54/119 (45%), Gaps = 4/119 (3%)
 Frame = -2

Query: 695 HALAVPSGSAYTV--TPAPEPRALTNS-EIVVSPDITST-VVSDVRGNVSASSRTLAAEE 528
           H+ A PS S+ +   T A  P   T++ E   +  ITST VVS +    SA +       
Sbjct: 170 HSSAAPSSSSASPSGTGAAAPSEFTSAAESTSTQYITSTEVVSTLTTYCSAPTTITTNGA 229

Query: 527 VRTYSCSTLSTANTGPITFA*KSVAGSRPAPDRTESSTTSGPPGARASAPLPSRTASST 351
             T +  T  T +  P T     V  ++P      SS+++ P G  A+AP  S +A+ +
Sbjct: 230 THTVTAPTTLTISDCPCT-----VTHTKPHSSAAPSSSSASPSGTGAAAPSESTSAAES 283

 Score = 34.3 bits (77), Expect = 0.88
 Identities = 37/135 (27%), Positives = 56/135 (41%), Gaps = 24/135 (17%)
 Frame = -2

Query: 683  VPSGSAYTVTPAPEPRALTNSEIVVSPDITSTVVSDVR-----GNVSASSRTLAAEE--- 528
            V +G  YT T  P    +T+    ++    STV   V      GN SA + +   E    
Sbjct: 834  VTNGKTYTAT-GPTTLTITDCPCTLTHGGNSTVAPTVATTTPAGNASAPATSAPVETGNS 892

Query: 527  ----------VRTYSCSTLSTANTGPI-TFA*KSVAGSRPAPDRTESSTTSGPPGARASA 381
                      V T + ++++   + P+ T    SVA    AP  T S++ + P  + ASA
Sbjct: 893  TSVAAPTSAPVETGNSTSVAAPTSAPVETGNNTSVAAPTSAPAETNSTSVAAPTESSASA 952

Query: 380  PL-----PSRTASST 351
            P+     PS   SST
Sbjct: 953  PVSSTETPSSAESST 967

>Suva_14.399 Chr14
           (684887..685388,685433..685442,685510..685523,
           685560..686078,686223..686230,686288..687146,
           687251..687519) [2181 bp, 727 aa] {ON} YNR044W (REAL)
          Length = 727

 Score = 34.7 bits (78), Expect = 0.64
 Identities = 31/111 (27%), Positives = 49/111 (44%)
 Frame = -2

Query: 683 VPSGSAYTVTPAPEPRALTNSEIVVSPDITSTVVSDVRGNVSASSRTLAAEEVRTYSCST 504
           VPS S  T +        T S    S   TST  S    + S SS + ++    + S S+
Sbjct: 157 VPSSSVTTSSTNQLNSTSTTSTSSTSTSSTST-SSTSTSSTSTSSTSTSSTSTSSTSTSS 215

Query: 503 LSTANTGPITFA*KSVAGSRPAPDRTESSTTSGPPGARASAPLPSRTASST 351
            ST++T   + +  S + S  +   T +S+TS    + +S    S + SST
Sbjct: 216 TSTSSTSTSSTSTSSTSTSSTSTSSTSTSSTSTSSTSTSSTSTSSTSTSST 266

 Score = 30.8 bits (68), Expect = 10.0
 Identities = 42/209 (20%), Positives = 80/209 (38%)
 Frame = -2

Query: 977 PSAARTLTCSANAYRSRISVLASRKRSTPSRWYLSSLQRCSKFAWNPADSTMKKRIE*PL 798
           PS++ T T S N   S  S  ++   ST S    S+    +  +     ST         
Sbjct: 158 PSSSVT-TSSTNQLNST-STTSTSSTSTSSTSTSSTSTSSTSTSSTSTSSTSTSSTSTSS 215

Query: 797 GKRARYSGNGTACTRPCTNACSAFAGVPRPTE*AHALAVPSGSAYTVTPAPEPRALTNSE 618
              +  S + T+ +   T++ S  +     T  +      + ++ T T +    + + S 
Sbjct: 216 TSTSSTSTSSTSTSSTSTSSTSTSSTSTSSTSTSSTSTSSTSTSSTSTSSTSTSSTSTSS 275

Query: 617 IVVSPDITSTVVSDVRGNVSASSRTLAAEEVRTYSCSTLSTANTGPITFA*KSVAGSRPA 438
              S   TS+  +      S S+ + +     T S ST ST+ +   T +  +   S   
Sbjct: 276 TSTSSTSTSSTSTSSTSTSSTSTSSTSTSSTSTSSTSTSSTSTSSTSTSS--TSTSSTST 333

Query: 437 PDRTESSTTSGPPGARASAPLPSRTASST 351
              + SST++      +SAP    +++S+
Sbjct: 334 SSTSTSSTSTSSTSTSSSAPSTHSSSTSS 362

>Skud_12.423 Chr12 complement(743004..745382) [2379 bp, 792 aa] {ON}
           YLR337C (REAL)
          Length = 792

 Score = 34.7 bits (78), Expect = 0.65
 Identities = 35/120 (29%), Positives = 50/120 (41%), Gaps = 6/120 (5%)
 Frame = -2

Query: 713 RPTE*AHALAVPSGSAYTVTP-APEPRALTNSEIVVSPDITSTVVSD-----VRGNVSAS 552
           RP+  + A  +P+  A  + P AP P  L+N     S    S          +    SAS
Sbjct: 301 RPSIPSTAPPIPTSHAPPLPPIAPPPPLLSNVASASSKKAASAPAPPPPPPPLPDMTSAS 360

Query: 551 SRTLAAEEVRTYSCSTLSTANTGPITFA*KSVAGSRPAPDRTESSTTSGPPGARASAPLP 372
           S ++A+      S ++LS    G    A  S A   PAP  T SS++  P  +  S P P
Sbjct: 361 SHSVASAPAPPASSTSLSNLTFGTFNKAASSPAPPPPAPPPTFSSSSGLPASSVPSPPPP 420

>NDAI0B00230 Chr2 complement(32811..35645) [2835 bp, 944 aa] {ON} 
          Length = 944

 Score = 34.7 bits (78), Expect = 0.66
 Identities = 71/338 (21%), Positives = 130/338 (38%), Gaps = 4/338 (1%)
 Frame = -2

Query: 1355 AGTTPTSMLPSNTSPGACRSTRLSRWPSTHNSLATRSEAPFSMDNVKLSPKFRYTNPGAL 1176
            +  +P S L +N S     S+  S   ST+N   + S +  S+  V  S  +  T+  + 
Sbjct: 255  SNASPLSPLETNVS-----SSTTSIISSTNNIRGSSSLSVSSIAYVSASASYVSTSATSS 309

Query: 1175 NALPRI----VE*PAINNSFSLSRDSSASNANTCSCLRSGSDKGDGTYVSSRCGVFSRAK 1008
            + L R        P+I  S S +  S+ASN  T S   S S        +S       + 
Sbjct: 310  SGLSRSGVSSSGAPSIPASTSYANSSAASNPATSSSATSSSGISSSGVSTSAVSSIPASA 369

Query: 1007 *AYNPANCSEPSAARTLTCSANAYRSRISVLASRKRSTPSRWYLSSLQRCSKFAWNPADS 828
               N +  S    + +   S+    S +S + +      S    SS+   S  + + A S
Sbjct: 370  TYANSSAASSSGVSSSGVSSSGVSTSAVSSIPASASYANSSAASSSVPSSSGVSTSGASS 429

Query: 827  TMKKRIE*PLGKRARYSGNGTACTRPCTNACSAFAGVPRPTE*AHALAVPSGSAYTVTPA 648
                     +   A Y+ +    +   +++  + +GV   T  A +++     AY  +  
Sbjct: 430  ---------IPASASYAESSATSSSGISSSGLSTSGV--VTSGASSVSPSVSGAYNPSSI 478

Query: 647  PEPRALTNSEIVVSPDITSTVVSDVRGNVSASSRTLAAEEVRTYSCSTLSTANTGPITFA 468
            P   A   S    +P +++T  S V  +VS ++ + +         ST   + +G  T  
Sbjct: 479  PVSSASGTS----TPGVSTTGASSVPASVSGANNSSSIPVPSVSRSSTSGVSTSGVSTSG 534

Query: 467  *KSVAGSRPAPDRTESSTTSGPPGARASAPLPSRTASS 354
              SV+    A      S+T  PP +  ++ + S + S+
Sbjct: 535  ASSVSAFVSARQYRPHSST--PPASNFASVIASGSESA 570

>Smik_7.302 Chr7 (508666..512235) [3570 bp, 1189 aa] {ON} YGR014W
           (REAL)
          Length = 1189

 Score = 34.7 bits (78), Expect = 0.68
 Identities = 37/150 (24%), Positives = 66/150 (44%), Gaps = 5/150 (3%)
 Frame = -2

Query: 977 PSAARTLTC---SANAYRSRISVLASRKRSTPSRWYL--SSLQRCSKFAWNPADSTMKKR 813
           P  + T T    S ++++S   V A+   S PS WY   S+ +  + +A+  +D T +++
Sbjct: 52  PQVSSTTTAYYQSGHSHQSATIVTATIS-SLPSTWYSPESTSENSASYAYQQSDYTSEQK 110

Query: 812 IE*PLGKRARYSGNGTACTRPCTNACSAFAGVPRPTE*AHALAVPSGSAYTVTPAPEPRA 633
              P     + S + T+     + A SAF      T    AL   + ++ +     EP A
Sbjct: 111 PWGP-SSNIQQSPSTTSLNAVKSGANSAFTTSDVST--TSALIDTNANSASFITTTEPEA 167

Query: 632 LTNSEIVVSPDITSTVVSDVRGNVSASSRT 543
             ++ +     I ST+      N+ +SSRT
Sbjct: 168 AMSASLTSETPIISTIAMSAGDNMFSSSRT 197

>Suva_3.105 Chr3 complement(150015..153692) [3678 bp, 1225 aa] {ON}
           YCR067C (REAL)
          Length = 1225

 Score = 34.7 bits (78), Expect = 0.68
 Identities = 28/109 (25%), Positives = 48/109 (44%)
 Frame = -2

Query: 677 SGSAYTVTPAPEPRALTNSEIVVSPDITSTVVSDVRGNVSASSRTLAAEEVRTYSCSTLS 498
           S S  T T  P P ++  S    +P  TST  S      +++S T +     T S ST +
Sbjct: 583 STSTPTSTSTPTPTSIPTS--TSTPTSTSTSTSTSTTTSTSTSTTTSTSTSTTTSTSTST 640

Query: 497 TANTGPITFA*KSVAGSRPAPDRTESSTTSGPPGARASAPLPSRTASST 351
           T +T   T    S + +      T +ST++    + +++   S + S+T
Sbjct: 641 TTSTSTSTTTSTSTSTTTSTSTSTTTSTSTSTTTSTSTSTTTSTSTSTT 689

>NCAS0B00350 Chr2 complement(43786..45075) [1290 bp, 429 aa] {ON} 
          Length = 429

 Score = 34.3 bits (77), Expect = 0.73
 Identities = 37/133 (27%), Positives = 61/133 (45%), Gaps = 12/133 (9%)
 Frame = -2

Query: 719 VPRPTE*AHALAVPSGSAYTVTPAPEPRALTN----------SEIVVSPDITSTVVSDVR 570
           VP P+    + A PS S  T + A    + +           S  V S  + S+VVS V+
Sbjct: 92  VPTPSSIITSTAAPSSSILTSSAASSVASSSVVGSSAVSPVVSSSVASSSVASSVVSSVQ 151

