Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AFR287W5.703ON61161131300.0
SAKL0E14938g5.703ON57453812161e-160
KLTH0E01034g5.703ON58358111241e-146
Kwal_55.196915.703ON46644410191e-132
KLLA0A00572g5.703ON5776079941e-127
YIL150C (MCM10)5.703ON5716029761e-124
TDEL0B021705.703ON5675899671e-123
Suva_9.385.703ON5695959671e-123
NCAS0G002205.703ON5925339511e-120
NDAI0F002805.703ON6106119521e-120
Smik_9.195.703ON5726009451e-120
Skud_9.185.703ON5715929421e-119
TPHA0E002105.703ON5444609361e-119
Kpol_1043.715.703ON5855119321e-117
CAGL0H06589g5.703ON5836139211e-116
ZYRO0G06578g5.703ON5695919121e-115
KAFR0D022105.703ON5845988971e-112
TBLA0G010205.703ON5946038521e-105
KNAG0L021505.703ON6164728511e-105
Kwal_47.175604.120ON43571810.28
KLTH0E08118g4.120ON62471790.60
SAKL0B10736g7.51ON1650109780.92
SAKL0H22352g4.120ON62270751.9
KLLA0F23243g7.51ON165364742.7
ADR374C7.51ON1640109724.4
KAFR0J02470na 1ON38740714.4
KLTH0D01628g7.51ON1654109724.6
Skud_15.5067.51ON166564724.6
Suva_8.3917.51ON166564724.6
YOR341W (RPA190)7.51ON166464724.7
Smik_15.5197.51ON166564725.2
Kwal_26.69797.51ON165464708.2
TDEL0H040007.51ON166564708.3
KAFR0K005407.51ON166264708.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR287W
         (611 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR287W Chr6 (956955..958790) [1836 bp, 611 aa] {ON} Syntenic ho...  1210   0.0  
SAKL0E14938g Chr5 (1242645..1242714,1242780..1244434) [1725 bp, ...   473   e-160
KLTH0E01034g Chr5 complement(97462..99128,99197..99281) [1752 bp...   437   e-146
Kwal_55.19691 s55 complement(80960..82360) [1401 bp, 466 aa] {ON...   397   e-132
KLLA0A00572g Chr1 complement(51265..52910,52994..53081) [1734 bp...   387   e-127
YIL150C Chr9 complement(61013..62728) [1716 bp, 571 aa] {ON}  MC...   380   e-124
TDEL0B02170 Chr2 complement(385955..387658) [1704 bp, 567 aa] {O...   377   e-123
Suva_9.38 Chr9 complement(55663..57372) [1710 bp, 569 aa] {ON} Y...   377   e-123
NCAS0G00220 Chr7 complement(31595..33373) [1779 bp, 592 aa] {ON}...   370   e-120
NDAI0F00280 Chr6 complement(58035..59867) [1833 bp, 610 aa] {ON}...   371   e-120
Smik_9.19 Chr9 complement(38635..40353) [1719 bp, 572 aa] {ON} Y...   368   e-120
Skud_9.18 Chr9 complement(38082..39797) [1716 bp, 571 aa] {ON} Y...   367   e-119
TPHA0E00210 Chr5 complement(26313..27947) [1635 bp, 544 aa] {ON}...   365   e-119
Kpol_1043.71 s1043 (151546..153303) [1758 bp, 585 aa] {ON} (1515...   363   e-117
CAGL0H06589g Chr8 (649740..651491) [1752 bp, 583 aa] {ON} simila...   359   e-116
ZYRO0G06578g Chr7 complement(519877..521586) [1710 bp, 569 aa] {...   355   e-115
KAFR0D02210 Chr4 complement(441977..443731) [1755 bp, 584 aa] {O...   350   e-112
TBLA0G01020 Chr7 (256107..257891) [1785 bp, 594 aa] {ON} Anc_5.7...   332   e-105
KNAG0L02150 Chr12 (386276..388126) [1851 bp, 616 aa] {ON} Anc_5....   332   e-105
Kwal_47.17560 s47 (455755..457059) [1305 bp, 435 aa] {ON} YAR007...    36   0.28 
KLTH0E08118g Chr5 (745621..747495) [1875 bp, 624 aa] {ON} simila...    35   0.60 
SAKL0B10736g Chr2 (925889..930841) [4953 bp, 1650 aa] {ON} highl...    35   0.92 
SAKL0H22352g Chr8 (1945309..1947177) [1869 bp, 622 aa] {ON} high...    33   1.9  
KLLA0F23243g Chr6 (2165407..2170368) [4962 bp, 1653 aa] {ON} hig...    33   2.7  
ADR374C Chr4 complement(1372609..1377531) [4923 bp, 1640 aa] {ON...    32   4.4  
KAFR0J02470 Chr10 (471934..473097) [1164 bp, 387 aa] {ON}              32   4.4  
KLTH0D01628g Chr4 complement(157597..162561) [4965 bp, 1654 aa] ...    32   4.6  
Skud_15.506 Chr15 (901437..906434) [4998 bp, 1665 aa] {ON} YOR34...    32   4.6  
Suva_8.391 Chr8 (702691..707688) [4998 bp, 1665 aa] {ON} YOR341W...    32   4.6  
YOR341W Chr15 (960987..965981) [4995 bp, 1664 aa] {ON}  RPA190RN...    32   4.7  
Smik_15.519 Chr15 (910592..915589) [4998 bp, 1665 aa] {ON} YOR34...    32   5.2  
Kwal_26.6979 s26 complement(150350..155314) [4965 bp, 1654 aa] {...    32   8.2  
TDEL0H04000 Chr8 (680730..685727) [4998 bp, 1665 aa] {ON} Anc_7....    32   8.3  
KAFR0K00540 Chr11 complement(114196..119184) [4989 bp, 1662 aa] ...    32   8.7  

>AFR287W Chr6 (956955..958790) [1836 bp, 611 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL150C (MCM10)
          Length = 611

 Score = 1210 bits (3130), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 584/611 (95%), Positives = 584/611 (95%)

Query: 1   MLSTTLNDPREIVPTSNYDILSDEEDMIEEGMNNMGFGLREDGTITNTKYSTVKLRLKQI 60
           MLSTTLNDPREIVPTSNYDILSDEEDMIEEGMNNMGFGLREDGTITNTKYSTVKLRLKQI
Sbjct: 1   MLSTTLNDPREIVPTSNYDILSDEEDMIEEGMNNMGFGLREDGTITNTKYSTVKLRLKQI 60

Query: 61  ESERSDLLARLEELKHRSXXXXXXSPTVEVPRSPTKAKCVEDEPAPSTSASTTYVXXXXX 120
           ESERSDLLARLEELKHRS      SPTVEVPRSPTKAKCVEDEPAPSTSASTTYV     
Sbjct: 61  ESERSDLLARLEELKHRSKKKAKKSPTVEVPRSPTKAKCVEDEPAPSTSASTTYVEEPEE 120

Query: 121 XXXXRYLLSANTPTTSYFAEKFARARDSSASTMRRKQELLKRRVYTFSDRDTAIEYTTFA 180
               RYLLSANTPTTSYFAEKFARARDSSASTMRRKQELLKRRVYTFSDRDTAIEYTTFA
Sbjct: 121 NENERYLLSANTPTTSYFAEKFARARDSSASTMRRKQELLKRRVYTFSDRDTAIEYTTFA 180

Query: 181 VDEVETYSNMRINKRYVPEEDLKRILHDIKVLRLPKLFAKVRPPKFSEPDYANWVTLGAI 240
           VDEVETYSNMRINKRYVPEEDLKRILHDIKVLRLPKLFAKVRPPKFSEPDYANWVTLGAI
Sbjct: 181 VDEVETYSNMRINKRYVPEEDLKRILHDIKVLRLPKLFAKVRPPKFSEPDYANWVTLGAI 240

Query: 241 SYKSDVKSTSQEKPAKYFTIRITDFHYDVQITVFGQKNVEKYYKLRVGDVIAILNPEIYP 300
           SYKSDVKSTSQEKPAKYFTIRITDFHYDVQITVFGQKNVEKYYKLRVGDVIAILNPEIYP
Sbjct: 241 SYKSDVKSTSQEKPAKYFTIRITDFHYDVQITVFGQKNVEKYYKLRVGDVIAILNPEIYP 300

Query: 301 WKESAKTTGETARTTGRSFGLSIKHNMNCILEIGHSKELGFCPAMNKTKGAPCGAPINKL 360
           WKESAKTTGETARTTGRSFGLSIKHNMNCILEIGHSKELGFCPAMNKTKGAPCGAPINKL
Sbjct: 301 WKESAKTTGETARTTGRSFGLSIKHNMNCILEIGHSKELGFCPAMNKTKGAPCGAPINKL 360

Query: 361 KEQVCSYHQETHLRSVNAKRVELNGNISLRAPTRDGIQQAGYMTRNSHGTKIGLLPDVYA 420
           KEQVCSYHQETHLRSVNAKRVELNGNISLRAPTRDGIQQAGYMTRNSHGTKIGLLPDVYA
Sbjct: 361 KEQVCSYHQETHLRSVNAKRVELNGNISLRAPTRDGIQQAGYMTRNSHGTKIGLLPDVYA 420

Query: 421 PRAPGAEQKFREHFASANAHRAYFDSDYHNPDVLQNLESKRRKIQLSKKDQQINKQLSLV 480
           PRAPGAEQKFREHFASANAHRAYFDSDYHNPDVLQNLESKRRKIQLSKKDQQINKQLSLV
Sbjct: 421 PRAPGAEQKFREHFASANAHRAYFDSDYHNPDVLQNLESKRRKIQLSKKDQQINKQLSLV 480

Query: 481 LGKNHTQVKDRVSEESLQQREKATKNVMKTGILRHIGFDPTGGRMAAVLYQGDHGPADTV 540
           LGKNHTQVKDRVSEESLQQREKATKNVMKTGILRHIGFDPTGGRMAAVLYQGDHGPADTV
Sbjct: 481 LGKNHTQVKDRVSEESLQQREKATKNVMKTGILRHIGFDPTGGRMAAVLYQGDHGPADTV 540

Query: 541 REPSISEILANKKRNIDLKPSKEARRKRIQQRNEVYNSIFKEEAVATPQGSCETAQXXXX 600
           REPSISEILANKKRNIDLKPSKEARRKRIQQRNEVYNSIFKEEAVATPQGSCETAQ    
Sbjct: 541 REPSISEILANKKRNIDLKPSKEARRKRIQQRNEVYNSIFKEEAVATPQGSCETAQLSSA 600

Query: 601 XXXXXXXXIVN 611
                   IVN
Sbjct: 601 DSSDEELEIVN 611

>SAKL0E14938g Chr5 (1242645..1242714,1242780..1244434) [1725 bp, 574
           aa] {ON} similar to uniprot|P32354 Saccharomyces
           cerevisiae YIL150C MCM10 Essential chromatin-associated
           protein involved in the initiation of DNA replication
           required for the association of the MCM2-7 complex with
           replication origins
          Length = 574

 Score =  473 bits (1216), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 245/538 (45%), Positives = 345/538 (64%), Gaps = 9/538 (1%)

Query: 56  RLKQIESERSDLLARLEELKHRSXXXXXXSPTVEVPRSPTKAKCV---EDEPAPSTSAST 112
           RL ++E E+ DL  RL+++  R          VEVPRSP+K+K V   E   +     S 
Sbjct: 27  RLDELEREKKDLKQRLQDISQRKKKIDPNFSGVEVPRSPSKSKHVAVKETSRSKDDRESC 86

Query: 113 TYVXXXXXXXXXRYLLSANTPTTSYFAEKFARARDSSASTMRRKQELLKRRVYTFSDRDT 172
                       +   S ++ +T YFA+ F+ ++ +     RRK E+L  RV+TF   D 
Sbjct: 87  FPAHENLNELQVQKKASLSSISTPYFAQNFSSSKKAQEVESRRKMEMLNCRVHTFDGPDF 146

Query: 173 AIEYTTFAVDEVETYSNMRINKRYVPEEDLKRILHDIKVLRLPKLFAKVRPPKFSEPDYA 232
             EY+  AV+E E +S   I+KRY+  E  ++IL + KVLRLPKLFAKVRPP F+EP Y+
Sbjct: 147 VREYSPIAVNEEEEFSGKWISKRYITAEQARKILRETKVLRLPKLFAKVRPPTFTEPQYS 206

Query: 233 NWVTLGAISYKSDVKSTSQEKPAKYFTIRITDFHYDVQITVFGQKNVEKYYKLRVGDVIA 292
           NWVT+G IS KS VK T+  KP++YFT+ +TDF + + I +FG KNVEKYY L+VGD+IA
Sbjct: 207 NWVTIGIISAKSSVKMTTGTKPSRYFTLTLTDFKHTINIYLFGNKNVEKYYNLKVGDIIA 266