Query: 569 GNVSASSRTLA--AEEVRTYSCSTLSTANTGPITFA*KSVAGSRPAPDRTESSTTSGPPG 396
            +V+ASS  ++  A  V +   +T S A++   + A  S A S  A   + SS +S    
Sbjct: 152 SSVAASSSVVSSGASSVESSVAATSSAASSVERSVAATSSAASSIA--SSSSSNSSFVSS 209

Query: 395 ARASAPLPSRTAS 357
           +   +P+ S +A+
Sbjct: 210 SSVVSPIVSSSAN 222

>ZYRO0A12386g Chr1 complement(981181..983412) [2232 bp, 743 aa] {ON}
           weakly similar to uniprot|Q06133 Saccharomyces
           cerevisiae YLR337C VRP1 Involved in cytoskeletal
           organization and cellular growth Proline-rich protein
           verprolin
          Length = 743

 Score = 32.3 bits (72), Expect(2) = 0.83
 Identities = 36/141 (25%), Positives = 51/141 (36%), Gaps = 1/141 (0%)
 Frame = -2

Query: 797 GKRARYSGNGTACTRPCTNACSAFAGVPRPTE*AHALAVPSGSAYTVTPAPEPRALTNSE 618
           G   R SG+ T   +P   +     G P P   A A   PS SA    P P P A ++S 
Sbjct: 168 GSMHRKSGS-TGAPKPPVASAPPVPGAPPPPPAAPAPPAPSMSAPPPPPTPPPVAASSSS 226

Query: 617 IVVSPDITSTVVS-DVRGNVSASSRTLAAEEVRTYSCSTLSTANTGPITFA*KSVAGSRP 441
           +   P            G ++A      A E  +    + + A + P        A   P
Sbjct: 227 LSSPPPAPPMPGGLPFLGEINARRSDRGATEGLSSGDGSSARAPSAP-------PAPPAP 279

Query: 440 APDRTESSTTSGPPGARASAP 378
            P       ++ PP  +ASAP
Sbjct: 280 PPSTAPPLPSAAPPVPQASAP 300

 Score = 20.4 bits (41), Expect(2) = 0.83
 Identities = 14/40 (35%), Positives = 17/40 (42%)
 Frame = -3

Query: 1021 SAGRSRHTTLPTAQSRLLRAP*RVLLMRTDRGSRCLPRGS 902
            S G  R    PTA  ++  AP   +  R  RGS     GS
Sbjct: 137  STGAPRPPVPPTAAPQIPSAPIPSVPTRPQRGSMHRKSGS 176

>YNR044W Chr14 (703699..705876) [2178 bp, 725 aa] {ON}
           AGA1Anchorage subunit of a-agglutinin of a-cells, highly
           O-glycosylated protein with N-terminal secretion signal
           and C-terminal signal for addition of GPI anchor to cell
           wall, linked to adhesion subunit Aga2p via two disulfide
           bonds
          Length = 725

 Score = 34.3 bits (77), Expect = 0.84
 Identities = 40/189 (21%), Positives = 79/189 (41%)
 Frame = -2

Query: 950 SANAYRSRISVLASRKRSTPSRWYLSSLQRCSKFAWNPADSTMKKRIE*PLGKRARYSGN 771
           SA+      S L+S   S P+   LSS         +P+ ++       P       S  
Sbjct: 162 SASIISPVTSTLSSTTSSNPTTTSLSSTST------SPSSTSTS-----PSSTSTSSSST 210

Query: 770 GTACTRPCTNACSAFAGVPRPTE*AHALAVPSGSAYTVTPAPEPRALTNSEIVVSPDITS 591
            T+ +   T++ S       P+  + + ++ S S+ + + +    + ++S    SP  TS
Sbjct: 211 STSSSSTSTSSSSTSTS---PSSTSTSSSLTSTSSSSTSTSQSSTSTSSSSTSTSPSSTS 267

Query: 590 TVVSDVRGNVSASSRTLAAEEVRTYSCSTLSTANTGPITFA*KSVAGSRPAPDRTESSTT 411
           T  S    + S+ S + ++    +YS ST  +  +   T A  S + +  +   T+S+++
Sbjct: 268 TSSSSTSTSPSSKSTSASSTSTSSYSTSTSPSLTSSSPTLASTSPSSTSISSTFTDSTSS 327

Query: 410 SGPPGARAS 384
            G   A +S
Sbjct: 328 LGSSIASSS 336

 Score = 33.5 bits (75), Expect = 1.5
 Identities = 32/120 (26%), Positives = 51/120 (42%), Gaps = 10/120 (8%)
 Frame = -2

Query: 680 PSGSAYTVTPAPEPRALTNSEIVVSPDITSTVVSDVRGNVSASSRTLAAEEVRTYSCSTL 501
           P  S  + T +  P   + S    SP  TST  S    + S++S + ++    + S ST 
Sbjct: 168 PVTSTLSSTTSSNPTTTSLSSTSTSPSSTSTSPSSTSTSSSSTSTSSSSTSTSSSSTSTS 227

Query: 500 --STANTGPITFA*KSVAGSRPAPDRTESSTTSGPPGARA--------SAPLPSRTASST 351
             ST+ +  +T    S   +  +   T SS+TS  P + +        S    S +ASST
Sbjct: 228 PSSTSTSSSLTSTSSSSTSTSQSSTSTSSSSTSTSPSSTSTSSSSTSTSPSSKSTSASST 287

 Score = 30.8 bits (68), Expect = 10.0
 Identities = 36/140 (25%), Positives = 63/140 (45%), Gaps = 1/140 (0%)
 Frame = -2

Query: 767 TACTRPCTN-ACSAFAGVPRPTE*AHALAVPSGSAYTVTPAPEPRALTNSEIVVSPDITS 591
           T  T  C++ AC + + +P  T     L+V S     + P     A+++    +S   T+
Sbjct: 100 TLSTEVCSHEACPSSSTLPTTT-----LSVTSKFTSYICPTCHTTAISS----LSEVGTT 150

Query: 590 TVVSDVRGNVSASSRTLAAEEVRTYSCSTLSTANTGPITFA*KSVAGSRPAPDRTESSTT 411
           TVVS     +  SS ++ +    T S    ST ++ P T +  S + S  +   + SST+
Sbjct: 151 TVVSS--SAIEPSSASIISPVTSTLS----STTSSNPTTTSLSSTSTSPSSTSTSPSSTS 204

Query: 410 SGPPGARASAPLPSRTASST 351
           +       S+   S ++SST
Sbjct: 205 TSSSSTSTSSSSTSTSSSST 224

>Kwal_26.7814 s26 (521381..524359) [2979 bp, 992 aa] {ON} YGR189C
            (CRH1) - Cell wall protein [contig 55] FULL
          Length = 992

 Score = 34.3 bits (77), Expect = 0.88
 Identities = 73/345 (21%), Positives = 134/345 (38%)
 Frame = -2

Query: 1379 TSAFRPKEAGTTPTSMLPSNTSPGACRSTRLSRWPSTHNSLATRSEAPFSMDNVKLSPKF 1200
            TS+  P  + +  TS  PS+++  A  S   S   S  +   + S  PFS      S   
Sbjct: 625  TSSGAPSSSASI-TSSAPSSSTESATSSAVSSSSASVSSGAVSSSSVPFSSSASITSNVP 683

Query: 1199 RYTNPGALNALPRIVE*PAINNSFSLSRDSSASNANTCSCLRSGSDKGDGTYVSSRCGVF 1020
              ++  A ++ P      A +++ S S  S +S A + S + S S       ++S   + 
Sbjct: 684  SSSSESATSSAPSSSTESATSSALSSSSASVSSGAVSSSSVPSSSSAS----ITSSVPIS 739

Query: 1019 SRAK*AYNPANCSEPSAARTLTCSANAYRSRISVLASRKRSTPSRWYLSSLQRCSKFAWN 840
            S A         S PS++ T + +++A  S     AS   S+ S    S     S    +
Sbjct: 740  SSAS-----MTSSAPSSS-TQSATSSAPSSSTESAASSALSSSSASVSSGAASSSNVPSS 793

Query: 839  PADSTMKKRIE*PLGKRARYSGNGTACTRPCTNACSAFAGVPRPTE*AHALAVPSGSAYT 660
             + S +              SG  ++ +   +   S+ A        A + +  + SA +
Sbjct: 794  SSSSVIS-------------SGKSSSTSISSSTVSSSTAP-------ASSNSQSTLSASS 833

Query: 659  VTPAPEPRALTNSEIVVSPDITSTVVSDVRGNVSASSRTLAAEEVRTYSCSTLSTANTGP 480
               +  P +  ++ + VS   TS +VS    +   SS  ++       S +T+ T++   
Sbjct: 834  SVQSSSPSSSLSASVSVSSS-TSEIVSSSASSTQGSSSPVS-------SSTTIMTSSVSS 885

Query: 479  ITFA*KSVAGSRPAPDRTESSTTSGPPGARASAPLPSRTASSTDR 345
             TF+ +    S        S +TS    +++S    S   SST++
Sbjct: 886  STFSSQPSLSSSTITSAQPSGSTSTLASSQSSTLSSSLPGSSTEQ 930

>CAGL0G10175g Chr7 (977483..979216) [1734 bp, 577 aa] {ON} some
           similarities with uniprot|P47179 Saccharomyces
           cerevisiae YJR151c
          Length = 577

 Score = 33.9 bits (76), Expect = 1.1
 Identities = 32/126 (25%), Positives = 58/126 (46%), Gaps = 4/126 (3%)
 Frame = -2

Query: 716 PRPTE*AHALAVPSGSAYTVTPAPEPRALTNSEIVVSPDITSTVV---SDVRGNVSASSR 546
           P P+        PS S    +P+P P + ++S  + S   +S+ +   S    ++ +SS 
Sbjct: 177 PSPSPSPSPSPSPSPSPSPKSPSPSPSSSSSSSSMPSSSSSSSSMPSSSSSSSSMPSSSS 236

Query: 545 TLAAEEVRTYSCSTLSTANTGPITFA*KSVAGSRPAPDRTES-STTSGPPGARASAPLPS 369
           + ++    + S S++ ++++        S+  S  AP  + S  TTS    A AS  LPS
Sbjct: 237 SSSSMPSSSSSSSSMPSSSSSMTPSQKASIIPSSAAPSSSSSIVTTSSISSADASPVLPS 296

Query: 368 RTASST 351
              SS+
Sbjct: 297 SVVSSS 302

 Score = 31.6 bits (70), Expect = 5.5
 Identities = 25/85 (29%), Positives = 39/85 (45%), Gaps = 10/85 (11%)
 Frame = -3

Query: 694 THWQSPAAVRTLS-------RPRPSPEH*QTPRSWCPRTSPAPS---SPTCAGTFLRAHA 545
           T W SP+   + S        P PSP    +P S  P  SP+PS   SP+ + +   + +
Sbjct: 117 TAWPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSSPSPSPSPSPSPSPSPSPSPSPSPSPS 176

Query: 544 RWPQRRSARTRVPHSAPPTQAPSPS 470
             P    + +  P  +P  ++PSPS
Sbjct: 177 PSPSPSPSPSPSPSPSPSPKSPSPS 201

>TBLA0H00500 Chr8 complement(96289..98253) [1965 bp, 654 aa] {ON} 
          Length = 654

 Score = 33.9 bits (76), Expect = 1.1
 Identities = 47/242 (19%), Positives = 92/242 (38%)
 Frame = -2

Query: 1133 SFSLSRDSSASNANTCSCLRSGSDKGDGTYVSSRCGVFSRAK*AYNPANCSEPSAARTLT 954
            S S +  SSA+ +++ +   S +        SS     + +  A + +  S  +A+ +  
Sbjct: 128  SSSAATSSSAATSSSAATSSSAATSSSAATSSSAASSSAASSSAASSSAASSSAASSSAA 187