Query: 293 ILNPEIYPWKESAKTTGETARTTGRSFGLSIKHNMNCILEIGHSKELGFCPAMNKTKGAP 352
           +LNPEI+PW+ S     ++++   +SF L IKHN N ILEIG S++ GFC   NK +G  
Sbjct: 267 VLNPEIWPWRPSKVEHEQSSQAVIKSFNLCIKHNFNSILEIGTSRDFGFCSIYNKLQGKT 326

Query: 353 CGAPINKLKEQVCSYHQETHLRSVNAKRVELNGNISLRAPTRDGIQQAGYMTRNSHGTKI 412
           CG PINK  E  C YHQE   R VNAKR+ELNGN SLR+PT++G++   Y  +N  G K 
Sbjct: 327 CGTPINKSVEDRCYYHQEVQFRQVNAKRLELNGNKSLRSPTKNGVKHILY-GKNKSG-KY 384

Query: 413 GLLPDVYAPRAPGAEQKFREHFASANAHRAYFDSDYHNPDVLQNLESKRRKIQLSKKDQQ 472
            LLPD YAP+    + +   +F++ NA RA+FD DY NPD L NL+SKRRK+++ KK++ 
Sbjct: 385 DLLPDRYAPQTQSKDSQNVLYFSNPNAARAFFDDDYQNPDFLNNLDSKRRKLEVGKKEKL 444

Query: 473 INKQLSLVLGKNHTQVKDRVSEESLQQRE--KATKNVMKTGILRHIGFDPTGGRMAAVLY 530
           + KQL  V+GK+++ +    +E S +Q E  +ATKN +++G+++ IGFDPT GRM++VL 
Sbjct: 445 LQKQLQQVIGKSNSNLFK--NETSTKQDEIRRATKNALESGLIKKIGFDPTSGRMSSVLK 502

Query: 531 QGDHGPADTVREPSISEILANKKRNIDLKPSKEARRKRIQQRNEVYNSIFKEEAVATP 588
               G  +  +  ++ EIL  KK  I+LKPSKEA R++ ++R EV+N  FK+E    P
Sbjct: 503 NNSKGLKEQAKNSAVEEILQIKKEKIELKPSKEALRQKFKKREEVWNHHFKKEENPNP 560

>KLTH0E01034g Chr5 complement(97462..99128,99197..99281) [1752 bp,
           583 aa] {ON} similar to uniprot|P32354 Saccharomyces
           cerevisiae YIL150C MCM10 Essential chromatin-associated
           protein involved in the initiation of DNA replication
          Length = 583

 Score =  437 bits (1124), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 239/581 (41%), Positives = 341/581 (58%), Gaps = 25/581 (4%)

Query: 8   DPREIVPTSNYDILSDEEDMIEEGMNNMGFGLREDGTITNTKYSTVKLRLKQIESERSDL 67
           DPRE++    +DI++ +ED              ED        + +K +L ++E ++ DL
Sbjct: 6   DPREVLQLDVHDIVTSDED--------------ED--------TKIKQQLDELERQQRDL 43

Query: 68  LARLEELKHRSXXXXXXSPTVEVPRSPTKAKCVEDEP-APSTSASTTYVXXXXXXXXXRY 126
             RLE+   R          VEVP SP + +  +  P +  +S   T             
Sbjct: 44  RDRLEQKASRKKAQRQSLERVEVPASPKEERKSKASPQSQKSSKGITLAANSNNDSIEVP 103

Query: 127 LLSANTPTTSYFAEKFARARDSSASTMRRKQELLKRRVYTFSDRDTAIEYTTFAVDEVET 186
             +  + TTSYF E F  AR      ++ +  LL  RV+TF   D+        VDE E 
Sbjct: 104 WKNGPSNTTSYFVENFVNARKVEEQKIQHRSSLLSCRVHTFKGIDSLKGSQPVNVDEKEL 163

Query: 187 YSNMRINKRYVPEEDLKRILHDIKVLRLPKLFAKVRPPKFSEPDYANWVTLGAISYKSDV 246
           YS   I++RY+   +L  I+ +IKVLRLPKLF+KVRPPKF+EPDYANWV +G IS+KS+V
Sbjct: 164 YSGFNISRRYMSTSELDEIMREIKVLRLPKLFSKVRPPKFTEPDYANWVAIGIISFKSEV 223

Query: 247 KSTSQEKPAKYFTIRITDFHYDVQITVFGQKNVEKYYKLRVGDVIAILNPEIYPWKESAK 306
           K TS  KP+KYF + +TDF +++ I +F  KNVEKYY LRVGD+IAILNP+I PW+ S  
Sbjct: 224 KLTSSSKPSKYFKMTLTDFTHNLDIYIFNNKNVEKYYNLRVGDIIAILNPDILPWRPSQV 283

Query: 307 TTGETARTTGRSFGLSIKHNMNCILEIGHSKELGFCPAMNKTKGAPCGAPINKLKEQVCS 366
              E +    +SF LSI+HN +C+LEIG SK+LGFC   NK     CGAPIN+     C 
Sbjct: 284 NNDEFSGPVVKSFNLSIRHNFDCVLEIGTSKDLGFCRIPNKATRKACGAPINRAATDRCE 343

Query: 367 YHQETHLRSVNAKRVELNGNISLRAPTRDGIQQAGYMTRNSHGTKIGLLPDVYAPRAPGA 426
           YHQ+   R VNA+RVELNG+ SLR+P ++G +QA Y T +    K+ LLPD +AP+A   
Sbjct: 344 YHQDVRFRHVNAQRVELNGSTSLRSPVKNGKKQALYGT-SGVKRKLQLLPDKHAPQAQDG 402

Query: 427 EQKFREHFASANAHRAYFDSDYHNPDVLQNLESKRRKIQLSKKDQQINKQLSLVLGKNHT 486
           E +    F++ N  +A+FD  Y NPD+L NLE+KRRK++ S+K++ +  QL+  +GK   
Sbjct: 403 ESQNTLFFSNPNYAKAFFDDSYQNPDMLNNLENKRRKLKDSEKERTLQNQLNSAIGKTGY 462

Query: 487 QVKDRVSEESLQQREKATKNVMKTGILRHIGFDPTGGRMAAVLYQGDH-GPADTVREPSI 545
           Q  +  S+E  +Q + AT+ V+ +G+LR IGFDP  G+M  VL  G +       +   +
Sbjct: 463 QSFNNKSKEEQKQMKDATEQVLNSGLLRDIGFDPFRGKMREVLKFGKNVNSGLNSKSSQV 522

Query: 546 SEILANKKRNIDLKPSKEARRKRIQQRNEVYNSIFKEEAVA 586
            EI++ KK N+ L PSK  ++KR+ +R +V+   F  E +A
Sbjct: 523 KEIMSFKKSNVSLAPSKAEQKKRLLRREQVWREHFDTEKLA 563

>Kwal_55.19691 s55 complement(80960..82360) [1401 bp, 466 aa] {ON}
           YIL150C (DNA43) - (putative) involved in DNA replication
           [contig 159] FULL
          Length = 466

 Score =  397 bits (1019), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 199/444 (44%), Positives = 288/444 (64%), Gaps = 6/444 (1%)

Query: 140 EKFARARDSSASTMRRKQELLKRRVYTFSDRDTAIEYTTFAVDEVETYSNMRINKRYVPE 199
           E FA +R +  S ++ + E+L  RV+TF            AV+E E  S + +++RY+  
Sbjct: 2   ENFANSRKAEESRIKHRGEMLDSRVHTFRGLKATKSRKPIAVEEKEPASGLWVSRRYIAS 61

Query: 200 EDLKRILHDIKVLRLPKLFAKVRPPKFSEPDYANWVTLGAISYKSDVKSTSQEKPAKYFT 259
           ++L  IL DIK+LRLPKLF+KVRPPKF+EPDYANWV +G + +KS VK TS  KP KYF 
Sbjct: 62  DELAEILKDIKILRLPKLFSKVRPPKFTEPDYANWVAVGILCHKSVVKMTSSSKPTKYFK 121

Query: 260 IRITDFHYDVQITVFGQKNVEKYYKLRVGDVIAILNPEIYPWKESAKTTGETARTTGRSF 319
           + ITDF + + + VF   NVEKYY LRVGD+IAILN +I PW+ S     E +  + +SF
Sbjct: 122 MTITDFTHSLDVYVFNNPNVEKYYNLRVGDIIAILNADILPWRPSQVGNDEFSGASVKSF 181

Query: 320 GLSIKHNMNCILEIGHSKELGFCPAMNKTKGAPCGAPINKLKEQVCSYHQETHLRSVNAK 379
            LSI+ N +C+LEIG S++LGFC   NK KG  CGAPIN+     C YHQE   R VNA+
Sbjct: 182 NLSIRGNYDCVLEIGTSRDLGFCQIYNKAKGKVCGAPINRAAVDRCDYHQEIRFRQVNAQ 241

Query: 380 RVELNGNISLRAPTRDGIQQAGYMTRNSHGT--KIGLLPDVYAPRAPGAEQKFREHFASA 437
           RVELNG++SLR+P ++G +QA Y    S G   K+ LLPD +AP+    E +   +F++ 
Sbjct: 242 RVELNGSMSLRSPVKNGKKQALY---GSSGVKRKLNLLPDKHAPQQQDRESQNTLYFSNP 298

Query: 438 NAHRAYFDSDYHNPDVLQNLESKRRKIQLSKKDQQINKQLSLVLGKNHTQVKDRVSEESL 497
           N  +A+FD  Y NPD+L+NL+SKRRK++ ++ ++Q+  QLS  LGK+  Q     +++  
Sbjct: 299 NYAKAFFDDTYQNPDLLENLDSKRRKMRDTESERQLQVQLSRALGKDGQQRFSEKTKQEQ 358

Query: 498 QQREKATKNVMKTGILRHIGFDPTGGRMAAVLYQGDHGPADT-VREPSISEILANKKRNI 556
           +Q ++AT+  + +G+L++IGFDPT G+M  VL  G +    T  +   + EI+  +K N+
Sbjct: 359 KQMKQATEQTIHSGLLKNIGFDPTKGKMRDVLKVGKNSKNSTDTKSIQVREIIETRKTNV 418

Query: 557 DLKPSKEARRKRIQQRNEVYNSIF 580
            L PSK  ++KR+ +R +V+   F
Sbjct: 419 SLAPSKADQKKRLLRREQVWKEHF 442

>KLLA0A00572g Chr1 complement(51265..52910,52994..53081) [1734 bp,
           577 aa] {ON} similar to uniprot|P32354 Saccharomyces
           cerevisiae YIL150C MCM10 Essential chromatin-associated
           protein involved in the initiation of DNA replication
          Length = 577

 Score =  387 bits (994), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 229/607 (37%), Positives = 348/607 (57%), Gaps = 50/607 (8%)

Query: 2   LSTTLNDPREIVPTSNYDILSDEEDMIEEGMNNMGFGLREDGTITNTKYSTVKLRLKQIE 61
           +S  L DPREI     Y+ LSD+E  IE                       VK R+ +I+
Sbjct: 1   MSYDLTDPREITAFDPYEELSDDESEIER----------------------VKRRIVEID 38

Query: 62  SERSDLLARLEELKHRSXXXXXXSPTVEVPRSPTKA----KCVED----EPAPSTSASTT 113
           +E+ DL  RL EL+ +         +++VP SP K+    K +ED     P      +T 
Sbjct: 39  TEKRDLTNRLLELEKKRNLKDPNFDSIDVPESPKKSDNATKGIEDIKHIAPVADIEEATF 98

Query: 114 YVXXXXXXXXXRYLLSANTPTTSYFAEKFARARDSSASTMRRKQELLKRRVYTFSDRDTA 173
            V         + L      TTSYF EK      +    ++RK+ELL  RVYTF+  D  
Sbjct: 99  NVNEDYVREKVKKL-----GTTSYFTEKLRSINTNEHEAIKRKKELLAHRVYTFNG-DMF 152

Query: 174 IEYTTFAVDEVETYSNMRINKRYVPEEDLKRILHDIKVLRLPKLFAKVRPPKFSEPDYAN 233
            EY    VDE +  S + I++RYVP   L++   +IKVLRLPKLF+KVR PKFSEPDY N
Sbjct: 153 DEYEPITVDEKDDLSGLVIDRRYVPLAVLRKHTKNIKVLRLPKLFSKVRAPKFSEPDYPN 212

Query: 234 WVTLGAISYKSDVKSTSQEKPAKYFTIRITDFHYDVQITVFGQKNVEKYYKLRVGDVIAI 293
           W+ LG IS K++ + T+  KP K+F++ I+DF +++ +  FG+  VEKYYKLR+GD+IAI
Sbjct: 213 WLVLGIISKKTEPRMTNSVKPVKFFSLTISDFQFELNVIFFGKSIVEKYYKLRLGDLIAI 272

Query: 294 LNPEIYPWKESAKTTGETARTTGRSFGLSIKHNMNCILEIGHSKELGFCPAMNKTKGAPC 353
           LNPEI P    +K     A  +  +F L +  + N ILE+GHSKE G C    K KG  C
Sbjct: 273 LNPEIMP----SKKLEAGASPSYATFSLKVSKDTNNILELGHSKEFGLCQFYMKNKGKLC 328

Query: 354 GAPINKLKEQVCSYHQETHLRSVNAKRVELNGNISLRAPTRDGIQQAGYMTRNSHG---T 410
           GAPINKL +  C+YH+E  +R  +++RVE++ ++++RAP   G QQ    +++++G    
Sbjct: 329 GAPINKLHDNYCAYHKEAKMRQNSSRRVEISSSVAMRAPVVKGYQQTIVKSQHNNGKTSI 388

Query: 411 KIGLLPDVYAPRAPGAEQKFREHFASANAHRAYFDSDYHNPDVLQNLESKRRKIQLSKKD 470
           +    PD    R P A +  R  F+SANA  A+FD DY NPD+L NL++KRRKIQ  + +
Sbjct: 389 RYQQNPDKPFVREPAAAETNRFLFSSANASTAFFDDDYENPDILANLDNKRRKIQELRNN 448

Query: 471 QQINKQLSLVLGKNHTQVKDRVSEESLQQREKATKNVMKTGILRHIGFDPTGGR--MAAV 528
           + + K+L  +  K  ++ +DRV++E+   ++ AT ++ + G+   IG+DPT G+  +  +
Sbjct: 449 RNLEKKLKGLSDKLLSKKEDRVNQEA---KKTATLSMFQHGLANQIGYDPTKGKASLEML 505

Query: 529 LYQGDHGPADTVREPSISEILANKKRNIDLKPSKEARRKRIQQRNEVYNSIFK--EEAVA 586
            Y  ++      ++ +I++I   KK N+ LKPSK+  +++I++RN ++N I K  +E + 
Sbjct: 506 EYSTENKAPKNDKQLAITDICNIKKDNVSLKPSKKQLKEKIEKRNAIFNEIMKGSQERLD 565

Query: 587 TPQGSCE 593
             +GS +
Sbjct: 566 KDEGSSD 572

>YIL150C Chr9 complement(61013..62728) [1716 bp, 571 aa] {ON}
           MCM10Essential chromatin-associated protein involved in
           the initiation of DNA replication; required for the
           association of the MCM2-7 complex with replication
           origins
          Length = 571

 Score =  380 bits (976), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 219/602 (36%), Positives = 337/602 (55%), Gaps = 52/602 (8%)

Query: 6   LNDPREIVPTSNYD-ILSDEEDMIEEGMNNMGFGLREDGTITNTKYSTVKLRLKQIESER 64
           +NDPREI+    Y+ I SDEED                          +   L+ +E +R
Sbjct: 1   MNDPREILAVDPYNNITSDEEDE-----------------------QAIARELEFMERKR 37

Query: 65  SDLLARLEELKHRSXXXXXXSPTVEVPRSPTKAKCVEDEPAPSTSASTTYVXXXXXXXXX 124
             L+ RL+  +            +EVP+SPTK + V+     +T   T +          
Sbjct: 38  QALVERLKRKQEFKKPQDPNFEAIEVPQSPTKNR-VKVGSHNATQQGTKFEGSNINEVRL 96

Query: 125 RYLLSANTP---TTSYFAEKFARARDSSASTMRRKQELLKRRVYTFSDRDTAIEYTTFAV 181
             L     P   TT+YF EKF  A+ +    + + + ++  RV+TFS  +   +Y     
Sbjct: 97  SQLQQQPKPPASTTTYFMEKFQNAKKNEDKQIAKFESMMNARVHTFSTDEK--KYVPIIT 154

Query: 182 DEVETYSNMRINKRYVPEEDLKRILHDIKVLRLPKLFAKVRPPKFSEPDYANWVTLGAIS 241
           +E+E++SN+ + KRY+PE+DLKR LH+IK+LRL KLFAK+RPPKF EP+YANW T+G IS
Sbjct: 155 NELESFSNLWVKKRYIPEDDLKRALHEIKILRLGKLFAKIRPPKFQEPEYANWATVGLIS 214

Query: 242 YKSDVKSTSQEKPAKYFTIRITDFHYDVQITVFGQKNVEKYYKLRVGDVIAILNPEIYPW 301
           +KSD+K TS EKP K+F   ITDF + + + +FG+K VE+YY LR+GDVIAILNPE+ PW
Sbjct: 215 HKSDIKFTSSEKPVKFFMFTITDFQHTLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPW 274

Query: 302 KESAKTTGETARTTGRSFGLSIKHNMNCILEIGHSKELGFCPAMNKTKGAPCGAPINKLK 361
           + S +          +SF L I H+  CILEIG S++LG+CP +NK     CG+PIN   
Sbjct: 275 RPSGRG------NFIKSFNLRISHDFKCILEIGSSRDLGWCPIVNKKTHKKCGSPINISL 328

Query: 362 EQVCSYHQETHLRSVNAKRVELNGNISLRAPTRDGIQQAGYMTRNSHGTKIGLLPDVYAP 421
            + C YH+E   R  +AKR+ELNG  +L APT+   Q + Y  +  +G  I     +   
Sbjct: 329 HKCCDYHREVQFRGTSAKRIELNGGYALGAPTKVDSQPSLYKAKGENGFNI-----IKGT 383

Query: 422 RAPGAEQKFR-----EHFASANAHRAYFDSDYHNPDVLQNLESKRRKIQLSKKDQQINKQ 476
           R   +E++ R      +F ++N+ +A+FD  + NPD+L NL++KRRKI  +KK   ++++
Sbjct: 384 RKRLSEEEERLKKSSHNFTNSNSAKAFFDEKFQNPDMLANLDNKRRKIIETKKSTALSRE 443

Query: 477 LSLVLGKNHTQVKDRVSEESLQQREKATKNVMKTGILRHIGFDPTGGRMAAVLYQGDHG- 535
           L  ++ +  +   +  S    Q+ ++ T++ ++TG+++ +GFDPT G+++ VL     G 
Sbjct: 444 LGKIMRRRESSGLEDKSVGERQKMKRTTESALQTGLIQRLGFDPTHGKISQVLKSSVSGS 503

Query: 536 -PADTV---REPSISEILANKKRNIDLKPSKEARRKRIQQRNEVYNSIF-KEEAVATPQG 590
            P + +   ++  I+++L  KK  + L PSK    K+   R EV+   F  +E   T  G
Sbjct: 504 EPKNNLLGKKKTVINDLLHYKKEKVILAPSKNEWFKKRSHREEVWQKHFGSKETKETSDG 563

Query: 591 SC 592
           S 
Sbjct: 564 SA 565

>TDEL0B02170 Chr2 complement(385955..387658) [1704 bp, 567 aa] {ON}
           Anc_5.703 YIL150C
          Length = 567

 Score =  377 bits (967), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 211/589 (35%), Positives = 340/589 (57%), Gaps = 44/589 (7%)

Query: 6   LNDPREIVPTSNY-DILSDEEDMIEEGMNNMGFGLREDGTITNTKYSTVKLRLKQIESER 64
           +NDPRE+V T  + ++ SDEED  E           ED  +             +IE ++
Sbjct: 1   MNDPREVVQTDPFGELTSDEEDQRE----------LEDQIV-------------EIERQK 37

Query: 65  SDLLARLEELKHRSXXXXXXSPTVEVPRSPTK--AKCVEDEPAPSTSASTTYVXXXXXXX 122
            DL+ RL+  K +          ++V  SP K  A+ ++ EP+  T              
Sbjct: 38  RDLVERLKS-KRQLKSKDPNFDAIQVESSPVKKPAESIKVEPS-RTKRVLDIENLNEKKV 95

Query: 123 XXRYLLSANTPTTSYFAEKFARARDSSASTMRRKQELLKRRVYTFSDRDTAIEYTTFAVD 182
             R  + ANT  TSYF + F  ++     + + +QELL +RV+TF   D   ++   AV+
Sbjct: 96  ESRSQIPANT--TSYFIDNFRNSKKEEQKSQQERQELLSKRVHTFRGIDGNHKFKAVAVE 153

Query: 183 EVETYSNMRINKRYVPEEDLKRILHDIKVLRLPKLFAKVRPPKFSEPDYANWVTLGAISY 242
           EVE YS++ + +RY+ ++DL+++LH++K+LRL KLFAK++PPKF+EP Y+NW  +G IS 
Sbjct: 154 EVEEYSDLWVKQRYISQDDLRKVLHEVKILRLSKLFAKIKPPKFAEPQYSNWAPIGIISA 213

Query: 243 KSDVKSTSQEKPAKYFTIRITDFHYDVQITVFGQKNVEKYYKLRVGDVIAILNPEIYPWK 302
           K  VK +S  KP KYF   +TDF Y++ + VFG+K VE+YY LRVGD++AILNPE+ PW+
Sbjct: 214 KGQVKFSSSGKPMKYFKFTLTDFQYNLDVYVFGKKGVERYYNLRVGDIVAILNPEVLPWR 273

Query: 303 ESAKTTGETARTTGRSFGLSIKHNMNCILEIGHSKELGFCPAMNKTKGAPCGAPINKLKE 362
            S K          +SF L I H+  CILEIG S+++ +C + NK++   CG PINK KE
Sbjct: 274 PSEKG------NFIKSFNLRISHDFPCILEIGQSRDIDWCKSFNKSQNKACGTPINKTKE 327

Query: 363 QVCSYHQETHLRSVNAKRVELNGNISLRAPTRDGIQQAGYMTRNSHGTK-IGLLPDVYAP 421
           + C +H+E   RS +AKR+ELNG+ +L APT+     A Y  +++   +   +LP+ Y  
Sbjct: 328 KCCDFHREIQFRSNHAKRIELNGSFALGAPTKVDSGPALYREKSAGAHRNFKVLPNHYQ- 386

Query: 422 RAPGAEQKFRE-HFASANAHRAYFDSDYHNPDVLQNLESKRRKIQLSKKDQQINKQLSLV 480
           ++ G     R  HF++ NA +A+F+ ++ NPD+L NL+SKRRK Q  KK   + +QL  +
Sbjct: 387 KSVGKNSDLRGIHFSNGNAAKAFFNDEFQNPDILNNLDSKRRKRQDDKKSLILQQQLKRI 446

Query: 481 LGKNHTQVKDRVSEESLQQREKATKNVMKTGILRHIGFDPTGGRMAAVLYQGDHGPAD-- 538
             + H  ++     +  ++  + T+  +++G+++++GFDPT G +  VL Q     ++  
Sbjct: 447 NSR-HAAIEIEKGSKKYEEICETTEATLQSGLIQNLGFDPTHGEIGNVLKQAAKDKSNNG 505

Query: 539 --TVREPSISEILANKKRNIDLKPSKEARRKRIQQRNEVYNSIFKEEAV 585
               ++  +S +L  KK +++LKP+KE   +R + R   +   F +++V
Sbjct: 506 QLNKKQKEVSSLLKFKKEHVELKPAKEVLLQRKRDRERAWQENFGDKSV 554

>Suva_9.38 Chr9 complement(55663..57372) [1710 bp, 569 aa] {ON}
           YIL150C (REAL)
          Length = 569

 Score =  377 bits (967), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 216/595 (36%), Positives = 330/595 (55%), Gaps = 49/595 (8%)

Query: 6   LNDPREIVPTSNYD-ILSDEEDMIEEGMNNMGFGLREDGTITNTKYSTVKLRLKQIESER 64
           ++DPREI+    Y+ + SDEED                          +   L+ +E ++
Sbjct: 1   MDDPREILAVDPYNNVTSDEED-----------------------EQAIAKELEFMERKK 37

Query: 65  SDLLARLEELKHRSXXXXXXSPTVEVPRSPTKAKCVEDEPAPSTSASTTYVXXXXXXXXX 124
             L+ RL+  +            VEVP+SP K   V+        A              
Sbjct: 38  QALMERLKRKQDFKKPEDPNFEAVEVPQSPAKKSIVKKSQDALKQAIRPVASNINESMLS 97