Query: 953  CSANAYRSRISVLASRKRSTPSRWYLSSLQRCSKFAWNPADSTMKKRIE*PLGKRARYSG 774
             S+ A  S  S  A    S  S   + S    S  A   + +     +E      +    
Sbjct: 188  SSSAASSSAASSSAVESSSAASSSAVESSSAASSSAVESSSAASSSVVESSSAASSSTVE 247

Query: 773  NGTACTRPCTNACSAFAGVPRPTE*AHALAVPSGSAYTVTPAPEPRALTNSEIVVSPDIT 594
            + +A +     + SA +     +    + A  + S+ +V+ +    A + SE       T
Sbjct: 248  SSSAASSSAVESSSAASSSAVESSSVSSAASSAASSASVSIS----AFSESESRNVTTAT 303

Query: 593  STVVSDVRGNVSASSRTLAAEEVRTYSCSTLSTANTGPITFA*KSVAGSRPAPDRTESST 414
            ST  S +   +++    +  E   TY  +  ST+ + P+T          P+ + T + T
Sbjct: 304  STNYSTIEKTITSCEDNVCTEVTSTYVSTPASTSVSAPVT---------TPSSNITTTYT 354

Query: 413  TS 408
            TS
Sbjct: 355  TS 356

>YJL225C Chr10 complement(466..4581,4970..6130) [5277 bp, 1758 aa]
            {ON} Putative protein of unknown function; similarity to
            DNA helicases that are also encoded within subtelomeric
            Y' elements and induced in telomerase deficient survivors
          Length = 1758

 Score = 33.9 bits (76), Expect = 1.2
 Identities = 32/142 (22%), Positives = 62/142 (43%)
 Frame = -2

Query: 776  GNGTACTRPCTNACSAFAGVPRPTE*AHALAVPSGSAYTVTPAPEPRALTNSEIVVSPDI 597
            G+  A T   TNA +  +   R     +A    + +A T        A TN+    + + 
Sbjct: 1123 GSANASTNASTNAITTASTNVRTNATTNASTNATTNASTNAST---NATTNASTNATTNS 1179

Query: 596  TSTVVSDVRGNVSASSRTLAAEEVRTYSCSTLSTANTGPITFA*KSVAGSRPAPDRTESS 417
            ++   +    NV  S+ T A+  VRT + +T ST ++   T    +   +  + + T + 
Sbjct: 1180 STNATTTASTNVRTSATTTASINVRTSATTTESTNSSTNAT----TTESTNSSTNATTTE 1235

Query: 416  TTSGPPGARASAPLPSRTASST 351
            +T+    A  +A +  RT+++T
Sbjct: 1236 STNSNTSATTTASINVRTSATT 1257

>YIL177C Chr9 complement(483..4598,4987..6147) [5277 bp, 1758 aa] {ON}
            Putative protein of unknown function; similarity to DNA
            helicases that are encoded within subtelomeric Y'
            elements and induced in telomerase deficient survivors
          Length = 1758

 Score = 33.9 bits (76), Expect = 1.2
 Identities = 32/142 (22%), Positives = 62/142 (43%)
 Frame = -2

Query: 776  GNGTACTRPCTNACSAFAGVPRPTE*AHALAVPSGSAYTVTPAPEPRALTNSEIVVSPDI 597
            G+  A T   TNA +  +   R     +A    + +A T        A TN+    + + 
Sbjct: 1123 GSANASTNASTNAITTASTNVRTNATTNASTNATTNASTNAST---NATTNASTNATTNS 1179

Query: 596  TSTVVSDVRGNVSASSRTLAAEEVRTYSCSTLSTANTGPITFA*KSVAGSRPAPDRTESS 417
            ++   +    NV  S+ T A+  VRT + +T ST ++   T    +   +  + + T + 
Sbjct: 1180 STNATTTASTNVRTSATTTASINVRTSATTTESTNSSTNAT----TTESTNSSTNATTTE 1235

Query: 416  TTSGPPGARASAPLPSRTASST 351
            +T+    A  +A +  RT+++T
Sbjct: 1236 STNSNTSATTTASINVRTSATT 1257

>Suva_4.214 Chr4 complement(374649..376391) [1743 bp, 581 aa] {ON}
           YDL037C (REAL)
          Length = 581

 Score = 33.5 bits (75), Expect = 1.4
 Identities = 29/83 (34%), Positives = 36/83 (43%)
 Frame = -2

Query: 596 TSTVVSDVRGNVSASSRTLAAEEVRTYSCSTLSTANTGPITFA*KSVAGSRPAPDRTESS 417
           ++T +S      S+S  TL + EV T S  T STA T        S   S   P      
Sbjct: 219 STTTISSTSSTHSSSKYTLQSTEVTTSSDVTTSTALTS-------SAESSTSVPQ----- 266

Query: 416 TTSGPPGARASAPLPSRTASSTD 348
           TTS  P A +S     RTA+S D
Sbjct: 267 TTSTGPNASSSLAAEFRTATSRD 289

>TDEL0G00100 Chr7 complement(9857..12145) [2289 bp, 762 aa] {ON} 
          Length = 762

 Score = 33.5 bits (75), Expect = 1.5
 Identities = 68/273 (24%), Positives = 115/273 (42%), Gaps = 10/273 (3%)
 Frame = -2

Query: 1139 NNSFSLSRDSSASNANTCSCLRSGSDKGDGTYVS---------SRCGVFSRAK*AYN-PA 990
            +++ S S  SS S+ ++ S + + + K   + VS         S   V S +  A + P 
Sbjct: 210  SSTSSTSSTSSTSSTSSTSSVPASTTKEPASSVSILTTSAPSKSTSSVPSASSSATSVPI 269

Query: 989  NCSEPSAARTLTCSANAYRSRISVLASRKRSTPSRWYLSSLQRCSKFAWNPADSTMKKRI 810
            + S PS+    T S++A  S  SV AS  R  P+ W +SS+         P++S      
Sbjct: 270  STSSPSS----TSSSSASSSTTSVPASTTRE-PASW-ISSV---------PSNSASISSA 314

Query: 809  E*PLGKRARYSGNGTACTRPCTNACSAFAGVPRPTE*AHALAVPSGSAYTVTPAPEPRAL 630
                   +   G+ T   +P T++ S  +   R +      A  S S+ +   AP     
Sbjct: 315  HSSASSSSSVPGSTTKTLQP-TSSKSLVSSNSRSS------AASSTSSSSTLSAPSS--- 364

Query: 629  TNSEIVVSPDITSTVVSDVRGNVSASSRTLAAEEVRTYSCSTLSTANTGPITFA*KSVAG 450
            + S    +P  +ST       +V AS+    A  +   S +  S+A++ P + A  S   
Sbjct: 365  STSSAPSNPASSSTT------SVPASTTKQPASWI---SSAPSSSASSTPSSSASSSTTS 415

Query: 449  SRPAPDRTESSTTSGPPGARASAPLPSRTASST 351
               +  +  +S TS PP + AS+   S  +SST
Sbjct: 416  VPASTTKQPASWTSSPPSSSASSAPSSSASSST 448

>YBL113C Chr2 complement(280..2658) [2379 bp, 792 aa] {ON}
           Helicase-like protein encoded within the telomeric Y'
           element
          Length = 792

 Score = 33.5 bits (75), Expect = 1.5
 Identities = 28/112 (25%), Positives = 50/112 (44%), Gaps = 1/112 (0%)
 Frame = -2

Query: 677 SGSAYTVTPAPEPRALTNSEIVVSPDITSTVVSDVRGNVSASSRTLAAEEVRTYSCSTLS 498
           + S    T      + TN+    S ++ ++  +    N S ++ T A+  VRT + +T S
Sbjct: 126 TNSNTNATTTESTNSSTNATTTASINVRTSATTTESTNSSTNATTTASINVRTSATTTES 185

Query: 497 T-ANTGPITFA*KSVAGSRPAPDRTESSTTSGPPGARASAPLPSRTASSTDR 345
           T ++T   T A  +V  S    + T S+T +       S+   + TAS+  R
Sbjct: 186 TNSSTNATTTASINVRTSATTTESTNSNTNASTNATTNSSTNATTTASTNVR 237

 Score = 33.1 bits (74), Expect = 1.9
 Identities = 27/98 (27%), Positives = 45/98 (45%), Gaps = 4/98 (4%)
 Frame = -2

Query: 629 TNSEIVVSPDITSTVVSDVRGNVSASSRTLAAEEVRTYSCSTLST-ANTGPITFA*KSVA 453
           TN+    S ++ ++  ++   N S ++ T A+  VRT + +T ST   T   T A  +V 
Sbjct: 226 TNATTTASTNVRTSATTNATTNSSTNATTTASTNVRTSATTTASTNVRTSATTTASINVR 285

Query: 452 GSRPAPDRTESS---TTSGPPGARASAPLPSRTASSTD 348
            S    +   SS   TT+    +  SA     T S+T+
Sbjct: 286 TSATTTESINSSTNATTTESTNSNTSATTTESTDSNTN 323

>Suva_11.245 Chr11 (447844..448170,448213..448225,448256..448926)
           [1011 bp, 336 aa] {ON} YKR013W (REAL)
          Length = 336

 Score = 33.1 bits (74), Expect = 1.5
 Identities = 34/114 (29%), Positives = 48/114 (42%), Gaps = 4/114 (3%)
 Frame = -2

Query: 680 PSGSAY---TVTPAPEPRALTNSEI-VVSPDITSTVVSDVRGNVSASSRTLAAEEVRTYS 513
           P+G+A    T T +P P  + N ++  V+P  T    + V  +VSA  +  AA+      
Sbjct: 61  PAGAATATATATASP-PIVVDNVQVDSVAPSATQDGTAVVESSVSAQIQVQAAQ------ 113

Query: 512 CSTLSTANTGPITFA*KSVAGSRPAPDRTESSTTSGPPGARASAPLPSRTASST 351
                 A   PIT A  S   S      T S+TTS  P     +   S T S+T
Sbjct: 114 -----AAAVTPITTATPSTTTSATPSTTTPSTTTSATPSTTTPSTTTSATPSTT 162

>Kpol_1028.20 s1028 complement(53777..57205) [3429 bp, 1142 aa] {ON}
            complement(53777..57205) [3429 nt, 1143 aa]
          Length = 1142

 Score = 33.5 bits (75), Expect = 1.5
 Identities = 60/306 (19%), Positives = 128/306 (41%), Gaps = 14/306 (4%)
 Frame = -2

Query: 1349 TTPTSMLPSNTSPGA--CRSTRLSRWPSTHNSLAT--RSEAPFSMDNVKLSPKFRYTNPG 1182
            T  T+++ S TS  +    S+ LS   +T N + T   +  P + ++V  S      +  
Sbjct: 656  TKTTNIVSSKTSEASNSVASSFLSTLTTTSNGVITIYTTWCPLTSNSVVKSTSS--VHKA 713

Query: 1181 ALNALPRIVE*PAINNSFSLS-----RDSSASNANTCSCLRSGSDKGDGTYVSSRCGVFS 1017
            ++++   IV+   ++ +  ++     R    S +NT +   S + K   +  S+   V +
Sbjct: 714  SIDSKSSIVKPTTVSTTGPITGSNWIRTVQVSTSNTSTT--SSTSKSSTSITSTTSRVTT 771