Query: 125 RYLLSANTPTTSYFAEKFARARDSSASTMRRKQELLKRRVYTFSDRDTAIEYTTFAVDEV 184
           +    + + TT+YF +KF  A+ +    + + + ++  RV+TF   +   EY     +E+
Sbjct: 98  QQSQESPSNTTTYFMQKFQDAKRNEDKQIAKYEGMMNARVHTFGTDNK--EYKPIITNEL 155

Query: 185 ETYSNMRINKRYVPEEDLKRILHDIKVLRLPKLFAKVRPPKFSEPDYANWVTLGAISYKS 244
           E++SN+ + KRY+PEEDLKR LH+IK+LRL KLFAK+RPPKF EPDYANW T+G IS+KS
Sbjct: 156 ESFSNLWVKKRYIPEEDLKRALHEIKILRLNKLFAKIRPPKFQEPDYANWATVGLISHKS 215

Query: 245 DVKSTSQEKPAKYFTIRITDFHYDVQITVFGQKNVEKYYKLRVGDVIAILNPEIYPWKES 304
           D+K TS EKP K+F   ITDF + + + +FG+K VE+YY LR+GDVIAILNPE+ PW+ S
Sbjct: 216 DIKFTSSEKPVKFFMFTITDFQHSLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPS 275

Query: 305 AKTTGETARTTGRSFGLSIKHNMNCILEIGHSKELGFCPAMNKTKGAPCGAPINKLKEQV 364
            +          +SF L I H+  CILEIG S++LG+CP +NK     CG+PIN      
Sbjct: 276 GRG------NFIKSFNLRISHDFKCILEIGSSRDLGWCPIVNKKTHKSCGSPINTNVHMC 329

Query: 365 CSYHQETHLRSVNAKRVELNGNISLRAPTRDGIQQAGYMTRNSHGTKIGLLPDVYAPRAP 424
           C YH+E   R   AKR+ELNG  +L APT+   Q + Y  +  +   I     V + R  
Sbjct: 330 CDYHREVQFRGTGAKRIELNGGYALGAPTKVDSQPSLYRAKGENQFNI-----VRSTRKG 384

Query: 425 GAEQKFR-----EHFASANAHRAYFDSDYHNPDVLQNLESKRRKIQLSKKDQQINKQLSL 479
            +E++ R      +F ++N+ +A+FD  + NPD+L NL+SKRRKI  +KK   ++++L  
Sbjct: 385 LSEEEERVKRNSHNFTNSNSAKAFFDEKFQNPDMLANLDSKRRKIIDTKKSTALSRELGK 444

Query: 480 VLGKNHTQVKDRVSEESLQQREKATKNVMKTGILRHIGFDPTGGRMAAVLYQ----GDHG 535
           ++ +  +   +  SE   Q+ ++ T++ ++TG+++ +GFDPT G+++ VL      G+  
Sbjct: 445 IMRRKDSSGLEDKSEGEKQKMKQTTESALQTGLIQRLGFDPTHGKISKVLKSSVPGGESM 504

Query: 536 PAD-TVREPSISEILANKKRNIDLKPSKEARRKRIQQRNEVYNSIF--KEEAVAT 587
           P     ++  I+++L  KK  + L PSK    K+   R EV+   F  KE  VA+
Sbjct: 505 PNRINGKKTVINDLLQYKKEKVILAPSKNEWFKKRSHREEVWQRHFGSKETEVAS 559

>NCAS0G00220 Chr7 complement(31595..33373) [1779 bp, 592 aa] {ON}
           Anc_5.703 YIL150C
          Length = 592

 Score =  370 bits (951), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 208/533 (39%), Positives = 303/533 (56%), Gaps = 39/533 (7%)

Query: 6   LNDPREIVPTSNYD-ILSDEEDMIEEGMNNMGFGLREDGTITNTKYSTVKLRLKQIESER 64
           +NDPRE++ T  YD + SDE+D  EE +      LR+               L+ +E +R
Sbjct: 1   MNDPREVLTTDPYDNVSSDEQD--EEAI------LRD---------------LENVERKR 37

Query: 65  SDLLARLEELKHRSXXXXXXSPTVEVPRSPTKAKCVEDEPAPSTSASTTYVXXXXXXXXX 124
            DLL R++E +            ++VP SP K        A   S +   +         
Sbjct: 38  QDLLNRIKEKQESKKLLDPNFQQLQVPCSPVKKTETNVPVAMKKSTNEMEIPHENPNELR 97

Query: 125 RYLLSANTP--TTSYFAEKFARARDSSASTMRRKQELLKRRVYTFSDRDTAIEYTTFAVD 182
               S   P  TT+YF EKF +++      +++ + ++  RV+TF D+    E+    V+
Sbjct: 98  IREKSGQLPSNTTTYFMEKFQKSKKEEEGKIQKMENMMNARVHTFQDQGGKQEFKPIQVN 157

Query: 183 EVETYSNMRINKRYVPEEDLKRILHDIKVLRLPKLFAKVRPPKFSEPDYANWVTLGAISY 242
           E+E YSN+ + KRY+P+ +L+++LH+IK+LRL KLFAKVRPPKFSEP Y+NW  LG IS 
Sbjct: 158 EIEEYSNIWLKKRYIPQSELRKMLHNIKILRLSKLFAKVRPPKFSEPQYSNWAALGIISA 217

Query: 243 KSDVKSTSQEKPAKYFTIRITDFHYDVQITVFGQKNVEKYYKLRVGDVIAILNPEIYPWK 302
           K D K T+ +KP KY    +TDF + + + +FG+  VE+YY LRVGDVIAILNPE++PW+
Sbjct: 218 KGDAKFTTTDKPKKYLKFTMTDFQHKLDVYIFGKGGVERYYNLRVGDVIAILNPEVFPWR 277

Query: 303 ESAKTTGETARTTGRSFGLSIKHNMNCILEIGHSKELGFCPAMNKTKGAPCGAPINKLKE 362
            S K  G+      +SF L I H+  CILEIG SK+LGFC   ++  G  C  PIN  KE
Sbjct: 278 PSGK--GQFI----KSFNLRINHDFKCILEIGSSKDLGFCKVTSRN-GTLCNTPINMSKE 330

Query: 363 QVCSYHQETHLRSVNAKRVELNGNISLRAPTRDGIQQAGYMTRNS---HGTKIGLLPDVY 419
             C YHQE   R  N+KR+ELNG+ +L APT+       Y  +N    H  K      V 
Sbjct: 331 DRCDYHQEIRFRDNNSKRIELNGSFALGAPTKVENNPTLYRKKNGETRHSRKNRQNFSVS 390

Query: 420 APRAPGAEQKF---REHFASANAHRAYFDSDYHNPDVLQNLESKRRKIQLSKKDQQINKQ 476
           A      + +F     HF++ N+ +A+FD  + NPD+L NL SKRRKIQ  KK  +I+K+
Sbjct: 391 ASFGSINKDQFDLRNRHFSNNNSAKAFFDEKFQNPDMLNNLNSKRRKIQDDKKWTRIDKE 450

Query: 477 LSLVLGKNHTQVKDRVSEESLQQREKATKNVMKTGILRHIGFDPTGGRMAAVL 529
           LS  +G   +      S   ++Q ++AT+  +++G+++ +GFDPT G++A VL
Sbjct: 451 LSKAIGNRASDDLGERSAMEVKQMKRATETTLQSGVIQRLGFDPTHGKIANVL 503

>NDAI0F00280 Chr6 complement(58035..59867) [1833 bp, 610 aa] {ON}
           Anc_5.703 YIL150C
          Length = 610

 Score =  371 bits (952), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 221/611 (36%), Positives = 326/611 (53%), Gaps = 62/611 (10%)

Query: 6   LNDPREIVPTSNYDILSDEEDMIEEGMNNMGFGLREDGTITNTKYSTVKLRLKQIESERS 65
           +NDPRE  P   +  LSD+E+              ED  +           L+ ++  +S
Sbjct: 1   MNDPRECSPEDPFADLSDKEE-------------NEDAVLE---------ELEDLDRRKS 38

Query: 66  DLLARLEELKHRSXXXXXXSPTVEVPRSPTK--AKCVEDEPAPSTSASTTYVXXXXXXXX 123
           DLL RL+ELK R          V++P +P +        E     +              
Sbjct: 39  DLLGRLKELKERQKRRDPNFDEVQIPGTPEEKNTNIFTSEQTILQNRDRKEEEVEEEEFS 98

Query: 124 XRYLLSAN---------------TPTTSYFAEKFARARDSSASTMRRKQELLKRRVYTF- 167
              L + N               + TTSYF EKF   +        R +++LK RV+ F 
Sbjct: 99  GERLPNPNELKVREREENLEKLPSNTTSYFMEKFQHVKKKEEIENVRNEKMLKARVHMFQ 158

Query: 168 ----SDRDTAIEYTTFAVDEVETYSNMRINKRYVPEEDLKRILHDIKVLRLPKLFAKVRP 223
               S +   IEY   A +EVE YS +RI KRY+P+++L  I  +IK+LRL KLFAKVRP
Sbjct: 159 GLNKSSKIHKIEYQPEAANEVEEYSMLRIQKRYIPKKELNDIFQNIKILRLNKLFAKVRP 218

Query: 224 PKFSEPDYANWVTLGAISYKSDVKSTSQEKPAKYFTIRITDFHYDVQITVFGQKNVEKYY 283
           PKF EP Y+NWVTLG I+ K  +K TS +KP KYF   I+DF Y+V I +F +  VE+YY
Sbjct: 219 PKFEEPQYSNWVTLGIITQKGSIKFTSSDKPKKYFKFTISDFKYNVDIFIFDKHAVERYY 278

Query: 284 KLRVGDVIAILNPEIYPWKESAKTTGETARTTGRSFGLSIKHNMNCILEIGHSKELGFCP 343
            LR+GD+IAILNPE+ PW+ S    G    T  +SF L I HN +CI+E+G SK+LGFCP
Sbjct: 279 NLRIGDIIAILNPEVLPWRPSNNKNG----TGIKSFNLRINHNYHCIIEVGKSKDLGFCP 334

Query: 344 AMNK-TKGAPCGAPINKLKEQVCSYHQETHLRSVNAKRVELNGNISLRAPTRDGIQQAGY 402
             NK  +   C  PI+  KE  CSYHQE   R+  +KR+ELNG+ +L AP + G Q   Y
Sbjct: 335 IPNKINESGTCHTPIDISKEDRCSYHQEIRFRNNGSKRIELNGSFALGAPVKVGAQPQLY 394

Query: 403 MTRNS------HGTKIGLL--PDVYAPRAPGAEQKFREHFASANAHRAYFDSDYHNPDVL 454
              N       HG +  ++   ++    +   E++ R +F+S N+ +A+FD  + NPD+L
Sbjct: 395 RNNNVPVRGVYHGNRFNVVKGSEIRKNESKLMEERRRRYFSSNNSAKAFFDEKFQNPDML 454

Query: 455 QNLESKRRKIQLSKKDQQINKQLSLVL-GKNHTQVKDRVSEESLQQREKATKNVMKTGIL 513
            NL++KRRKI   K+   ++++LS  +  K+  ++    +++   + + AT+  ++TG++
Sbjct: 455 TNLDTKRRKIADDKRSNYLDQELSKAIENKSSNRLSGNKTKKEYAKMKSATETTLQTGVI 514

Query: 514 RHIGFDPTGGRMAAVLYQGDHGPADTV----REPSISEILANKKRNIDLKPSKEARRKRI 569
           + +GFDPT G++A VL  G     D V    +   + ++L  KK  + L P+KE   KR 
Sbjct: 515 QRLGFDPTHGKIAKVLQTGKDSGKDNVHNTHKVEKVKDLLEFKKGKVVLAPAKEELIKRK 574

Query: 570 QQRNEVYNSIF 580
            +R EV+   F
Sbjct: 575 NRREEVWQKHF 585

>Smik_9.19 Chr9 complement(38635..40353) [1719 bp, 572 aa] {ON}
           YIL150C (REAL)
          Length = 572

 Score =  368 bits (945), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 208/600 (34%), Positives = 326/600 (54%), Gaps = 49/600 (8%)

Query: 6   LNDPREIVPTSNYD-ILSDEEDMIEEGMNNMGFGLREDGTITNTKYSTVKLRLKQIESER 64
           ++DPREI+    Y+ + SDEED                          +   L+ +E +R
Sbjct: 1   MDDPREILAVDPYNSVTSDEED-----------------------EQAIAKELEFMERKR 37