Query: 1016 RAK*AYNPANCSEPSAARTLTCSANAYRSRISVLASRK--RSTPSRWYLSSLQRCSKFA- 846
             +  + + +  S  S + T + S+ +  S  S+ +S     ST S    SS    S  + 
Sbjct: 772  TSSISKSSSTTSTSSTSLTSSTSSTSLTSSTSLTSSTSLTSSTSSTSLTSSTSLTSSTSS 831

Query: 845  WNPADSTMKKRIE*PLGKRARYSGNGTACTRPCTNACSAFAGVPRPTE*AHALAVPSGSA 666
             +   ST            +  S   +  +   T++ S+ + +   T         S ++
Sbjct: 832  TSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSTSSISSTT-------TTSKTS 884

Query: 665  YTVTPAPEPRALTNSEIVVSPDITSTVVS-DVRGNVSASSRTLAAEEVRT-YSCSTLSTA 492
            Y  T A  PR  + S   +  ++TS++ S  +  +++ ++  +++    T Y  ST+ T 
Sbjct: 885  YIPTTATTPRTSSTSTKNIRSNVTSSITSLQISTSITTNAEQVSSSTTPTSYVMSTVFTT 944

Query: 491  NTGPIT 474
            + G +T
Sbjct: 945  SNGVVT 950

>Suva_10.428 Chr10 (751935..753077) [1143 bp, 380 aa] {ON} YLR332W
           (REAL)
          Length = 380

 Score = 33.1 bits (74), Expect = 1.6
 Identities = 26/109 (23%), Positives = 54/109 (49%)
 Frame = -2

Query: 677 SGSAYTVTPAPEPRALTNSEIVVSPDITSTVVSDVRGNVSASSRTLAAEEVRTYSCSTLS 498
           S SA + + +    AL++S  + S  + S+ VS    + S+S ++  +    + S +++S
Sbjct: 37  SASAVSSSHSSSKSALSSSSTLSSSSLISSAVSSSLSSSSSSKKSSTSHSSLSTSVASVS 96

Query: 497 TANTGPITFA*KSVAGSRPAPDRTESSTTSGPPGARASAPLPSRTASST 351
             +    +    S + S  A   ++SS++S    + +SAP  +  +SST
Sbjct: 97  FTSFS-FSSTSSSDSSSSEASSTSDSSSSSASSASTSSAPSSTSDSSST 144

>Suva_6.1 Chr6 complement(1..453) [453 bp, 151 aa] {ON}  (NOVEL)
          Length = 151

 Score = 32.0 bits (71), Expect = 1.8
 Identities = 28/97 (28%), Positives = 43/97 (44%), Gaps = 5/97 (5%)
 Frame = -2

Query: 626 NSEIVVSPDITSTVVSDVRGNVSASSRTLAAEEVRTYSCSTLSTANTGPITFA*KSVAGS 447
           +++ +V+   T T     +   S+ S             ST+   +T   T A  + A S
Sbjct: 10  SNQTIVTTSSTFTTSGTTKPYTSSGSPIPLTSVATDTGLSTVDARDTSASTSAGFTTASS 69

Query: 446 RPAPDR-TESSTTSGPPGARASAPLPS----RTASST 351
            P+ D  T SST+S   GAR+S+ + S     T SST
Sbjct: 70  TPSVDSITGSSTSSSQTGARSSSTINSIDQKNTVSST 106

>Suva_15.60 Chr15 complement(93081..94727) [1647 bp, 548 aa] {ON}
           YOL105C (REAL)
          Length = 548

 Score = 33.1 bits (74), Expect = 1.8
 Identities = 32/98 (32%), Positives = 49/98 (50%), Gaps = 5/98 (5%)
 Frame = -2

Query: 629 TNSEIVVSPDITSTVVSDVRGNVSA-SSRTLAAEEVRTYSCSTLSTANTG-PITFA*KSV 456
           T +    S  I++T  S  +G  S   S +  A+   TYS +T ST  +  PIT    + 
Sbjct: 145 TEAASTTSYTISTTHSSTSKGTSSTIESSSSNAKSSTTYSQTTSSTTTSSTPIT----TT 200

Query: 455 AGSRPAPDRTESSTTSGPPGA---RASAPLPSRTASST 351
           + S   P  T S+++S PP A    +SAPL + + SS+
Sbjct: 201 STSSSVPTTTTSTSSSIPPTASSTSSSAPLTTSSTSSS 238

>AFR473W Chr6 (1290077..1290517,1290567..1292726) [2601 bp, 866 aa]
           {ON} NOHBY644; No homolog in Saccharomyces cerevisiae;
           1-intron
          Length = 866

 Score = 33.1 bits (74), Expect = 2.0
 Identities = 30/101 (29%), Positives = 38/101 (37%)
 Frame = -2

Query: 671 SAYTVTPAPEPRALTNSEIVVSPDITSTVVSDVRGNVSASSRTLAAEEVRTYSCSTLSTA 492
           S  T   A       +S  V +P  TS  +S    + S  S   A   V   S +T ST+
Sbjct: 176 SVPTTAEAASSSTQASSSAVSTPTTTSAAMSSTEASSSTVSAPTAGTSVAPSSSTTSSTS 235

Query: 491 NTGPITFA*KSVAGSRPAPDRTESSTTSGPPGARASAPLPS 369
                T +  S   S     +    T S  PGA  SAP PS
Sbjct: 236 GAAASTAS--STTSSTTV--KPTVGTISQEPGATGSAPGPS 272

>ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR102W
           (KIC1)
          Length = 947

 Score = 33.1 bits (74), Expect = 2.0
 Identities = 38/138 (27%), Positives = 52/138 (37%), Gaps = 25/138 (18%)
 Frame = -2

Query: 692 ALAVPSGSAYTVTPAP---EPRALTNSEIVVS-----PDITSTVVSDVRGNVSASSRTLA 537
           A A P G+   V P     +PR+ T S    S     P +        R   S  +++L 
Sbjct: 554 ATAAPIGATAGVDPMTLKNKPRSATVSSSASSGLQRRPTLGGNPAVAARSEASGLNKSLG 613

Query: 536 AEEVRTYSCSTLSTANTGPITFA*KSVAGSRP----------------APDRTESSTTSG 405
           AE  RT + +     N      A   ++ SR                  PDR+ SST S 
Sbjct: 614 AELTRTVTLNAHIPPNGPSQGTAGAGLSSSRSNDRSPSPSRSGVASNLTPDRSTSSTASS 673

Query: 404 -PPGARASAPLPSRTASS 354
            PPGA A   LP  +A +
Sbjct: 674 EPPGAAAQGMLPLSSAKT 691

>KLTH0E08844g Chr5 (804120..808682) [4563 bp, 1520 aa] {ON} some
            similarities with uniprot|P32334 Saccharomyces cerevisiae
            YGR014W MSB2 Mucin family member at the head of the
            Cdc42p- and MAP kinase-dependent filamentous growth
            signaling pathway also functions as an osmosensor in
            parallel to the Sho1p-mediated pathway potential Cdc28p
            substrate
          Length = 1520

 Score = 33.1 bits (74), Expect = 2.1
 Identities = 49/247 (19%), Positives = 96/247 (38%), Gaps = 7/247 (2%)
 Frame = -2

Query: 1073 SGSDKGDGTYVSSRCGVFSRAK*AYNPANCSEPSAARTLTCSANAYRSRISVLASRKRST 894
            SGSD G  T  S    + +  +   + +  S   AA   T SA AY +   + +    ST
Sbjct: 37   SGSDSGSATATSVSAALSTSPQATPSSSPVSSSIAAARSTSSAPAYSANSPLSSDNAPST 96

Query: 893  -PSRWYLSSLQRCSKFAWNPADSTMKKRIE*PLGKRARYSGNGTACTRPCTNACSAFAGV 717
             P+     +    S  +++P+D+ +   I       A+++ + ++   P +         
Sbjct: 97   RPTTQLEDTTSHHSHSSYSPSDTQLTSYI-----TSAQWTTSESSSLDPVSPTSE----- 146

Query: 716  PRPTE*AHALAVPSGSAYTVTPAPEPRALTNSEIVVSPDITSTVVSDVRGNVSASSRTLA 537
             R T  A   +    S  T + + +  +LT++ +  +   T  + +    N  + S   +
Sbjct: 147  -RVTSTAAQSSAEQSSELTSSSSSDHPSLTSAWVAGTTSETPKIETHSSSNTVSQSSHTS 205

Query: 536  AEEVRTYSCSTLSTANTGPI------TFA*KSVAGSRPAPDRTESSTTSGPPGARASAPL 375
                 T + +T +T++T          FA  S      + D   S+   G     A+A  
Sbjct: 206  LTSTSTSNDATKTTSSTEGFFSSVAQAFAESSQQSETTSSDAKTSNQNEGTTSQSATAIS 265

Query: 374  PSRTASS 354
             S++A+S
Sbjct: 266  QSQSATS 272

>KLLA0E01035g Chr5 (109821..115457) [5637 bp, 1878 aa] {ON} some
            similarities with uniprot|P08640 Saccharomyces cerevisiae
            YIR019C MUC1 GPI-anchored cell surface glycoprotein
            required for diploid pseudohyphal formation and haploid
            invasive growth transcriptionally regulated by the MAPK
            pathway (via Ste12p and Tec1p) and the cAMP pathway (via
            Flo8p)
          Length = 1878

 Score = 33.1 bits (74), Expect = 2.1
 Identities = 33/105 (31%), Positives = 49/105 (46%), Gaps = 6/105 (5%)
 Frame = -2

Query: 647  PEPRALTNSEIVVSPDITSTVVSDVRGNVSASSRTLAAEEVRTYSCSTLSTANTGPITFA 468
            PE R  T S    S ++TST  S V   ++ASS T+   E RT + S+    +TG  T  
Sbjct: 1350 PEERTSTES----SSEVTSTGSSTV---LTASSTTILEPEERTSTESSSEVTSTGSSTVI 1402

Query: 467  *KSVAGSRPAPDR------TESSTTSGPPGARASAPLPSRTASST 351
              S        +R      TE+++T  P  A  S+ + S  +S+T
Sbjct: 1403 IASSTTILEPEERTSTESSTEATSTESPIEATKSSDIISTQSSNT 1447

 Score = 31.2 bits (69), Expect = 8.3
 Identities = 33/113 (29%), Positives = 47/113 (41%)
 Frame = -2

Query: 692  ALAVPSGSAYTVTPAPEPRALTNSEIVVSPDITSTVVSDVRGNVSASSRTLAAEEVRTYS 513
            A +  S ++ T T  P+ +  T S    S ++TST  S V   ++ SS T+   E RT +
Sbjct: 1304 ATSTESFTSSTTTADPQEQTSTES----SSEVTSTGSSTV---ITVSSTTILEPEERTST 1356

Query: 512  CSTLSTANTGPITFA*KSVAGSRPAPDRTESSTTSGPPGARASAPLPSRTASS 354
             S+    +TG  T               T SSTT   P  R S    S   S+
Sbjct: 1357 ESSSEVTSTGSSTVL-------------TASSTTILEPEERTSTESSSEVTST 1396

>ZYRO0G05104g Chr7 complement(410797..412200) [1404 bp, 467 aa] {ON}
            some similarities with uniprot|P38844 Saccharomyces
            cerevisiae YHR143W
          Length = 467

 Score = 32.7 bits (73), Expect = 2.3
 Identities = 62/278 (22%), Positives = 116/278 (41%), Gaps = 9/278 (3%)
 Frame = -2

Query: 1355 AGTTPTSMLPSNTSPGACRSTRLSRWPSTH--NSLATRSEAPFSMDNVKLSPKFRYTNPG 1182
            + +TP+S  PS+++P +  ST  S  PS++  +S +  + AP S      S  +  ++  
Sbjct: 159  SSSTPSSSTPSSSTPSS--STPSSSTPSSNSPSSSSPSTSAPSSSSPSSSSQVYSTSSSD 216

Query: 1181 ALNALPRIVE*PAINNSFSLSRDSSASNANTCSCLRSGSDKGDGTYVSSRCGVFSRAK*A 1002
            + ++  R    P+   S + +   SASN+++ S          G+ +SS   V S +  +
Sbjct: 217  SQSSNSRFTLQPSSTYSITSNTAVSASNSDSTS-----GSTNSGSSLSSSSSVPSGSANS 271

Query: 1001 YNPANCSE--PSAARTLTCSANAYRSRISVLASRKRSTPSRWYLSSLQRCSKFAWNPADS 828
             N  + S   PS +     S ++  S  S  A+   S  S   +SS    S         
Sbjct: 272  DNSLSSSPSVPSGSANSGSSLSSSSSAPSGSANSDNSLSSSSSVSSSGSAS--------- 322

Query: 827  TMKKRIE*PLGKRARYSGNGTACTRPCTNACSAFAGVPRPTE*AHALAVPSGSAYTVTPA 648
                    P+   +  S + TA +    ++ ++ +G       +   + PS SA ++   
Sbjct: 323  --------PISVSSSGSSSVTAISSTSPSSLASGSG-------SSVYSSPSASASSIPST 367

Query: 647  PEPRALTNSEIVVSPD-----ITSTVVSDVRGNVSASS 549
                + ++S I  SP       TS+  S + G+ S+SS
Sbjct: 368  ----SFSSSSITASPSSSGSFSTSSSSSTISGSSSSSS 401

 Score = 31.6 bits (70), Expect = 5.2
 Identities = 34/142 (23%), Positives = 62/142 (43%)
 Frame = -2

Query: 779 SGNGTACTRPCTNACSAFAGVPRPTE*AHALAVPSGSAYTVTPAPEPRALTNSEIVVSPD 600
           S +  + + P +N+ S+ +    P+  A + + PS S+   + +      +NS   + P 
Sbjct: 174 SSSTPSSSTPSSNSPSSSS----PSTSAPSSSSPSSSSQVYSTSSSDSQSSNSRFTLQPS 229

Query: 599 ITSTVVSDVRGNVSASSRTLAAEEVRTYSCSTLSTANTGPITFA*KSVAGSRPAPDRTES 420
            T ++ S+    VSAS+           S ST  + N+G    +  SV       D + S
Sbjct: 230 STYSITSNTA--VSASN-----------SDSTSGSTNSGSSLSSSSSVPSGSANSDNSLS 276

Query: 419 STTSGPPGARASAPLPSRTASS 354
           S+ S P G+  S    S ++S+
Sbjct: 277 SSPSVPSGSANSGSSLSSSSSA 298

>Kwal_55.19510 s55 complement(4111..4932) [822 bp, 274 aa] {ON}
           YOR008C (SLG1) - involved in cell wall integrity and
           stress response [contig 159] PARTIAL
          Length = 274

 Score = 32.3 bits (72), Expect = 2.4
 Identities = 24/93 (25%), Positives = 42/93 (45%)
 Frame = -2

Query: 629 TNSEIVVSPDITSTVVSDVRGNVSASSRTLAAEEVRTYSCSTLSTANTGPITFA*KSVAG 450
           TNSE+  S  ITS+ +     + ++S+  L A    T    ++S+  TG  + +  S + 
Sbjct: 70  TNSEVSTSASITSSGLPVTTVSSASSTHNLPASSELTSESISISSTTTGSGSGSELSSST 129

Query: 449 SRPAPDRTESSTTSGPPGARASAPLPSRTASST 351
              +P  + S + S      AS  +P    S+T
Sbjct: 130 VTSSPTASSSGSGSDSGSGSASGSMPGSGISTT 162

>Smik_13.534 Chr13 (890162..893422) [3261 bp, 1086 aa] {ON} YMR317W
           (REAL)
          Length = 1086

 Score = 32.7 bits (73), Expect = 2.7
 Identities = 31/120 (25%), Positives = 53/120 (44%), Gaps = 5/120 (4%)
 Frame = -2

Query: 692 ALAVPSGSAYTVTPAPEPRALTNSEIV---VSPDITSTVVSDVRGNVSASSRTLAAEEVR 522
           AL   + S  +  P  E   LT S +    VS  ITS+ +S+   N+SA+S T +  +  
Sbjct: 232 ALTSSTSSTASSLPTSEASILTPSSVYTSEVSSHITSSTLSESLPNISAASSTTSTLKTS 291

Query: 521 TYSCSTLSTANTGPITFA*KSVAGSRPAPDRT--ESSTTSGPPGARASAPLPSRTASSTD 348
             + +T S+  T   +   +  A S P    T  E+S ++       + P  + T  ++D
Sbjct: 292 DAAPATSSSITTVASSVNYRLTASSAPFVRNTTIENSLSTSSSTIACTRPPATSTLQTSD 351

 Score = 31.6 bits (70), Expect = 6.1
 Identities = 34/142 (23%), Positives = 61/142 (42%), Gaps = 1/142 (0%)
 Frame = -2

Query: 779 SGNGTACTRPCTNACSAFAGVPRPTE*AHALAVPSGS-AYTVTPAPEPRALTNSEIVVSP 603
           S +  ACTRP   +        + ++ A A++    + A ++T    P ++  SE   S 
Sbjct: 332 SSSTIACTRPPATSTL------QTSDTASAISSSVNTVASSITSTSTPSSVYTSE--ASS 383

Query: 602 DITSTVVSDVRGNVSASSRTLAAEEVRTYSCSTLSTANTGPITFA*KSVAGSRPAPDRTE 423
            ITS+ +S+   N+SA S T    E    + +T S+  T   +   +  A S P    T 
Sbjct: 384 HITSSTLSESLPNISAVSSTTLTLETSDAAPATSSSITTVASSVNYRLTASSAPFVRNTT 443

Query: 422 SSTTSGPPGARASAPLPSRTAS 357
              +     +  ++  PS T++
Sbjct: 444 IENSLSTSSSTIASTRPSATST 465

>Kwal_22.2754 s22 complement(3903..5135) [1233 bp, 411 aa] {ON}
           YHR211W (FLO5) - Flocculin, similar to flocculation
           protein Flo1p [contig 440] PARTIAL
          Length = 411

 Score = 32.3 bits (72), Expect = 2.9
 Identities = 24/93 (25%), Positives = 42/93 (45%)
 Frame = -2

Query: 629 TNSEIVVSPDITSTVVSDVRGNVSASSRTLAAEEVRTYSCSTLSTANTGPITFA*KSVAG 450
           TNSE+  S  ITS+ +     + ++S+  L A    T    ++S+  TG  + +  S + 
Sbjct: 70  TNSEVSTSASITSSGLPVTTVSSASSTHNLPASSELTSESISISSTTTGSGSGSELSSST 129

Query: 449 SRPAPDRTESSTTSGPPGARASAPLPSRTASST 351
              +P  + S + S      AS  +P    S+T
Sbjct: 130 VTSSPTASSSGSGSDSGSGSASGSMPGSGISTT 162

>Kwal_44.16506 s44 (3436..4890) [1455 bp, 484 aa] {ON} YAR050W
           (FLO1) - FLO1 putative cell wall glycoprotein [contig
           442] FULL
          Length = 484

 Score = 32.3 bits (72), Expect = 3.0
 Identities = 24/93 (25%), Positives = 42/93 (45%)
 Frame = -2

Query: 629 TNSEIVVSPDITSTVVSDVRGNVSASSRTLAAEEVRTYSCSTLSTANTGPITFA*KSVAG 450
           TNSE+  S  ITS+ +     + ++S+  L A    T    ++S+  TG  + +  S + 
Sbjct: 70  TNSEVSTSASITSSGLPVTTVSSASSTHNLPASSELTSESISISSTTTGSGSGSELSSST 129

Query: 449 SRPAPDRTESSTTSGPPGARASAPLPSRTASST 351
              +P  + S + S      AS  +P    S+T
Sbjct: 130 VTSSPTASSSGSGSDSGSGSASGSMPGSGISTT 162

>Kpol_1058.6 s1058 complement(30414..32117) [1704 bp, 567 aa] {ON}
           complement(30414..32117) [1704 nt, 568 aa]
          Length = 567

 Score = 32.3 bits (72), Expect = 3.2
 Identities = 29/101 (28%), Positives = 42/101 (41%), Gaps = 12/101 (11%)
 Frame = -2

Query: 773 NGTACTRPCTNACSAFAGVPRPTE*AHALA----VPSGSAYTVTPAPEPRA-------LT 627
           N    T   T  CS+      PT   H +     V SG  + V P    +        LT
Sbjct: 415 NDVCSTVTVTEPCSSETVTHAPTTTTHVIPGTTIVTSGKTFVVPPTTLTKVVSSASTPLT 474

Query: 626 NSEIVVSPDITSTVVSDVRGNVSAS-SRTLAAEEVRTYSCS 507
            ++ V S   T T ++ +    + S S TLA EEV+++S S
Sbjct: 475 TTKHVTSAATTKTQLTSLETEQNKSHSTTLATEEVKSHSTS 515

>TBLA0G01290 Chr7 complement(344622..346769) [2148 bp, 715 aa] {ON}
           Anc_4.168 YLR337C
          Length = 715

 Score = 28.5 bits (62), Expect(2) = 3.7
 Identities = 25/79 (31%), Positives = 29/79 (36%), Gaps = 10/79 (12%)
 Frame = -3

Query: 679 PAAVRTLSRPRPSPEH*QTPRSWCPRTSPA--------PSSPTCAGTFLRAHARWPQRRS 524
           P A  +L    PS  H        P  +PA        PS P  A        + P    
Sbjct: 459 PHAAPSLPHAAPSLPHAAPAAPSLPHAAPAAPSLPHAAPSLPHAAPAGPLLPTKAPPLPG 518

Query: 523 ARTRVPHSAP--PTQAPSP 473
           A   VPHSAP  P  AP+P
Sbjct: 519 AAPSVPHSAPSIPHTAPTP 537

 Score = 21.9 bits (45), Expect(2) = 3.7
 Identities = 10/27 (37%), Positives = 13/27 (48%)
 Frame = -2

Query: 449 SRPAPDRTESSTTSGPPGARASAPLPS 369
           S P P       ++ PP   A+ PLPS
Sbjct: 565 SPPLPSAAPPLPSAAPPLPSAAPPLPS 591

>YIL123W Chr9 (128151..129581) [1431 bp, 476 aa] {ON}  SIM1Protein
           of the SUN family (Sim1p, Uth1p, Nca3p, Sun4p) that may
           participate in DNA replication, promoter contains SCB
           regulation box at -300 bp indicating that expression may
           be cell cycle-regulated
          Length = 476

 Score = 32.0 bits (71), Expect = 4.0
 Identities = 30/127 (23%), Positives = 54/127 (42%), Gaps = 17/127 (13%)
 Frame = -2

Query: 683 VPSGSAYTVTPAPEPRALTNSEIVVSPDI----TSTVVSDVRGNVSASSRTLAAEE---- 528
           V     +TVTPA    A   +  +++  +    +S   +D   +++ SS  LA  E    
Sbjct: 47  VVDSDGHTVTPAASEVATAATSAIITTSVLAPTSSAAAADSSASIAVSSAALAKNEKISD 106