Query: 65  SDLLARLEELKHRSXXXXXXSPTVEVPRSPTKAKCVEDEPAPSTSASTTYVXXXXXXXXX 124
             L+ RL+  +            +EVP+SPTK++            +             
Sbjct: 38  QALMERLKRKQAFKKPNDPNFEAIEVPQSPTKSRVKSGSQNAVKQVTRLETSNANESNLS 97

Query: 125 RYLLSANTP--TTSYFAEKFARARDSSASTMRRKQELLKRRVYTFSDRDTAIEYTTFAVD 182
           +       P  TT+YF +KF  A+      + + + ++  RV+TF   +   +Y     +
Sbjct: 98  QIQKQPELPINTTTYFMQKFQNAKKDEDRQIAKFESMMDARVHTFGTDNK--KYKPIIAN 155

Query: 183 EVETYSNMRINKRYVPEEDLKRILHDIKVLRLPKLFAKVRPPKFSEPDYANWVTLGAISY 242
           E+E +SN+ + KRY+PE+DLKR LH+IK+LRL KLFAKVRPPKF  P+YANW T+G IS+
Sbjct: 156 ELEGFSNLWVKKRYIPEDDLKRSLHEIKILRLGKLFAKVRPPKFQAPEYANWATVGLISH 215

Query: 243 KSDVKSTSQEKPAKYFTIRITDFHYDVQITVFGQKNVEKYYKLRVGDVIAILNPEIYPWK 302
           KSD+K TS EKP K+F   ITDF + + + +FG+K VE+YY LR+GD+IAILNPE+ PW+
Sbjct: 216 KSDIKFTSSEKPVKFFMFTITDFQHTLDVYIFGKKGVERYYNLRLGDIIAILNPEVLPWR 275

Query: 303 ESAKTTGETARTTGRSFGLSIKHNMNCILEIGHSKELGFCPAMNKTKGAPCGAPINKLKE 362
            S +          +SF L I H+  CILEIG S++LG+CP +N      CG+PIN    
Sbjct: 276 PSGRG------NFIKSFNLRISHDFKCILEIGSSRDLGWCPIVNTKTHKKCGSPINISLH 329

Query: 363 QVCSYHQETHLRSVNAKRVELNGNISLRAPTRDGIQQAGYMTRNSHGTKIGLLPDVYAPR 422
           + C YH+E   R  +AKR+ELNG  +L APT+   Q + Y  +  +  +  ++ D     
Sbjct: 330 KCCDYHREVQFRGTSAKRIELNGGYALGAPTKVNSQPSLYKAKGEN--RFNIIRDARKGL 387

Query: 423 APGAE--QKFREHFASANAHRAYFDSDYHNPDVLQNLESKRRKIQLSKKDQQINKQLSLV 480
           +   E  +K   +F ++N+ +A+FD  + NPD+L NL++KRRKI  +KK + +N++L+ +
Sbjct: 388 SEEEERMKKSSHNFTNSNSAKAFFDEKFQNPDMLANLDNKRRKITDTKKSKALNRELAKI 447

Query: 481 LGKNHTQVKDRVSEESLQQREKATKNVMKTGILRHIGFDPTGGRMAAVLYQGDHGPAD-- 538
           + +  +   +  S+   Q+ ++ T+N ++TG+++ +GFDPT G ++ VL     G     
Sbjct: 448 MRRKESSGLEDKSDGEKQKMKQTTENALQTGLIQRLGFDPTHGEISKVLKSSVPGGESKN 507

Query: 539 ---TVREPSISEILANKKRNIDLKPSKEARRKRIQQRNEVYNSIFKEEAVATPQGSCETA 595
                ++  I+++L  KK  + L PSK    K+   R EV+   F       P+G  E A
Sbjct: 508 NLLNGKKTVINDLLHYKKEKVILAPSKNEWFKKRNHREEVWQRHF------GPKGEAEEA 561

>Skud_9.18 Chr9 complement(38082..39797) [1716 bp, 571 aa] {ON}
           YIL150C (REAL)
          Length = 571

 Score =  367 bits (942), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 215/592 (36%), Positives = 332/592 (56%), Gaps = 57/592 (9%)

Query: 6   LNDPREIVPTSNYD-ILSDEEDMIEEGMNNMGFGLREDGTITNTKYSTVKLRLKQIESER 64
           ++DPRE +    Y+ + SDE+D                         T+   L+ +E ++
Sbjct: 1   MDDPREFLVADPYNNVTSDEDD-----------------------EQTIAKELEFMERKK 37

Query: 65  SDLLARLEELKHRSXXXXXXSPTVEVPRSPTKAKCVEDEPAPSTS----ASTTYVXXXXX 120
             L+ RL+  +            +EVP+SP K + +             A++        
Sbjct: 38  QALVERLKRKQEFKRAEDPNFEAIEVPQSPAKNRNIMKSQNTMKRDMRPAASNINDLKLS 97

Query: 121 XXXXRYLLSANTPTTSYFAEKFARARDSSASTMRRKQELLKRRVYTF-SDRDTAIEYTTF 179
               +  L +NT  T YF +KF  A+ +      + + ++  RV+TF +D+    EY   
Sbjct: 98  QLQQKQELPSNT--TGYFMQKFQNAKRNEEKQRAKYENMMNARVHTFGTDKK---EYRAT 152

Query: 180 AVDEVETYSNMRINKRYVPEEDLKRILHDIKVLRLPKLFAKVRPPKFSEPDYANWVTLGA 239
             +E+E +SN+ + KRY+PE+DLKR LH+IK+LRL KLFAK+RPPKF EPDYANW  +G 
Sbjct: 153 IANELEEFSNIWVKKRYIPEDDLKRALHEIKILRLGKLFAKIRPPKFQEPDYANWAVVGL 212

Query: 240 ISYKSDVKSTSQEKPAKYFTIRITDFHYDVQITVFGQKNVEKYYKLRVGDVIAILNPEIY 299
           IS+KSDVK TS +KPAK+F   ITDF + + + +FG+K VE+YY LR+GDVIAILNPE+ 
Sbjct: 213 ISHKSDVKFTSSDKPAKFFMFTITDFQHTLDVYIFGKKAVERYYNLRLGDVIAILNPEVL 272

Query: 300 PWKESAKTTGETARTTGRSFGLSIKHNMNCILEIGHSKELGFCPAMNKTKGAPCGAPINK 359
           PW+ S +          +SF L I H+  CILEIG S++LG+CP +N+ K   CG+PIN 
Sbjct: 273 PWRPSGQG------NFIKSFNLRISHDFKCILEIGSSRDLGWCPIVNRKKNENCGSPINI 326

Query: 360 LKEQVCSYHQETHLRSVNAKRVELNGNISLRAPTRDGIQQAGYMTRNSHGTKIGLLPDVY 419
              + C YH+E   R  +AKR+ELNG  +L APT+   Q   Y  +  +   +     V 
Sbjct: 327 ALHKCCDYHREVQFRGTSAKRIELNGGYALGAPTKVDAQPTLYRAKGENNFNL-----VR 381

Query: 420 APRAPGAEQKFR-----EHFASANAHRAYFDSDYHNPDVLQNLESKRRKIQLSKKDQQIN 474
           + R   +E++ R      +F ++N+ +A+FD  + NPD+L NL+SKRRKI  SKK   ++
Sbjct: 382 SIRKTLSEEEERMKKNSHNFRNSNSAKAFFDEKFQNPDMLANLDSKRRKIIDSKKSTALS 441

Query: 475 KQLSLVL-GKNHTQVKDRVSEESLQQREKATKNVMKTGILRHIGFDPTGGRMAAVLYQGD 533
           ++L  ++  K  + ++D+  EE  Q+ ++ T++ ++TG+L+ +GFDPT G+++ VL    
Sbjct: 442 RELGKIMRRKGSSGLEDKCDEEK-QKIKQTTESALQTGLLQRLGFDPTHGKISKVLKSSV 500

Query: 534 HG--PADTV---REPSISEILANKKRNIDLKPSKEARRKRIQQRNEVYNSIF 580
            G  P + V   ++  I ++L  KK  + L PSK    K+   R EV+   F
Sbjct: 501 PGGEPRNKVMGGKKTVIDDLLNYKKEKVILAPSKNEWFKKRSHREEVWQKHF 552

>TPHA0E00210 Chr5 complement(26313..27947) [1635 bp, 544 aa] {ON}
           Anc_5.703 YIL150C
          Length = 544

 Score =  365 bits (936), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 184/460 (40%), Positives = 281/460 (61%), Gaps = 19/460 (4%)

Query: 129 SANTP--TTSYFAEKFARARDSSASTMRRKQELLKRRVYTFSDRDTAIEYTTFAVDEVET 186
           +AN P  TTSYF + F +A+      ++  Q+ +  RV++F+  + + +Y +  V+E+E 
Sbjct: 60  NANLPANTTSYFMQNFLKAKKEETKQVKEYQQKMSSRVHSFAGANLSKKYQSIIVEELEE 119

Query: 187 YSNMRINKRYVPEEDLKRILHDIKVLRLPKLFAKVRPPKFSEPDYANWVTLGAISYKSDV 246
           YS   I+KRY+P+E++ + LH+IK+LRL KLFAK+RPPKFSEPDYANW   G I  K D+
Sbjct: 120 YSRFNISKRYLPKEEVSKCLHNIKILRLNKLFAKIRPPKFSEPDYANWAVTGIICSKEDI 179

Query: 247 KSTSQEKPAKYFTIRITDFHYDVQITVFGQKNVEKYYKLRVGDVIAILNPEIYPWKESAK 306
           K TS + P K+F   IT+F + + I +FG   VEKYY LRVGD+I ILNPE+ PW+   K
Sbjct: 180 KLTSSKTPVKFFKFTITNFQHTLDIFIFGAAGVEKYYNLRVGDIIFILNPEVLPWRPEFK 239

Query: 307 TTGETARTTGRSFGLSIKHNMNCILEIGHSKELGFCPAMNKTKGAPCGAPINKLKEQVCS 366
                   + +SF L I H  +CILEI  SK++ +C  +N+  GA C  PINK K+ VC 
Sbjct: 240 G------NSIKSFNLRISHKFDCILEIARSKDIAWCQQINRKTGAKCNTPINKSKQDVCD 293

Query: 367 YHQETHLRSVNAKRVELNGNISLRAPTRDGIQQAGYMTRNSHGTKIGLLPDVYAPRAPGA 426
           YH+E   RS NAKRVEL+G  +L APT+   + A Y ++N+   K G   ++ A R    
Sbjct: 294 YHKEMQFRSANAKRVELSGTYALGAPTQIDSRPALYRSKNTSNLKPGNNFNIVADRRYMK 353

Query: 427 EQKF------REHFASANAHRAYFDSDYHNPDVLQNLESKRRKIQLSKKDQQINKQLSLV 480
           +++       R HF+S+N+ +A+FD D+ NPD+L NLE+KRRKI+  K+D  + + L   
Sbjct: 354 KKENDPINSKRHHFSSSNSAKAFFDEDFQNPDMLVNLENKRRKIKDDKRDVMLQRALRES 413

Query: 481 LGKNHTQVKDRVSEESLQQREKATKNVMKTGILRHIGFDPTGGRMAAVLYQGDHGPADTV 540
           +G +   +KD+ ++E +Q     T   ++ G ++ +GFDPTGG++  VL +       + 
Sbjct: 414 VGNSKLLLKDKSNQE-IQSMRNTTDATLQNGFIQKLGFDPTGGQIKVVLEKSADKSTQSK 472

Query: 541 REPSISEILAN----KKRNIDLKPSKEARRKRIQQRNEVY 576
            +   S  + N    KK +++LKPS+E   +++  R + +
Sbjct: 473 LQKQKSNAMENLVTFKKSSVNLKPSREVLLEKLHHREQSF 512

>Kpol_1043.71 s1043 (151546..153303) [1758 bp, 585 aa] {ON}
           (151546..153303) [1758 nt, 586 aa]
          Length = 585

 Score =  363 bits (932), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 202/511 (39%), Positives = 299/511 (58%), Gaps = 34/511 (6%)

Query: 88  VEVPRSPTKAKCVEDEPAPSTSASTTYVXXXXXXXXXRYLL----SANTPTTSYFAEKFA 143
           V+VP SP K++ VE +P   TS                  L     +N  TTSYF EKF 
Sbjct: 59  VQVPSSPKKSRVVELKP---TSKPIDNNEEEEEENPNEVALMTKDDSNYGTTSYFMEKFY 115

Query: 144 RARDSSASTMRRKQELLKRRVYTFSDRDTAIEYTTFAVDEVETYSNMRINKRYVPEEDLK 203
            ++      +     ++  RV+TFS   +  E+    VDE++ YSN+ +  RY+P ++L 
Sbjct: 116 NSKKDHERKVVAYSSMMSSRVHTFSGTGSKKEFKPTDVDELDQYSNLWLRSRYIPVDELN 175