Query: 527 -------VRTYSCSTLSTANTGPITFA*KSVAGS--RPAPDRTESSTTSGPPGARASAPL 375
                    +   S+ S++++   T    SV+ S    AP  T  ST+S    + +SA  
Sbjct: 107 AAASATASTSQGASSSSSSSSATSTLESSSVSSSSEEAAPTSTVVSTSSATQSSASSATK 166

Query: 374 PSRTASS 354
            S +++S
Sbjct: 167 SSTSSTS 173

>Skud_12.313 Chr12 (559031..560467) [1437 bp, 478 aa] {ON} YLR238W
            (REAL)
          Length = 478

 Score = 32.0 bits (71), Expect = 4.0
 Identities = 27/105 (25%), Positives = 41/105 (39%), Gaps = 5/105 (4%)
 Frame = -2

Query: 1331 LPSNTSPGACRSTRLSRWPSTHNSLATRSEAPFSMDNVKLSPKFRYTNPGALNAL----- 1167
            +P NT P    +    R    H+   T S   F   N+  +P+ +YT    L +L     
Sbjct: 27   IPENTKPINGSNNSSKRPVEKHDKRITDSSKNFLPHNISRTPRRKYTYILVLTSLNGTFE 86

Query: 1166 PRIVE*PAINNSFSLSRDSSASNANTCSCLRSGSDKGDGTYVSSR 1032
             + +  P   +   L R  + SN N+ S LR G      T+   R
Sbjct: 87   SKHIVIPFKPDGLKLGRPVANSNNNSSSSLRGGKRLDSHTFSQVR 131

>YOR009W Chr15 (344335..345798) [1464 bp, 487 aa] {ON}  TIR4Cell wall
            mannoprotein of the Srp1p/Tip1p family of
            serine-alanine-rich proteins; expressed under anaerobic
            conditions and required for anaerobic growth;
            transcription is also induced by cold shock
          Length = 487

 Score = 32.0 bits (71), Expect = 4.0
 Identities = 36/162 (22%), Positives = 67/162 (41%)
 Frame = -2

Query: 1379 TSAFRPKEAGTTPTSMLPSNTSPGACRSTRLSRWPSTHNSLATRSEAPFSMDNVKLSPKF 1200
            +S+  P  +    +S+ PS++   +      S   S+ + +A+ S AP S + V  S   
Sbjct: 209  SSSVAPSSSEVVSSSVAPSSSEVVS------SSVASSSSEVASSSVAPSSSEVVSSSVAS 262

Query: 1199 RYTNPGALNALPRIVE*PAINNSFSLSRDSSASNANTCSCLRSGSDKGDGTYVSSRCGVF 1020
              +   + +A   +    A+++S      SS S+++  S   + S     + VSS  G  
Sbjct: 263  STSEATSSSA---VTSSSAVSSSTESVSSSSVSSSSAVSSSEAVSSSPVSSVVSSSAGPA 319

Query: 1019 SRAK*AYNPANCSEPSAARTLTCSANAYRSRISVLASRKRST 894
            S +   YN    S  S A+T   +   Y S  +   +   S+
Sbjct: 320  SSSVAPYNSTIASSSSTAQTSISTIAPYNSTTTTTPASSASS 361

>KLTH0B02860g Chr2 (223097..225583) [2487 bp, 828 aa] {ON} some
           similarities with uniprot|P20840 Saccharomyces
           cerevisiae YJR004C SAG1 Alpha-agglutinin of alpha-cells
           binds to Aga1p during agglutination N-terminal half is
           homologous to the immunoglobulin superfamily and
           contains binding site for a-agglutinin C-terminal half
           is highly glycosylated and contains GPI anchor
          Length = 828

 Score = 32.0 bits (71), Expect = 4.5
 Identities = 32/115 (27%), Positives = 51/115 (44%), Gaps = 2/115 (1%)
 Frame = -2

Query: 689 LAVPSGSAYT--VTPAPEPRALTNSEIVVSPDITSTVVSDVRGNVSASSRTLAAEEVRTY 516
           L  PS S+    VT +P   + + SE       +ST  S+     SASS + +     + 
Sbjct: 428 LISPSTSSIVSIVTSSPSESSTSPSESSTPSSASSTSPSESSTPSSASSTSSSVSSTPSS 487

Query: 515 SCSTLSTANTGPITFA*KSVAGSRPAPDRTESSTTSGPPGARASAPLPSRTASST 351
             ST S+ ++ P + +  S + S  +P  + +ST       R SAP  +   SST
Sbjct: 488 VSSTPSSVSSTPSSESSTSPSESSTSPSESTTSTPITTFANRTSAPPSTGHYSST 542

>SAKL0F03410g Chr6 (272918..273889) [972 bp, 323 aa] {ON} no
           similarity
          Length = 323

 Score = 31.6 bits (70), Expect = 4.6
 Identities = 28/104 (26%), Positives = 50/104 (48%)
 Frame = -2

Query: 665 YTVTPAPEPRALTNSEIVVSPDITSTVVSDVRGNVSASSRTLAAEEVRTYSCSTLSTANT 486
           YT   +PE  A  +S    S    ++V SD   + SA+S ++A+      S +++++A+ 
Sbjct: 37  YTTKYSPEELASLSSASAAS----ASVASDSAASASAASASVAS-VASVASVASVASASA 91

Query: 485 GPITFA*KSVAGSRPAPDRTESSTTSGPPGARASAPLPSRTASS 354
              + A  S A +  A   +E+S  S    +  SA   S++ SS
Sbjct: 92  ASASAASASAASASAASANSEASVASRMSASSVSAVAASQSLSS 135

>Kwal_23.6441 s23 (1584397..1587708) [3312 bp, 1104 aa] {ON} YNL283C
            (WSC2) - Putative integral membrane protein containing
            novel cysteine motif. Similarity to SLG1 (WSC1), WSC3 and
            WSC4 [contig 393] PARTIAL
          Length = 1104

 Score = 32.0 bits (71), Expect = 4.6
 Identities = 64/276 (23%), Positives = 106/276 (38%), Gaps = 15/276 (5%)
 Frame = -2

Query: 1133 SFSLSRDSSASNANTCSCLRSGSDKGDGTYVSSRCGV---FSRAK*AYNPANCSEPSAAR 963
            S S S  +S S+A + S   SGS    G+   S  G    FS    +   ++ S  S + 
Sbjct: 448  STSGSTTTSTSSATSSSSSISGSTTHSGSKTRSSSGTSSGFSTTSGSSTNSDSSTTSDSS 507

Query: 962  T-LTCSANAYRSRISVLASR-KRSTPSRWYLSSLQRCSKFAWNPADSTMKKRIE*PLGKR 789
            T LT   ++  S IS  ++    ST S    +S    +  +   +DS+         G  
Sbjct: 508  TALTSGTHSGSSTISGSSTTLTASTTSTSSTTSTSSTTSDSSTTSDSSTALTSGTHSGS- 566

Query: 788  ARYSGNGTACTRPC--TNACSAFAGVPRPTE*AHALAVPSGSAYTVTPAPEPRALTNSEI 615
            +  SG+ T  T     T++ ++ +            +  SGS     P     + TNS  
Sbjct: 567  STISGSSTTLTASTISTSSTTSTSSTTSDASTTSTSSTHSGSTTNSGPTTTSGSTTNSGS 626

Query: 614  VVSPD--------ITSTVVSDVRGNVSASSRTLAAEEVRTYSCSTLSTANTGPITFA*KS 459
              + D         TST  +    + +++S T      R+ S +TL ++     T + K+
Sbjct: 627  STTSDSSTISGSSTTSTSSTTSDSSTTSTSSTHLGSSTRSGSSTTLGSSGQTTETRSSKA 686

Query: 458  VAGSRPAPDRTESSTTSGPPGARASAPLPSRTASST 351
            +  S  +     SST+S      AS+       SST
Sbjct: 687  IVSSGTSYSNEISSTSSSTKTDLASSSTRVEVPSST 722

>Ecym_7349 Chr7 complement(722484..725873) [3390 bp, 1129 aa] {ON}
           similar to Ashbya gossypii AGR019C
          Length = 1129

 Score = 32.0 bits (71), Expect = 4.6
 Identities = 27/111 (24%), Positives = 57/111 (51%)
 Frame = -2

Query: 683 VPSGSAYTVTPAPEPRALTNSEIVVSPDITSTVVSDVRGNVSASSRTLAAEEVRTYSCST 504
           + S S Y+  P  +  +L+ S  + +  +++T  + V  + S+SS + ++    +   ST
Sbjct: 388 IVSSSTYSANPISD--SLSTSSGIPTGTLSTTPQTLVSSSSSSSSSSSSSPSPLSPPSST 445

Query: 503 LSTANTGPITFA*KSVAGSRPAPDRTESSTTSGPPGARASAPLPSRTASST 351
            ST++    + +  S + S P+P    SST+S    + +S+   S ++SS+
Sbjct: 446 SSTSSDSSSSSS-SSSSSSSPSPLSPPSSTSSDSSSSSSSSSSSSSSSSSS 495

>KLTH0H09834g Chr8 complement(846452..847540) [1089 bp, 362 aa] {ON}
           some similarities with uniprot|P47032 Saccharomyces
           cerevisiae YJL079C PRY1 Protein of unknown function, has
           similarity to Pry2p and Pry3p and to the plant PR-1
           class of pathogen related proteins
          Length = 362

 Score = 31.6 bits (70), Expect = 4.8
 Identities = 32/121 (26%), Positives = 50/121 (41%), Gaps = 7/121 (5%)
 Frame = -2

Query: 692 ALAVPSGSAYTVTPAPEPRALTNSEIVVSPDIT-STVVSDVRGNVSASSRTLAAEEVRTY 516
           A + P  SA + + AP   A+      VS   + S+  +      SA + T AAE     
Sbjct: 90  ASSAPVSSAESTSSAPLVTAVAQKAAAVSETASESSEAATSSAASSADAGTSAAETSVAA 149

Query: 515 SCSTLSTANTGPITFA*KSVAGSRPAPDRTESSTTSGPPGARA------SAPLPSRTASS 354
           S S+ +   T  +    +S   S  +P +T +S       A A      S+P  + +ASS
Sbjct: 150 STSSSAAPETTTVAATSESSTSSTSSPAKTSTSAAETSSSAAAETSISTSSPAATSSASS 209

Query: 353 T 351
           T
Sbjct: 210 T 210

>Ecym_5668 Chr5 (1358134..1359360) [1227 bp, 408 aa] {ON} similar to
           Ashbya gossypii AGL354C
          Length = 408

 Score = 31.6 bits (70), Expect = 5.0
 Identities = 32/115 (27%), Positives = 46/115 (40%), Gaps = 2/115 (1%)
 Frame = -2

Query: 734 SAFAGVPRPTE*AHALAVPSGSAYTVTPAPEPRALTNSEIVVSPD--ITSTVVSDVRGNV 561
           + +AGVP         A PS      +PAPE      +E VVSP     S     V GNV
Sbjct: 48  TVWAGVPP--------AAPSPPDAGASPAPENNEAPKAEKVVSPSPLAASDFGVGVGGNV 99

Query: 560 SASSRTLAAEEVRTYSCSTLSTANTGPITFA*KSVAGSRPAPDRTESSTTSGPPG 396
            AS  + ++    + S S   + +  P            P+P  + S ++S P G
Sbjct: 100 DASPESPSSSPSSSPSPSPSPSPSPSP-----SPSPSPSPSPSPSPSPSSSSPAG 149

>KLLA0B09746g Chr2 (850402..851775) [1374 bp, 457 aa] {ON} similar
           to uniprot|P38288 Saccharomyces cerevisiae YBR162C TOS1
           Target of SBF
          Length = 457

 Score = 31.6 bits (70), Expect = 5.2
 Identities = 24/106 (22%), Positives = 45/106 (42%)
 Frame = -2

Query: 662 TVTPAPEPRALTNSEIVVSPDITSTVVSDVRGNVSASSRTLAAEEVRTYSCSTLSTANTG 483
           TV+ A +         V   ++TST+V D  GN   +  T           +T+ T  + 
Sbjct: 115 TVSTAKKHHEHKREAAVQWVEVTSTIVVDGDGNPIETDATSGGSATEVTDGTTILTPVSS 174

Query: 482 PITFA*KSVAGSRPAPDRTESSTTSGPPGARASAPLPSRTASSTDR 345
           P+T +  S   S  +      S++S    + +S+   S ++S+ +R
Sbjct: 175 PVTSSPASAVSSSSSSASGSGSSSSTSSSSSSSSGSSSESSSAWNR 220

>Agos_YGOB_Anc_6.91 Chr7 complement(1287909..1288673) [765 bp, 254
           aa] {ON} ANNOTATED BY YGOB - Search-DOGS annotation
          Length = 254

 Score = 31.2 bits (69), Expect = 5.4
 Identities = 15/30 (50%), Positives = 21/30 (70%), Gaps = 1/30 (3%)
 Frame = -3

Query: 559 LRAH-ARWPQRRSARTRVPHSAPPTQAPSP 473
           LRA  +R P+ RSAR R P  +PP+++P P
Sbjct: 68  LRAQESRVPRERSARDRSPRRSPPSRSPPP 97

>Skud_8.16 Chr8 (36776..37860,37891..38563) [1758 bp, 585 aa] {ON}
           YHL028W (REAL)
          Length = 585

 Score = 31.6 bits (70), Expect = 5.5
 Identities = 27/104 (25%), Positives = 46/104 (44%), Gaps = 9/104 (8%)
 Frame = -2

Query: 635 ALTNSEIVVSPDITSTVVSDVRGNVSASSRTLAAEEVRTYSCSTLSTANTGPITFA*KSV 456
           ++ + E   +P  +S  +S    + ++SS T A+  + T   ++LS   T P+  +    
Sbjct: 117 SIQSVETSTAPSTSSASISTASSSAASSSIT-ASSTLTTLDTTSLSATTTAPVPTS-TGA 174

Query: 455 AGSRPAPDRTESST---------TSGPPGARASAPLPSRTASST 351
           + S   P  T SST         TS      +S   P+ T+SST
Sbjct: 175 SSSISTPTSTTSSTSTPASTTSLTSTSTSTISSTSTPTSTSSST 218

>Kpol_206.1 s206 (199..1971) [1773 bp, 590 aa] {ON} (199..1971)
           [1773 nt, 591 aa]
          Length = 590

 Score = 31.6 bits (70), Expect = 5.5
 Identities = 25/107 (23%), Positives = 43/107 (40%)
 Frame = -2

Query: 683 VPSGSAYTVTPAPEPRALTNSEIVVSPDITSTVVSDVRGNVSASSRTLAAEEVRTYSCST 504
           V S +  T    P P +  NSE   S D  S V S      + ++ T    + +T S S 
Sbjct: 180 VDSTTESTTNSEPVPESTANSESESSIDSESIVESATESITTETTVTKTKSKTKTKSASA 239

Query: 503 LSTANTGPITFA*KSVAGSRPAPDRTESSTTSGPPGARASAPLPSRT 363
            ++ +    +    S + S      T +ST++  P + ++   P  T
Sbjct: 240 SASTSASSSSI---SASSSASTSTSTSTSTSTSTPTSTSTLTKPEET 283

>NDAI0K02870 Chr11 complement(648772..650760) [1989 bp, 662 aa] {ON}
           Anc_6.48 YLR260W
          Length = 662

 Score = 31.6 bits (70), Expect = 5.7
 Identities = 21/104 (20%), Positives = 47/104 (45%), Gaps = 7/104 (6%)
 Frame = +1

Query: 415 VLDSVRSGAGREPATDFYAKVMGPVLAVLSVEHEYVRTSSAASVRELAETFPRTSETTVL 594
           +L  +    G+  A+  + K   P+L+  + + E + T+ ++   ++A++   +    + 
Sbjct: 263 ILIIINPHGGKGKASKLFNKWSKPILSTSNCKFEIINTTYSSHATDIAKSLDISKYDIIA 322

Query: 595 VMSGDTTISEFVNAL-------GSGAGVTVYALPLGTANAWAHS 705
             SGD    E +N L        +   +T+  +P G+ NA + S
Sbjct: 323 CASGDGIPYEVINGLYQRPDRVDAFNKLTITQIPCGSGNAMSIS 366

>KLTH0B06556g Chr2 (528699..529601) [903 bp, 300 aa] {ON} some
           similarities with uniprot|P38844 Saccharomyces
           cerevisiae YHR143W DSE2 daughter-specific expression
           protein 2
          Length = 300

 Score = 31.2 bits (69), Expect = 5.9
 Identities = 32/113 (28%), Positives = 55/113 (48%), Gaps = 1/113 (0%)
 Frame = -2

Query: 686 AVPSGSAYTVTPAPEPRALT-NSEIVVSPDITSTVVSDVRGNVSASSRTLAAEEVRTYSC 510
           A  + S +++  +  P + +  S  V S D++S+V S      SASS + ++    + S 
Sbjct: 137 AASASSTFSLISSSIPASSSPRSTFVSSTDVSSSVSSATYSASSASSSSSSSAIASSTSS 196

Query: 509 STLSTANTGPITFA*KSVAGSRPAPDRTESSTTSGPPGARASAPLPSRTASST 351
           +  ST+NT  I+    S A +  A   ++SS+T        S+P  +  ASST
Sbjct: 197 AFSSTSNTPGIS---SSSASATSASSASKSSST-----ITKSSPSVTSIASST 241

>Skud_9.200 Chr9 complement(360408..361313) [906 bp, 301 aa] {ON}
           YIR019C (REAL)
          Length = 301

 Score = 31.2 bits (69), Expect = 5.9
 Identities = 28/116 (24%), Positives = 52/116 (44%), Gaps = 2/116 (1%)
 Frame = -2

Query: 755 RPCTNAC--SAFAGVPRPTE*AHALAVPSGSAYTVTPAPEPRALTNSEIVVSPDITSTVV 582
           + C+N C  S+ +  P PT           S+   + AP P + T S    +P  ++T  
Sbjct: 199 KDCSNNCGGSSSSSAPAPT-----------SSTESSSAPAPTSSTESSSAPAPTSSTTES 247

Query: 581 SDVRGNVSASSRTLAAEEVRTYSCSTLSTANTGPITFA*KSVAGSRPAPDRTESST 414
           S      SA + T ++E     + ++ + +++ P   +  + + S PAP  + SST
Sbjct: 248 S------SAPAPTSSSESSSAPAPTSSTESSSAPAPTSSTTESSSAPAPTSSSSST 297

>Kwal_56.24705 s56 (1113032..1113637) [606 bp, 201 aa] {ON} [contig
           160] PARTIAL
          Length = 201

 Score = 30.8 bits (68), Expect = 6.0
 Identities = 21/57 (36%), Positives = 30/57 (52%), Gaps = 2/57 (3%)
 Frame = -2

Query: 992 ANCSEPSAARTLTCSANAYRSRISVLASRKRSTPSRWYLS--SLQRCSKFAWNPADS 828
           A+ S  S   +++  A A+ SR   L+++K S  S   +S  SLQRCS F     DS
Sbjct: 135 AHSSFSSVGSSISHPAAAFSSRFPSLSTQKSSVFSNSRISNASLQRCSSFGQGSTDS 191

>Skud_11.185 Chr11 (336442..337533) [1092 bp, 363 aa] {ON} YKL043W
           (REAL)
          Length = 363

 Score = 31.2 bits (69), Expect = 6.4
 Identities = 21/67 (31%), Positives = 31/67 (46%)
 Frame = +1

Query: 607 DTTISEFVNALGSGAGVTVYALPLGTANAWAHSVGLGTPAKALQAFVQGRVHAVPFPLYR 786
           D T+  F N L     + +  +   T NA+A+   L T     ++    R +AVPFP Y 
Sbjct: 29  DNTLPSF-NELSHQNTINLPFIQRKTPNAYANVAQLATSPTPAKSGYYCRYYAVPFPAYP 87

Query: 787 ARFPSGY 807
            + PS Y
Sbjct: 88  QQPPSPY 94

>KAFR0J01110 Chr10 complement(203049..204341) [1293 bp, 430 aa] {ON}
            Anc_2.256 YNL053W
          Length = 430

 Score = 31.2 bits (69), Expect = 6.8
 Identities = 45/201 (22%), Positives = 76/201 (37%), Gaps = 36/201 (17%)
 Frame = -2

Query: 1334 MLPSNTSPGAC-RSTRLSRWPSTHNSLAT--------RSEAPFSMDNVKLSPKFRYTNPG 1182
            ML S  SP    R   +SR P T +   T        RS    ++    ++  F  T   
Sbjct: 1    MLESIASPSTTERIINVSRSPKTLHKRNTKNLSLSIDRSNISEAIPETSMNCTFNGTEKA 60

Query: 1181 ALNALPRIVE*PAINNSFSLS-----RDSSASNANTCSCLRSGSDKGDGT-YVSSRCGVF 1020
             LNA PR++     N+S+++S      D   +     + + + + KGD + Y  S     
Sbjct: 61   CLNAAPRVIG-TMQNDSYNISSCNNINDQDTNEKTDAAPVLAPNKKGDASIYTLSAASKS 119

Query: 1019 SRAK*AYNPANCSEP---------------------SAARTLTCSANAYRSRISVLASRK 903
            + A   Y    C+E                      S  R+ T +A + ++  S L+S +
Sbjct: 120  TSASPIYASFKCNESGKLNRNHSMSLSIKTKNLRTHSRNRSQTITAASLKAHTSALSSNE 179

Query: 902  RSTPSRWYLSSLQRCSKFAWN 840
            ++T    +  S QR +    N
Sbjct: 180  KATTVWVFPESEQRLNNSLTN 200

>Smik_7.309 Chr7 (520619..522262) [1644 bp, 547 aa] {ON} YGR023W
           (REAL)
          Length = 547

 Score = 31.2 bits (69), Expect = 7.2
 Identities = 20/87 (22%), Positives = 43/87 (49%)
 Frame = -2

Query: 677 SGSAYTVTPAPEPRALTNSEIVVSPDITSTVVSDVRGNVSASSRTLAAEEVRTYSCSTLS 498
           + S+Y  +P+P     ++S  + SP  +S+  S    + S+SS + ++    + S S+ S
Sbjct: 202 TSSSYLPSPSPSTSTSSSSSYLPSPSSSSSSSSSSSSSSSSSSSSSSSSSSSSPSSSSSS 261

Query: 497 TANTGPITFA*KSVAGSRPAPDRTESS 417
            + +   +F+    + S P+   + SS
Sbjct: 262 YSTSSSSSFSSAQSSSSYPSSSISSSS 288

>CAGL0L04554g Chr12 complement(526735..528417) [1683 bp, 560 aa]
           {ON} similar to uniprot|Q12246 Saccharomyces cerevisiae
           YOR171c LCB4
          Length = 560

 Score = 31.2 bits (69), Expect = 7.2
 Identities = 24/104 (23%), Positives = 40/104 (38%), Gaps = 7/104 (6%)
 Frame = +1

Query: 415 VLDSVRSGAGREPATDFYAKVMGPVLAVLSVEHEYVRTSSAASVRELAETFPRTSETTVL 594
           +L  +    G+  A   + K + P+L       E + T  +    ++A         T+ 
Sbjct: 170 ILVIINPHGGKGKAMHIFKKRIEPILIASECSFELMETKYSRHATDIAREIDLEEFDTIA 229