Query: 204 RILHDIKVLRLPKLFAKVRPPKFSEPDYANWVTLGAISYKSDVKSTSQEKPAKYFTIRIT 263
            +L DIK+LRLPKLFAKVRPPKF+EP Y+NWV  G I+ K D+K TS  KP KYF   I+
Sbjct: 176 LMLLDIKILRLPKLFAKVRPPKFTEPQYSNWVVTGIITSKDDIKYTSSSKPTKYFKFTIS 235

Query: 264 DFHYDVQITVFGQKNVEKYYKLRVGDVIAILNPEIYPWKESAKTTGETARTTGRSFGLSI 323
           DF +++ + +FG K VEKYY LRVGDV+AILNPEI PW+ S  + G  + +T +SF L I
Sbjct: 236 DFQHNLDVFIFGVKGVEKYYNLRVGDVVAILNPEILPWRPSENSGG--SGSTIKSFNLRI 293

Query: 324 KHNMNCILEIGHSKELGFCPAMNKTKGAPCGAPINKLKEQVCSYHQETHLRSVNAKRVEL 383
            H  +CILEIG S++LG+CP  N +K   C  PINK KE  C YH+E   R   + RVEL
Sbjct: 294 SHKFDCILEIGASRDLGWCPIPNASKNTLCKTPINKSKEDKCQYHREIQFRKTTSNRVEL 353

Query: 384 NGNISLRAPTRDGIQQAGYMTRN-SHGTKI----GLLPDV-YAPRAPGAEQKFR-EHFAS 436
           +G  +L APT+   + A Y  R  S+ +++     ++ D  Y  R    + + R  HF++
Sbjct: 354 SGTYALGAPTKVDARPALYQNRGTSNNSRVQKSYNMVSDSHYQKRKDSNKLETRMHHFST 413

Query: 437 ANAHRAYFDSDYHNPDVLQNLESKRRKIQLSKKDQQINKQLSLVLGKNHTQVKDRVSEES 496
            N+ +A+FD D+ NPD+L NL+SKRRKI+ SK ++ + K L           K+ V +ES
Sbjct: 414 MNSAKAFFDEDFQNPDILNNLDSKRRKIKDSKMERNLVKAL-----------KNTVDKES 462

Query: 497 --LQQREKATKNVMKTGILRHIGFDPTGGRMAAVLYQGDHGPADT-----VREPSISEIL 549
              +  + AT+  ++TGIL+ +GFDPTGG++++V+   +     T      ++ ++ +++
Sbjct: 463 KNFKNLKNATQATLQTGILQRLGFDPTGGKLSSVIRNSNSETEVTNKYQMEKKEALDDLM 522

Query: 550 ANKKRNIDLKPSKEARRKRIQQRNEVYNSIF 580
             +K  ++LKPSK+   KR   R   +  +F
Sbjct: 523 TFRKDTVNLKPSKDDLIKRRIDRQRNWKKLF 553

>CAGL0H06589g Chr8 (649740..651491) [1752 bp, 583 aa] {ON} similar
           to uniprot|P32354 Saccharomyces cerevisiae YIL150c DNA43
          Length = 583

 Score =  359 bits (921), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 216/613 (35%), Positives = 331/613 (53%), Gaps = 72/613 (11%)

Query: 1   MLSTTLNDPREIVPTSNYDILSDEEDMIEEGMNNMGFGLREDGTITNTKYSTVKLRLKQI 60
           M+    NDPRE+     Y  LS E+D  +E                    S ++  L+ I
Sbjct: 1   MVHIIDNDPREVKLLDPYTDLS-EDDKEQE--------------------SDIQRELEMI 39

Query: 61  ESERSDLLARLEELKHRSXXXXXXSPT---------VEVPRSPTKAKCVEDEPAPSTSAS 111
           E ++ DL++RL+E K R        P          VEVPRSP +      E        
Sbjct: 40  ERKKQDLISRLKENK-RKLLSKQLDPNMKNINSRGRVEVPRSPKRESLPAQENLQHNVPQ 98

Query: 112 TTYVXXXXXXXXX-------RYLLSANTPTTSYFAEKFARARDSSASTMRRKQELLKRRV 164
            T+                 R  L     TTSYF  KF  ++      +   Q+++  R 
Sbjct: 99  VTHNQAANNKKANPNEEDIVRKELDV-VATTSYFQNKFKNSKTDENRMVTAYQQMMSART 157

Query: 165 YTFSDRDTAIEYTTFAVDEVETYSNMRINKRYVPEEDLKRILHDIKVLRLPKLFAKVRPP 224
           +TF+   +  +  T   DE+E YSN  I KRY+P++++ ++LH IK+LRL KLFAKVRPP
Sbjct: 158 HTFNGSTSLSDNKTIQCDELEPYSNFHIKKRYIPKDEVDKLLHGIKILRLNKLFAKVRPP 217

Query: 225 KFSEPDYANWVTLGAISYKSDVKSTSQEKPAKYFTIRITDFHYDVQITVFGQKNVEKYYK 284
            FSEP Y+NWV +GAIS K DVK T+  KP KYF   +TDF +++ + VFG+K VE+YY 
Sbjct: 218 SFSEPQYSNWVAIGAISSKEDVKLTNAAKPVKYFKFTLTDFRHNLDVYVFGKKPVERYYN 277

Query: 285 LRVGDVIAILNPEIYPWKESAKTTGETARTTGRSFGLSIKHNMNCILEIGHSKELGFCPA 344
           LRVGD+IA+LNPEI PW+ S    G       +SF L I H+ NCILEIG S++LG+C  
Sbjct: 278 LRVGDIIAVLNPEILPWRPSGCVNG------IKSFNLRIGHDFNCILEIGASRDLGWCQM 331

Query: 345 MNKTKGAPCGAPINKLKEQVCSYHQETHLRSVNAKRVELNGNISLRAPTRDGIQQAGYMT 404
           +N  +   C +PIN   ++ C +H+E  +RS  +KR+EL+G+ +L APT+ G Q + Y  
Sbjct: 332 VNHGQSKICNSPINTKTDRCCEFHRELQMRSTASKRIELSGSYALGAPTKVGTQPSIYKD 391

Query: 405 RNSHGTKIGLLPDVYAPRAPGAEQKFR--------EHFASANAHRAYFDSDYHNPDVLQN 456
            N           +++    G++++           HF++  A +A+FD  + +P +L N
Sbjct: 392 NNKSRNTNPAKHKMFSITGHGSKKEQEKEKHEIEAHHFSNKRAAKAFFDDSFQDPSLLAN 451

Query: 457 LESKRRKIQLSKKDQQINKQLSLVLGKNHTQVKDRVSEESLQQREKATKNVMKTGILRHI 516
           LESKRRKI+ SK D+ + K L+   G++ +Q K++      QQ ++ T+  ++TG+++ +
Sbjct: 452 LESKRRKIKASKMDRNLLKALN---GEDASQSKNK------QQVKEITEKTLQTGVIQRL 502

Query: 517 GFDPTGGRMAAVLYQGDHGPADTVREPSIS-------EILANKKRNIDLKPSKEARRKRI 569
           GFDP+GG++A VL   D        +P+IS       +++  KK  I LKPS+E + ++ 
Sbjct: 503 GFDPSGGQIAKVL---DKSRGTKTDDPTISKKMGLINDLIHFKKDKIKLKPSREIQLEKR 559

Query: 570 QQRNEVYNSIFKE 582
            +R  ++   F++
Sbjct: 560 HRREAIWKKHFQD 572

>ZYRO0G06578g Chr7 complement(519877..521586) [1710 bp, 569 aa] {ON}
           similar to uniprot|P32354 Saccharomyces cerevisiae
           YIL150C MCM10 Essential chromatin-associated protein
           involved in the initiation of DNA replication required
           for the association of the MCM2-7 complex with
           replication origins
          Length = 569

 Score =  355 bits (912), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 211/591 (35%), Positives = 324/591 (54%), Gaps = 56/591 (9%)

Query: 6   LNDPREIVPTSNYDILSDEEDMIEEGMNNMGFGLREDGTITNTKYSTVKLRLKQIESERS 65
           + DPRE++    YD+L                      T    + + ++ ++ +IE ++ 
Sbjct: 1   MRDPREVLNNDLYDVL----------------------TSEGEEENEIEAQIAEIERQKK 38

Query: 66  DLLARLEELKHRSXXXXXXSPTVEVPRSPTKAKCVEDEPAPSTSASTTYVXXXXX---XX 122
           DLL RL   K            ++V  SP K       P          V          
Sbjct: 39  DLLQRLNVKKTNPKPLDPNLSHIQVESSPKKVTNSVLPPTVQQQEPRGEVRNENLNELKA 98

Query: 123 XXRYLLSANTPTTSYFAEKFARARDSSASTMRRKQELLKRRVYTFSDRDTAIEYTTFAVD 182
             +  + ANT  TS+F EK++ ++      +R +++LL  RV+TF       EY     +
Sbjct: 99  QSQEQIPANT--TSFFIEKYSTSKRKQDYEVRAQEDLLSNRVHTFQGARRQDEYKPIPTN 156

Query: 183 EVETYSNMRINKRYVPEEDLKRILHDIKVLRLPKLFAKVRPPKFSEPDYANWVTLGAISY 242
           E+E +SN+ I+KRY+P+E+ + I  +IK+LRL KLFAKV+PPKF+EP Y+NW  +G IS 
Sbjct: 157 ELEEFSNLWISKRYIPKEEQRSIFANIKILRLSKLFAKVKPPKFNEPPYSNWAVIGLISN 216

Query: 243 KSDVKSTSQEKPAKYFTIRITDFHYDVQITVFGQKNVEKYYKLRVGDVIAILNPEIYPWK 302
           K +VK TS   P KYF   +T+F Y +   +FG++ VE+YY LRVGD+IAILNP++ PW+
Sbjct: 217 KGEVKFTSAASPKKYFKFTLTNFQYSIDTYIFGKEGVERYYNLRVGDIIAILNPQVLPWR 276

Query: 303 ESAKTTGETARTTGRSFGLSIKHNMNCILEIGHSKELGFCPAMNKTKGAPCGAPINKLKE 362
            S        +   +SF L I H   CILEIG S++LG+CP  NK+K   C APINK KE
Sbjct: 277 PSG------TKAHIKSFNLRISHKFECILEIGASRDLGWCPMFNKSKNEICRAPINKDKE 330

Query: 363 QVCSYHQETHLRSVNAKRVELNGNISLRAPTRDGIQQAGYMTRNSHGTKIGLLPDVYAPR 422
             C YH+E   RS NAKRVEL+G  +L APTR   Q A Y   +S      L  ++    
Sbjct: 331 DCCEYHRELKFRSTNAKRVELSGTYALGAPTRIDAQPALYRGGSSQKN---LNYNIITNG 387

Query: 423 APGAEQK-------FREHFASANAHRAYFDSDYHNPDVLQNLESKRRKIQLSKKDQQINK 475
           A G   K          HF++ NA +A+FD  + NP+ L+NLE+KRRK++ ++K   +N+
Sbjct: 388 ADGGSNKEINPLDINARHFSNRNAAKAFFDERFQNPETLRNLENKRRKLRDNRKSNILNR 447

Query: 476 QLSLVLGKNHTQVKDRVSEESLQQREKATKNVMKTGILRHIGFDPTGGRMAAVLYQGDHG 535
           +L      +   +K + +EE + + ++ T++ M +G+++++GFDPT G++A+V     H 
Sbjct: 448 ELK---KNSELDIKHKSAEE-IDEIKRTTESTMGSGMMKNLGFDPTQGKIASVF---KHQ 500

Query: 536 PADTVREP------SISEILANKKRNIDLKPSKEARRKRIQQRNEVYNSIF 580
            +D+ ++P      S++ +L+ KK N+ LKPSKE   K+ ++R  V+   F
Sbjct: 501 RSDSDKKPLTEKDSSVASLLSFKKDNVKLKPSKEILIKQKRRRERVWKEHF 551

>KAFR0D02210 Chr4 complement(441977..443731) [1755 bp, 584 aa] {ON}
           Anc_5.703 YIL150C
          Length = 584

 Score =  350 bits (897), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 207/598 (34%), Positives = 325/598 (54%), Gaps = 55/598 (9%)

Query: 6   LNDPREIVPTSNY-DILSDEEDMIEEGMNNMGFGLREDGTITNTKYSTVKLRLKQIESER 64
           ++DPREI P   Y +I  D+ED                          ++L L++IE+ +
Sbjct: 1   MSDPREIAPNDLYQNITPDKEDA-----------------------RRIELELEKIENVK 37