Query: 595 VMSGDTTISEFVNAL-------GSGAGVTVYALPLGTANAWAHS 705
             SGD    E +N L        +   +TV  LP G+ NA + S
Sbjct: 230 CASGDGVPYEVINGLYMREDKVDAFNKITVTQLPCGSGNAMSIS 273

>Ecym_3138 Chr3 complement(255001..256767) [1767 bp, 588 aa] {ON}
           similar to Ashbya gossypii AGR256W
          Length = 588

 Score = 31.2 bits (69), Expect = 7.3
 Identities = 32/120 (26%), Positives = 44/120 (36%), Gaps = 8/120 (6%)
 Frame = +1

Query: 415 VLDSVRSGAGREPATDFYAKVMGPVLAVLSVEHEYVRTSSAASVRELAETFPRTSETTVL 594
           +L  +    GR  A   Y     P+L       E  +TS      E+A T        + 
Sbjct: 203 ILVIINPHGGRGRANKIYVTKAKPILIASGCYVEVFQTSYPEHAIEIARTMDIDKYDVIA 262

Query: 595 VMSGDTTISEFVNAL-------GSGAGVTVYALPLGTANAWAHSV-GLGTPAKALQAFVQ 750
             SGD    E +N L        +   V V  LP G+ NA + S  G   PA A  + V+
Sbjct: 263 CASGDGIPYEVLNGLYRREDRAKAFNKVAVTQLPCGSGNAMSVSCHGTNNPAYAALSLVK 322

>YHL028W Chr8 (48763..50580) [1818 bp, 605 aa] {ON}  WSC4ER membrane
           protein involved in the translocation of soluble
           secretory proteins and insertion of membrane proteins
           into the ER membrane; may also have a role in the stress
           response but has only partial functional overlap with
           WSC1-3
          Length = 605

 Score = 31.2 bits (69), Expect = 7.3
 Identities = 30/155 (19%), Positives = 55/155 (35%)
 Frame = -2

Query: 710 PTE*AHALAVPSGSAYTVTPAPEPRALTNSEIVVSPDITSTVVSDVRGNVSASSRTLAAE 531
           P   A     PS    +  P      L+ S    +   TST  S      +  S T +  
Sbjct: 161 PLTTASTSTTPSTDITSALPTTTSTKLSTSIPTSTTSSTSTTTSTSSSTSTTVSVTSSTS 220

Query: 530 EVRTYSCSTLSTANTGPITFA*KSVAGSRPAPDRTESSTTSGPPGARASAPLPSRTASST 351
              + + STL + +T   + +  +   S P    T SST++       ++P  S   +S+
Sbjct: 221 TTTSTTSSTLISTSTSSSSSSTPTTTSSAPISTSTTSSTST---STSTTSPTSSSAPTSS 277

Query: 350 DRXXXXXXXXXXXXXXXXLQNNSVSFMSPAATPVS 246
                               + +V++ S  A+P++
Sbjct: 278 SNTTPTSTTFTTTSPSTAPSSTTVTYTSTTASPIT 312

>Suva_6.151 Chr6 (260998..261861) [864 bp, 287 aa] {ON} YJL079C
           (REAL)
          Length = 287

 Score = 30.8 bits (68), Expect = 7.6
 Identities = 34/138 (24%), Positives = 57/138 (41%), Gaps = 2/138 (1%)
 Frame = -2

Query: 758 TRPCTNACSAFAGVPRPTE*AHALAVPS--GSAYTVTPAPEPRALTNSEIVVSPDITSTV 585
           T    +   A   V   TE AHA AV +  G  Y           T +    +   TST 
Sbjct: 10  TSALASTALAAPAVVTVTEHAHAAAVVTVQGVVYIENGQTRTTYETLAAATATAKPTSTA 69

Query: 584 VSDVRGNVSASSRTLAAEEVRTYSCSTLSTANTGPITFA*KSVAGSRPAPDRTESSTTSG 405
            + V   ++ASS + A+  V     S +     G  T +  ++  S  +P +  S++TS 
Sbjct: 70  TALVAPPIAASSVSSASNTV-----SAVLAQVKGKSTSSTTTLTPSTSSPSQAASTSTSA 124

Query: 404 PPGARASAPLPSRTASST 351
           P    +++   + T++ST
Sbjct: 125 PATTTSTSQAAATTSAST 142

>Smik_4.315 Chr4 (567448..568395) [948 bp, 315 aa] {ON} YDR077W (REAL)
          Length = 315

 Score = 30.8 bits (68), Expect = 8.0
 Identities = 28/102 (27%), Positives = 40/102 (39%), Gaps = 1/102 (0%)
 Frame = -2

Query: 1382 GTSAFRPKEAGTTPTSMLPSNTSPGACRSTRLSRWPSTH-NSLATRSEAPFSMDNVKLSP 1206
            GTS   P EA   PT+ LP+N +     +   +  P+T   +  T SEAP  +    +SP
Sbjct: 57   GTSTAAPTEA---PTTALPTNGTSTEAPTEAPTEAPTTALPTNGTSSEAPTELPTSFISP 113

Query: 1205 KFRYTNPGALNALPRIVE*PAINNSFSLSRDSSASNANTCSC 1080
                  P   +  P     P  N S   + D +     T  C
Sbjct: 114  NSTTAFPPTTSLPPSNTTIPPYNPSTEYTTDYTVVTEYTTYC 155

>NCAS0E02550 Chr5 (506706..511037) [4332 bp, 1443 aa] {ON} Anc_7.401
            YBL079W
          Length = 1443

 Score = 31.2 bits (69), Expect = 8.2
 Identities = 23/87 (26%), Positives = 46/87 (52%), Gaps = 1/87 (1%)
 Frame = -2

Query: 1319 TSPGACRSTRL-SRWPSTHNSLATRSEAPFSMDNVKLSPKFRYTNPGALNALPRIVE*PA 1143
            +S GA  +T    + PS+ +SL   S + F++D+V LSP+F     G    + R+     
Sbjct: 691  SSTGATTTTITPQKSPSSSSSLKPLSSSNFNLDDVILSPRFY----GITLLVARLFRDIW 746

Query: 1142 INNSFSLSRDSSASNANTCSCLRSGSD 1062
             +N F+L++  +  +++T +  +  +D
Sbjct: 747  ASNVFTLNQHVTVDSSSTTNLTKGSTD 773

>Smik_9.46 Chr9 (106005..107447) [1443 bp, 480 aa] {ON} YIL123W
           (REAL)
          Length = 480

 Score = 30.8 bits (68), Expect = 9.2
 Identities = 25/92 (27%), Positives = 43/92 (46%)
 Frame = -2

Query: 680 PSGSAYTVTPAPEPRALTNSEIVVSPDITSTVVSDVRGNVSASSRTLAAEEVRTYSCSTL 501
           P G++ +   +    +  +S        TSTV S      S++S + A +     S +T 
Sbjct: 120 PQGTSSSSATSALESSSASSSSAEKNSKTSTVASTSSATQSSASSSSATQSSAISSSATQ 179

Query: 500 STANTGPITFA*KSVAGSRPAPDRTESSTTSG 405
           S+A++   + A  S +GS+P    T SS+ SG
Sbjct: 180 SSASSSAKSSASSSSSGSQP----TSSSSASG 207

>Skud_4.739 Chr4 (1306825..1308369) [1545 bp, 514 aa] {ON} YDR463W
           (REAL)
          Length = 514

 Score = 30.8 bits (68), Expect = 9.3
 Identities = 23/78 (29%), Positives = 33/78 (42%), Gaps = 5/78 (6%)
 Frame = -2

Query: 596 TSTVVSDVRGNVSASSRTLAAEEVRTYSCSTLSTANTGPITFA*KSVAGSRP-----APD 432
           ++ +   + G  S    ++ A ++ T    TLS  N        KS+ GSRP     AP 
Sbjct: 69  SNNIDRSLNGGCSVIPCSMDASDLNTPISMTLSPENRVKCEVNFKSLLGSRPEQDIGAPM 128

Query: 431 RTESSTTSGPPGARASAP 378
           +  SS TS P     S P
Sbjct: 129 KMSSSVTSSPLSPSGSTP 146

>KAFR0A04890 Chr1 (966960..968711) [1752 bp, 583 aa] {ON} Anc_6.80
           YLR286C
          Length = 583

 Score = 30.8 bits (68), Expect = 9.6
 Identities = 25/83 (30%), Positives = 42/83 (50%), Gaps = 5/83 (6%)
 Frame = -2

Query: 635 ALTNSEIVVSPDITSTVVSDVRGNVSASSRTLAAEEVRTYSCSTLSTANT----GPITFA 468
           ++ +S ++VSP  TSTV+S           T+A+ E+   S S+ S++++     P+T A
Sbjct: 331 SIASSSLIVSPTATSTVLS-----------TIASSEIIPSSISSSSSSSSPTILSPVTSA 379

Query: 467 *KS-VAGSRPAPDRTESSTTSGP 402
             S V  S  + + T   TT  P
Sbjct: 380 YSSDVTSSTSSVETTNLQTTLDP 402

>NDAI0G02620 Chr7 (599890..601662) [1773 bp, 590 aa] {ON}  YGL258W-A
          Length = 590

 Score = 30.8 bits (68), Expect = 9.6
 Identities = 24/98 (24%), Positives = 45/98 (45%), Gaps = 3/98 (3%)
 Frame = -2

Query: 629 TNSEIVVSPDITSTVVSDVRGNVSASSRTLAAEEVRTYSCST---LSTANTGPITFA*KS 459
           T +E+ +S   TS+  S      SAS+ +  +    +YS ST    S++ +     +   
Sbjct: 467 TTTEVTLSTSATSSPESSASSVTSASTLSSDSSAASSYSRSTSTLRSSSRSSSFVSSNNR 526

Query: 458 VAGSRPAPDRTESSTTSGPPGARASAPLPSRTASSTDR 345
              S  +  R+ SS++S    + +S+   +   SST+R
Sbjct: 527 ATASTSSSIRSSSSSSSSSSSSSSSSSSSTGITSSTNR 564

>CAGL0J11176g Chr10 (1088473..1090362) [1890 bp, 629 aa] {ON} some
            similarities with uniprot|P53882 Saccharomyces cerevisiae
            YNL176c
          Length = 629

 Score = 30.8 bits (68), Expect = 9.7
 Identities = 25/95 (26%), Positives = 42/95 (44%)
 Frame = -2

Query: 1139 NNSFSLSRDSSASNANTCSCLRSGSDKGDGTYVSSRCGVFSRAK*AYNPANCSEPSAART 960
            ++S  LS ++S S+    S   S S +   TY +     FS +   Y P      S++  
Sbjct: 274  SSSVLLSPNNSESSIKVSSASSSSSRRKASTYTTPSRIPFSNSSEWYTPLPTPSISSSTN 333

Query: 959  LTCSANAYRSRISVLASRKRSTPSRWYLSSLQRCS 855
             T S  +  + I + +S   S+ S++Y SS    S
Sbjct: 334  DTSSLLSELALIGISSSSSSSSSSQFYTSSTSSSS 368

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 113,849,323
Number of extensions: 2346795
Number of successful extensions: 9841
Number of sequences better than 10.0: 126
Number of HSP's gapped: 9530
Number of HSP's successfully gapped: 175
Length of query: 466
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 353
Effective length of database: 40,524,141
Effective search space: 14305021773
Effective search space used: 14305021773
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 35 (18.1 bits)