Query: 65  SDLLARLEELKHRSXXXXXXSPTVEVPRSPTKA---KCVEDEPAP--------STSASTT 113
            DLL RL   K            V+VP SP K    + VE +            ++ +  
Sbjct: 38  RDLLERLHRKKIEIERRDPNFTGVQVPASPVKKHELQLVEQKDQKLKNINRFEESNENPN 97

Query: 114 YVXXXXXXXXXRYLLSANTPTTSYFAEKFARARDSSASTMRRKQELLKRRVYTFSDRDTA 173
            +            L+ +  +T YF EKF  A+      + + + ++K RV+TF+  +  
Sbjct: 98  ELCLQQRFQKQTARLNDSNASTEYFMEKFRDAKRKEKVHIEKHESMMKSRVHTFNGIEPK 157

Query: 174 IEYTTFAVDEVETYSNMRINKRYVPEEDLKRILHDIKVLRLPKLFAKVRPPKFSEPDYAN 233
            EY    VDE+E YSN+ INKRY P  +LK +LH++K+LRL KLFAKVRPPKF EP Y+N
Sbjct: 158 NEYQHVIVDELEQYSNLWINKRYTPVSNLKSMLHEVKILRLNKLFAKVRPPKFEEPQYSN 217

Query: 234 WVTLGAISYKSDVKSTSQEKPAKYFTIRITDFHYDVQITVFGQKNVEKYYKLRVGDVIAI 293
           WV +G +S KSD+K T+  KP KY    +TDF + V   +FG++ VE+YY LR+GD+IA+
Sbjct: 218 WVVVGIVSDKSDIKFTASNKPQKYLKFTLTDFKHKVDTYIFGKEGVERYYNLRIGDIIAV 277

Query: 294 LNPEIYPWKESAKTTGETARTTGRSFGLSIKHNMNCILEIGHSKELGFCPAMNKTKGAPC 353
           LNPEI PW+ S K      +   +SF L I H   CILEIG S++L  CP + ++    C
Sbjct: 278 LNPEILPWRPSGK------QNYIKSFNLRISHPYKCILEIGKSRDLARCPIVVRSTSKEC 331

Query: 354 GAPINKLKEQVCSYHQETHLRSVNAKRVELNGNISLRAPTRDGIQQAGYMTRNSHGTKI- 412
           G PINK  ++ C YH+E  +R   +KR++L+G  +L APT+   Q A Y    +   KI 
Sbjct: 332 GVPINKKVDRCCEYHREMEIRKGPSKRLDLSGQYALGAPTKLESQPALYRGHTAQNVKIQ 391

Query: 413 --GLLPDVYAPRAPGAEQKFRE---HFASANAHRAYFDSDYHNPDVLQNLESKRRKIQLS 467
              L P  Y+   P    K+ E    F++ NA +A+FD ++ NPD++ NL++KRRKI   
Sbjct: 392 NFKLTPS-YSQNNPHLIDKYGEKSKFFSNRNAAKAFFDDEFQNPDMISNLDNKRRKIMEQ 450

Query: 468 KKDQQINKQLSLVLGKNHTQVKDRVSEESLQQREKATKNVMKTGILRHIGFDPTGGRMAA 527
           +K   +N++L  +L K+  Q  +  + E +++ ++ T+  +++G+ + +GFDPTGG+++ 
Sbjct: 451 RKSNVLNRELDRLLRKD--QDLEGKTREEVEKMKQTTQRTLQSGLFQKVGFDPTGGKISR 508

Query: 528 VLYQGDHGPAD-----TVREPSISEILANKKRNIDLKPSKEARRKRIQQRNEVYNSIF 580
           +L   +          + ++ ++ +++A KK  I L PSK     +  +R +V+   F
Sbjct: 509 ILKNKERSKDGEPKFLSQKDRTVDDLMAFKKEYIILAPSKVDLLNKKNKREKVWQENF 566

>TBLA0G01020 Chr7 (256107..257891) [1785 bp, 594 aa] {ON} Anc_5.703
           YIL150C
          Length = 594

 Score =  332 bits (852), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 203/603 (33%), Positives = 329/603 (54%), Gaps = 52/603 (8%)

Query: 6   LNDPREIVPTSNYDILSDEEDMIEEGMNNMGFGLREDGTITNTKYSTVKLRLKQIESERS 65
           +NDPRE+     +D +S +ED   E                      ++ +++ IE ++ 
Sbjct: 1   MNDPREVFENDLFDNISPDEDEELE----------------------LQKQIELIERQKR 38

Query: 66  DLLARLEELKHRSXXX------------XXXSPTVEVPRSPTKAKCVEDEPA--PSTSAS 111
           DL  RLE  +  S                     ++VP SP K K    + A  P T  +
Sbjct: 39  DLQERLEYKRKVSRAVDPNFISTEGNVDATSESRIQVPGSPEKIKRKHTQLAATPVTKKN 98

Query: 112 TTYVXXXXXXXXXRYLLSANTP--TTSYFAEKFARARDSSASTMRRKQELLKRRVYTFSD 169
           T              +  A+ P  +T+YF   FA ++   A  ++  + L+  RV++F +
Sbjct: 99  TGIQDNPNELKLKNQIEPASVPAGSTAYFMNNFASSKKVEAQKIQDYETLMSARVHSFGN 158

Query: 170 -RDTAIEYTTFAVDEVETYSNMRINKRYVPEEDLKRILHDIKVLRLPKLFAKVRPPKFSE 228
             +   E     V+E E YS + I++RY+ EE + ++L DIK+LRL KLFAK+RPPKF  
Sbjct: 159 YTNLQKESQIINVEEKEKYSGLWISRRYLKEETIDQLLQDIKILRLNKLFAKIRPPKFES 218

Query: 229 PDYANWVTLGAISYKSDVKSTSQEKPAKYFTIRITDFHYDVQITVFGQKNVEKYYKLRVG 288
           P Y+NWV +G I+ KS  K TS   P KYF   I DF  ++ I VF ++ + KYY LRVG
Sbjct: 219 PQYSNWVAVGVITEKSGFKLTSSNTPRKYFKFTIGDFQQNISIFVFNREAIAKYYNLRVG 278

Query: 289 DVIAILNPEIYPWKESAKTTGETARTTGRSFGLSIKHNMNCILEIGHSKELGFCPAMNKT 348
           D+I ILNP I PW+ S +          +SF LSI+   +CI+EIG S++LG+C    K+
Sbjct: 279 DIICILNPVIAPWRPSEEN------GYIKSFNLSIQTKYDCIIEIGKSRDLGWCNVPVKS 332

Query: 349 KGA-PCGAPINKLKEQVCSYHQETHLRSVNAKRVELNGNISLRAPTRDGIQQAGY--MTR 405
           KG  PCG PINK K++ C +H+ET  R+  AKR+ELNG+ +L APT+     + Y   T 
Sbjct: 333 KGGKPCGTPINKTKDKCCEFHRETEFRNAAAKRIELNGSFALGAPTKADTNPSLYKKKTN 392

Query: 406 NSHGTKIGLLPDVYAPRAPGAEQKFREHFASANAHRAYFDSDYHNPDVLQNLESKRRKIQ 465
           N +      +      R  G  +    +F S N  +A+F+ ++ NPD++ NL+SKRRK++
Sbjct: 393 NIYSKNQFNVVRRRNARKEGDSKLHNSNFRSTNIAKAFFNDEFQNPDIISNLDSKRRKLK 452

Query: 466 LSKKDQQINKQLSLVLGK--NHTQVKDRVSEESLQQREKATKNVMKTGILRHIGFDPTGG 523
            +K+D ++ K+L+  L K  N ++  +  S+E +++    T+N+M+ G+L++IG+DPT G
Sbjct: 453 DAKRDSELIKELNKTLTKEDNVSKNLEGKSKEDVKEMRNITENIMQIGMLKNIGYDPTHG 512

Query: 524 RMAAVLYQGD-HGPADTV-REPSISEILANKKRNIDLKPSKEARRKRIQQRNEVYNSIFK 581
           +M  ++ + +   P+ T  R  +++++L  KK  ++LKP K     + ++R+E++N  F 
Sbjct: 513 KMKYLMKKSNGKDPSYTSNRSNAVNDLLHFKKDKVNLKPLKSDLLMKKRKRDEIWNEYFG 572

Query: 582 EEA 584
           +++
Sbjct: 573 DQS 575

>KNAG0L02150 Chr12 (386276..388126) [1851 bp, 616 aa] {ON} Anc_5.703
           YIL150C
          Length = 616

 Score =  332 bits (851), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 176/472 (37%), Positives = 276/472 (58%), Gaps = 30/472 (6%)

Query: 134 TTSYFAEKFARARDSSASTMRRKQELLKRRVYTFSDRDTAIEYTTFAVDEVETYSNMRIN 193
           TTSYF EKF +++ +    +  ++ +L  RV+TF   D   E+   AV+E+E +S++ I+
Sbjct: 127 TTSYFLEKFQQSKKTEKLEIEAQETMLSARVHTFQGVDK--EFQLEAVNELEQFSDLWIS 184

Query: 194 KRYVPEEDLKRILHDIKVLRLPKLFAKVRPPKFSEPDYANWVTLGAISYKSDVKSTSQEK 253
           KRY+P++ L+  L D+K+LRL KLFAKVRPPKF EP Y+NW  L  IS KS+VK T+ + 
Sbjct: 185 KRYIPKQYLEESLRDVKLLRLNKLFAKVRPPKFQEPQYSNWAVLAIISKKSEVKFTTSKN 244

Query: 254 PAKYFTIRITDFHYDVQITVFGQKNVEKYYKLRVGDVIAILNPEIYPWKESAKTTGETAR 313
           P K+    +T+F   + + VFG   V++YY LR GD++A+LNPEI PW+ S    G    
Sbjct: 245 PQKFIRFTLTNFQQQLDLFVFGDAGVKRYYNLREGDIVAVLNPEILPWRPSG---GSQQT 301

Query: 314 TTGRSFGLSIKHNMNCILEIGHSKELGFCPAMNKTKGAPCGAPINKLKEQVCSYHQETHL 373
           T+ +SF L I H   CILEIG S++LG+CP   K     CG+ IN  +++ C YH+E  +
Sbjct: 302 TSIKSFNLKIAHKFKCILEIGKSRDLGYCPVTKKFSNEKCGSAINLARDRTCEYHRELQM 361

Query: 374 RSVNAKRVELNGNISLRAPTRDGIQ------------QAGYMTRNSHGTKIGLLPDVYAP 421
           R  ++KR++LNG  +L APT+ G Q            Q+        G +    P   + 
Sbjct: 362 RQNSSKRLDLNGGFALGAPTKVGTQPDLFREASGRFKQSARSLPRDQGKRFYTEPSWNSR 421

Query: 422 RAPG--AEQKF---REHFASANAHRAYFDSDYHNPDVLQNLESKRRKIQLSKKDQQINKQ 476
              G  +E+ +    + F S+NA +A+FD ++ NPD+L NL++KRRK+Q SKK +Q++++
Sbjct: 422 HGQGGSSEENYGLKGKFFTSSNAAKAFFDDEFQNPDMLHNLDAKRRKLQDSKKSRQLDRK 481

Query: 477 LSLVLGKNHTQVKDRVSEESLQQREKATKNVMKTGILRHIGFDPTGGRMAAVLYQGD--- 533
           L  +L K+  +     +   +   ++ T+  + TG+++ +GFDPT GR A+V+ + D   
Sbjct: 482 LKRLLSKDEDRATLDKNTAEMAALKRTTETALHTGLIQRLGFDPTHGRAASVMKKRDSER 541

Query: 534 -HGPADTV----REPSISEILANKKRNIDLKPSKEARRKRIQQRNEVYNSIF 580
             G  + V    +E  ++E+L  K+   +L PS+     R Q R EV+   F
Sbjct: 542 GSGANEDVALSQKENMVNELLRWKRDKCNLLPSETQLAHRKQHRREVWRETF 593

>Kwal_47.17560 s47 (455755..457059) [1305 bp, 435 aa] {ON} YAR007C
           (RFA1) - 69 kDa subunit of the heterotrimeric RPA (RF-A)
           single-stranded DNA binding protein, binds URS1 and CAR1
           [contig 207] PARTIAL
          Length = 435

 Score = 35.8 bits (81), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 37/71 (52%), Gaps = 3/71 (4%)

Query: 234 WVTLGAISYKSDVKSTS-QEKPAKYFTIRITDFHYDVQITVFGQKNVEKYYK-LRVGDVI 291
           W     +S+K D+K+ S Q    K F I + D   +++ T F + NV+K+Y+ L+ G V 
Sbjct: 239 WTIKARVSFKGDIKTWSNQRGEGKLFNINLLDTSGEIRATTFSE-NVDKFYQLLQEGKVY 297

Query: 292 AILNPEIYPWK 302
            +    I P K
Sbjct: 298 YVSKARIQPSK 308

>KLTH0E08118g Chr5 (745621..747495) [1875 bp, 624 aa] {ON} similar
           to uniprot|P22336 Saccharomyces cerevisiae YAR007C RFA1
           Subunit of heterotrimeric Replication Factor A (RF-A)
           which is a highly conserved single-stranded DNA binding
           protein involved in DNA replication repair and
           recombination
          Length = 624

 Score = 35.0 bits (79), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 36/71 (50%), Gaps = 3/71 (4%)

Query: 234 WVTLGAISYKSDVKSTS-QEKPAKYFTIRITDFHYDVQITVFGQKNVEKYYK-LRVGDVI 291
           W     +S+K D+K+ S Q    K F + + D   +++ T F + NV+K+Y  L+ G V 
Sbjct: 203 WTIKARVSFKGDIKTWSNQRGEGKLFNVNLLDNSGEIRATTFSE-NVDKFYNLLQEGKVY 261

Query: 292 AILNPEIYPWK 302
            +    I P K
Sbjct: 262 YVSKARIQPSK 272

>SAKL0B10736g Chr2 (925889..930841) [4953 bp, 1650 aa] {ON} highly
           similar to uniprot|P10964 Saccharomyces cerevisiae
           YOR341W RPA190 RNA polymerase I subunit largest subunit
           of RNA polymerase I
          Length = 1650

 Score = 34.7 bits (78), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 46/109 (42%), Gaps = 19/109 (17%)

Query: 366 SYHQETHLRSVNAKRVELNGNISL--RAPTRDGIQQAGYMTRNSHGTKIGLLPDVYAPRA 423
           S H  TH+ +    R   N +I +  R PT   + +A  M     G K+ +LP       
Sbjct: 554 STHNSTHILNKKVYRHIKNRDIVIMNRQPT---LHKASMM-----GHKVRVLP------- 598

Query: 424 PGAEQKFREHFASANAHRAYFDSDYHNPDVLQNLESKRRKIQLSKKDQQ 472
              E+  R H+A+  A+ A FD D  N    QN  ++     L+  D Q
Sbjct: 599 --GEKTLRLHYANTGAYNADFDGDEMNMHFPQNENARAEAFNLANTDSQ 645

>SAKL0H22352g Chr8 (1945309..1947177) [1869 bp, 622 aa] {ON} highly
           similar to uniprot|P22336 Saccharomyces cerevisiae
           YAR007C RFA1 Subunit of heterotrimeric Replication
           Factor A (RF-A) which is a highly conserved
           single-stranded DNA binding protein involved in DNA
           replication repair and recombination
          Length = 622

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 31/70 (44%), Gaps = 1/70 (1%)

Query: 234 WVTLGAISYKSDVKSTS-QEKPAKYFTIRITDFHYDVQITVFGQKNVEKYYKLRVGDVIA 292
           W     +S+K D+K+ S Q    K F +   D   +++ T F    V+ Y  L+ G V  
Sbjct: 200 WTIKARVSFKGDIKTWSNQRGEGKLFNVNFLDTSGEIRATAFNDNAVKFYEILQEGKVYY 259

Query: 293 ILNPEIYPWK 302
           +    I P K
Sbjct: 260 VSKARIQPAK 269

>KLLA0F23243g Chr6 (2165407..2170368) [4962 bp, 1653 aa] {ON} highly
           similar to uniprot|P10964 Saccharomyces cerevisiae
           YOR341W RPA190 RNA polymerase I subunit largest subunit
           of RNA polymerase I
          Length = 1653

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 29/64 (45%), Gaps = 9/64 (14%)

Query: 409 GTKIGLLPDVYAPRAPGAEQKFREHFASANAHRAYFDSDYHNPDVLQNLESKRRKIQLSK 468
           G K+ +LP          E+  R H+A+  A+ A FD D  N    QN  +K   + L+ 
Sbjct: 602 GHKVRVLP---------GEKTLRLHYANTGAYNADFDGDEMNMHFPQNENAKAEALNLAN 652

Query: 469 KDQQ 472
            D Q
Sbjct: 653 TDSQ 656

>ADR374C Chr4 complement(1372609..1377531) [4923 bp, 1640 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR341W
           (RPA190)
          Length = 1640

 Score = 32.3 bits (72), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 45/109 (41%), Gaps = 19/109 (17%)

Query: 366 SYHQETHLRSVNAKRVELNGNISL--RAPTRDGIQQAGYMTRNSHGTKIGLLPDVYAPRA 423
           S H  TH  +    R   N +I +  R PT   + +A  M     G K+ +LP       
Sbjct: 545 STHGSTHTLNKKVYRHIKNRDIVIMNRQPT---LHKASMM-----GHKVRVLP------- 589

Query: 424 PGAEQKFREHFASANAHRAYFDSDYHNPDVLQNLESKRRKIQLSKKDQQ 472
              E+  R H+A+  A+ A FD D  N    QN  ++     L+  D Q
Sbjct: 590 --GEKTLRLHYANTGAYNADFDGDEMNMHFPQNENARSEAFTLANTDSQ 636

>KAFR0J02470 Chr10 (471934..473097) [1164 bp, 387 aa] {ON} 
          Length = 387

 Score = 32.0 bits (71), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 3/40 (7%)

Query: 426 AEQKFREHFASANAHRAYFDSDYHNPDVLQNLESKRRKIQ 465
           A QK+ +      A   +   DYH+PDV+  ++SK + IQ
Sbjct: 218 ASQKYEKQLKDFGADEVF---DYHDPDVISKIKSKYKNIQ 254

>KLTH0D01628g Chr4 complement(157597..162561) [4965 bp, 1654 aa]
           {ON} highly similar to uniprot|P10964 Saccharomyces
           cerevisiae YOR341W RPA190 RNA polymerase I subunit
           largest subunit of RNA polymerase I
          Length = 1654

 Score = 32.3 bits (72), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 45/109 (41%), Gaps = 19/109 (17%)

Query: 366 SYHQETHLRSVNAKRVELNGNISL--RAPTRDGIQQAGYMTRNSHGTKIGLLPDVYAPRA 423
           S H  TH  +    R   N +I +  R PT   + +A  M     G K+ +LP       
Sbjct: 560 SSHSATHSLNKKVYRHIKNRDIVIMNRQPT---LHKASMM-----GHKVRVLP------- 604

Query: 424 PGAEQKFREHFASANAHRAYFDSDYHNPDVLQNLESKRRKIQLSKKDQQ 472
              E+  R H+A+  A+ A FD D  N    QN  ++     L+  D Q
Sbjct: 605 --GEKTLRLHYANTGAYNADFDGDEMNMHFPQNENARAEAFNLANTDSQ 651

>Skud_15.506 Chr15 (901437..906434) [4998 bp, 1665 aa] {ON} YOR341W
           (REAL)
          Length = 1665

 Score = 32.3 bits (72), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 30/64 (46%), Gaps = 9/64 (14%)

Query: 409 GTKIGLLPDVYAPRAPGAEQKFREHFASANAHRAYFDSDYHNPDVLQNLESKRRKIQLSK 468
           G K+ +LP+         E+  R H+A+  A+ A FD D  N    QN  ++   + L+ 
Sbjct: 602 GHKVRVLPN---------EKTLRLHYANTGAYNADFDGDEMNMHFPQNENARAEALNLAN 652

Query: 469 KDQQ 472
            D Q
Sbjct: 653 TDSQ 656

>Suva_8.391 Chr8 (702691..707688) [4998 bp, 1665 aa] {ON} YOR341W
           (REAL)
          Length = 1665

 Score = 32.3 bits (72), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 30/64 (46%), Gaps = 9/64 (14%)

Query: 409 GTKIGLLPDVYAPRAPGAEQKFREHFASANAHRAYFDSDYHNPDVLQNLESKRRKIQLSK 468
           G K+ +LP+         E+  R H+A+  A+ A FD D  N    QN  ++   + L+ 
Sbjct: 602 GHKVRVLPN---------EKTLRLHYANTGAYNADFDGDEMNMHFPQNENARAEALNLAN 652

Query: 469 KDQQ 472
            D Q
Sbjct: 653 TDSQ 656

>YOR341W Chr15 (960987..965981) [4995 bp, 1664 aa] {ON}  RPA190RNA
           polymerase I largest subunit A190
          Length = 1664

 Score = 32.3 bits (72), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 30/64 (46%), Gaps = 9/64 (14%)

Query: 409 GTKIGLLPDVYAPRAPGAEQKFREHFASANAHRAYFDSDYHNPDVLQNLESKRRKIQLSK 468
           G K+ +LP+         E+  R H+A+  A+ A FD D  N    QN  ++   + L+ 
Sbjct: 602 GHKVRVLPN---------EKTLRLHYANTGAYNADFDGDEMNMHFPQNENARAEALNLAN 652

Query: 469 KDQQ 472
            D Q
Sbjct: 653 TDSQ 656

>Smik_15.519 Chr15 (910592..915589) [4998 bp, 1665 aa] {ON} YOR341W
           (REAL)
          Length = 1665

 Score = 32.3 bits (72), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 30/64 (46%), Gaps = 9/64 (14%)

Query: 409 GTKIGLLPDVYAPRAPGAEQKFREHFASANAHRAYFDSDYHNPDVLQNLESKRRKIQLSK 468
           G K+ +LP+         E+  R H+A+  A+ A FD D  N    QN  ++   + L+ 
Sbjct: 602 GHKVRVLPN---------EKTLRLHYANTGAYNADFDGDEMNMHFPQNENARAEALNLAN 652

Query: 469 KDQQ 472
            D Q
Sbjct: 653 TDSQ 656

>Kwal_26.6979 s26 complement(150350..155314) [4965 bp, 1654 aa] {ON}
           YOR341W (RPA190) - RNA polymerase I subunit 190 (alpha)
           [contig 46] FULL
          Length = 1654

 Score = 31.6 bits (70), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 28/64 (43%), Gaps = 9/64 (14%)

Query: 409 GTKIGLLPDVYAPRAPGAEQKFREHFASANAHRAYFDSDYHNPDVLQNLESKRRKIQLSK 468
           G K+ +LP          E+  R H+A+  A+ A FD D  N    QN  ++     L+ 
Sbjct: 596 GHKVRVLP---------GEKTLRLHYANTGAYNADFDGDEMNMHFPQNENARAEAFNLAN 646

Query: 469 KDQQ 472
            D Q
Sbjct: 647 TDSQ 650

>TDEL0H04000 Chr8 (680730..685727) [4998 bp, 1665 aa] {ON} Anc_7.51
           YOR341W
          Length = 1665

 Score = 31.6 bits (70), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 28/64 (43%), Gaps = 9/64 (14%)

Query: 409 GTKIGLLPDVYAPRAPGAEQKFREHFASANAHRAYFDSDYHNPDVLQNLESKRRKIQLSK 468
           G K+ +LP          E+  R H+A+  A+ A FD D  N    QN  ++     L+ 
Sbjct: 601 GHKVRVLP---------GEKTLRLHYANTGAYNADFDGDEMNMHFPQNENARAEAFNLAN 651

Query: 469 KDQQ 472
            D Q
Sbjct: 652 TDSQ 655

>KAFR0K00540 Chr11 complement(114196..119184) [4989 bp, 1662 aa]
           {ON} Anc_7.51 YOR341W
          Length = 1662

 Score = 31.6 bits (70), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 28/64 (43%), Gaps = 9/64 (14%)

Query: 409 GTKIGLLPDVYAPRAPGAEQKFREHFASANAHRAYFDSDYHNPDVLQNLESKRRKIQLSK 468
           G K+ +LP          E+  R H+A+  A+ A FD D  N    QN  ++     L+ 
Sbjct: 602 GHKVRVLP---------GEKTLRLHYANTGAYNADFDGDEMNMHFPQNENARAEAFNLAN 652

Query: 469 KDQQ 472
            D Q
Sbjct: 653 TDSQ 656

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.130    0.368 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 61,918,426
Number of extensions: 2688496
Number of successful extensions: 7391
Number of sequences better than 10.0: 49
Number of HSP's gapped: 7579
Number of HSP's successfully gapped: 50
Length of query: 611
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 495
Effective length of database: 40,180,143
Effective search space: 19889170785
Effective search space used: 19889170785
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 69 (31.2 bits)