Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AFR286W5.702ON1758175884070.0
Ecym_40185.702ON1769177136770.0
SAKL0E14916g5.702ON1779168426940.0
KLLA0A00594g5.702ON1748168223100.0
Kwal_55.196975.702ON1760165321400.0
KLTH0E01056g5.702ON1771163320340.0
TDEL0B021905.702ON1810167419990.0
Suva_11.3315.702ON1898167218660.0
YKR095W (MLP1)5.702ON1875171017930.0
ZYRO0G06600g5.702ON1820127817760.0
Skud_11.3345.702ON1885161817760.0
Smik_11.3585.702ON1878157717680.0
NCAS0A032005.702ON1788163116630.0
CAGL0G02497g5.702ON1780162015640.0
TBLA0E017305.702ON1820154713191e-151
NDAI0E050405.702ON1973134012931e-147
Suva_9.395.702ON1682163310011e-110
Skud_9.195.702ON168014749571e-105
Smik_9.205.702ON168215399321e-101
YIL149C (MLP2)5.702ON167914888964e-97
KAFR0D022205.702ON167415458777e-95
KNAG0L021405.702ON160816487341e-77
KNAG0C065905.702ON165113736966e-73
KAFR0H002105.702ON145411476534e-68
NDAI0F002905.702ON15545365785e-59
Kpol_1043.705.702ON13214765052e-50
TPHA0E002305.702ON12846193253e-29
TPHA0D046105.702ON11832122295e-18
NCAS0G002305.702ON17351812233e-17
Kpol_2001.755.702ON10067071411e-07
NDAI0G056301.295ON1229253980.012
KNAG0G009108.68ON1226250960.025
KNAG0B013103.393ON356151880.15
Ecym_83744.46ON914374890.16
TBLA0E021907.101ON1089165811.4
Kpol_483.114.238ON2546557811.5
ZYRO0D11902g5.501ON44362791.7
Suva_2.5285.414ON944398801.8
YGL086W (MAD1)6.188ON74991791.9
AGL023W8.68ON1222324792.3
YFL008W (SMC1)8.68ON1225143782.9
KAFR0B048402.341ON780118773.9
SAKL0G02024g5.414ON84948764.5
KLTH0D17688g4.364ON680132756.6
KLLA0C12573g2.590ON830113757.1
ABL071W4.364ON66393747.9
NDAI0G005201.450ON57548748.0
KAFR0F030204.46ON824319748.2
TBLA0I032903.525ON407151738.3
CAGL0G09867g7.535ON644117748.5
TBLA0F027507.488ON1414127748.6
TBLA0E044108.259ON1422157748.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR286W
         (1758 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic h...  3242   0.0  
Ecym_4018 Chr4 complement(42777..48086) [5310 bp, 1769 aa] {ON} ...  1420   0.0  
SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} sim...  1042   0.0  
KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {O...   894   0.0  
Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {O...   828   0.0  
KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {...   788   0.0  
TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {...   774   0.0  
Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR09...   723   0.0  
YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}  MLP1Myos...   695   0.0  
ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] ...   688   0.0  
Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR09...   688   0.0  
Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR09...   685   0.0  
NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {...   645   0.0  
CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} simil...   607   0.0  
TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {...   512   e-151
NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_...   502   e-147
Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON} ...   390   e-110
Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON} ...   373   e-105
Smik_9.20 Chr9 complement(40653..45701) [5049 bp, 1682 aa] {ON} ...   363   e-101
YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}  M...   349   4e-97
KAFR0D02220 Chr4 complement(443928..448952) [5025 bp, 1674 aa] {...   342   7e-95
KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5...   287   1e-77
KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON} Anc_...   272   6e-73
KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON...   256   4e-68
NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON...   227   5e-59
Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON} (147...   199   2e-50
TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON...   129   3e-29
TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON} Anc_...    93   5e-18
NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON...    91   3e-17
Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON} (206...    59   1e-07
NDAI0G05630 Chr7 complement(1393671..1397360) [3690 bp, 1229 aa]...    42   0.012
KNAG0G00910 Chr7 (172759..176439) [3681 bp, 1226 aa] {ON} Anc_8....    42   0.025
KNAG0B01310 Chr2 (247976..249046) [1071 bp, 356 aa] {ON} Anc_3.3...    39   0.15 
Ecym_8374 Chr8 complement(751652..754396) [2745 bp, 914 aa] {ON}...    39   0.16 
TBLA0E02190 Chr5 complement(534078..537347) [3270 bp, 1089 aa] {...    36   1.4  
Kpol_483.11 s483 complement(25219..32859) [7641 bp, 2546 aa] {ON...    36   1.5  
ZYRO0D11902g Chr4 complement(1008230..1009561) [1332 bp, 443 aa]...    35   1.7  
Suva_2.528 Chr2 (942956..945790) [2835 bp, 944 aa] {ON} YDR356W ...    35   1.8  
YGL086W Chr7 (347119..349368) [2250 bp, 749 aa] {ON}  MAD1Coiled...    35   1.9  
AGL023W Chr7 (670877..674545) [3669 bp, 1222 aa] {ON} Syntenic h...    35   2.3  
YFL008W Chr6 (119429..123106) [3678 bp, 1225 aa] {ON}  SMC1Subun...    35   2.9  
KAFR0B04840 Chr2 complement(1005497..1007839) [2343 bp, 780 aa] ...    34   3.9  
SAKL0G02024g Chr7 (169807..172356) [2550 bp, 849 aa] {ON} weakly...    34   4.5  
KLTH0D17688g Chr4 (1470627..1472669) [2043 bp, 680 aa] {ON} weak...    33   6.6  
KLLA0C12573g Chr3 (1068765..1071257) [2493 bp, 830 aa] {ON} simi...    33   7.1  
ABL071W Chr2 (267074..269065) [1992 bp, 663 aa] {ON} Syntenic ho...    33   7.9  
NDAI0G00520 Chr7 complement(112068..113795) [1728 bp, 575 aa] {O...    33   8.0  
KAFR0F03020 Chr6 (595158..597632) [2475 bp, 824 aa] {ON} Anc_4.4...    33   8.2  
TBLA0I03290 Chr9 complement(799772..800995) [1224 bp, 407 aa] {O...    33   8.3  
CAGL0G09867g Chr7 complement(942215..944149) [1935 bp, 644 aa] {...    33   8.5  
TBLA0F02750 Chr6 (661437..665681) [4245 bp, 1414 aa] {ON} Anc_7....    33   8.6  
TBLA0E04410 Chr5 (1122005..1126273) [4269 bp, 1422 aa] {ON} Anc_...    33   8.6  

>AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YKR095W (MLP1) and
            YIL149C (MLP2)
          Length = 1758

 Score = 3242 bits (8407), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1649/1758 (93%), Positives = 1649/1758 (93%)

Query: 1    MSDHIESKAESKAEEVDYSRLAARXXXXXXXXXXXXXXXXRTLWGREQAFRQLEAENTRL 60
            MSDHIESKAESKAEEVDYSRLAAR                RTLWGREQAFRQLEAENTRL
Sbjct: 1    MSDHIESKAESKAEEVDYSRLAARLGLEQGQVQQLGEQLVRTLWGREQAFRQLEAENTRL 60

Query: 61   KVSIGAAESACEHGVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPSVPERVQQQLEE 120
            KVSIGAAESACEHGV                                PSVPERVQQQLEE
Sbjct: 61   KVSIGAAESACEHGVEALRERQQQLAAEAGAQQRGQGEAGSAGRAGGPSVPERVQQQLEE 120

Query: 121  TERRVAAGDSARRDLARLLEEKISDLDASQQELERVLGVNKELRRHEMELEFTVQSQRSQ 180
            TERRVAAGDSARRDLARLLEEKISDLDASQQELERVLGVNKELRRHEMELEFTVQSQRSQ
Sbjct: 121  TERRVAAGDSARRDLARLLEEKISDLDASQQELERVLGVNKELRRHEMELEFTVQSQRSQ 180

Query: 181  SLREQAEIQRLQQELALVRSNAEWTTGQLNEKNQQLNSYREKTNGEIQSTQVELNIVKNE 240
            SLREQAEIQRLQQELALVRSNAEWTTGQLNEKNQQLNSYREKTNGEIQSTQVELNIVKNE
Sbjct: 181  SLREQAEIQRLQQELALVRSNAEWTTGQLNEKNQQLNSYREKTNGEIQSTQVELNIVKNE 240

Query: 241  LEVEHANVAALRSKNGELSKQLQDALCETKRLTDSLHSEKQEFAREMALKQRLIELLNGQ 300
            LEVEHANVAALRSKNGELSKQLQDALCETKRLTDSLHSEKQEFAREMALKQRLIELLNGQ
Sbjct: 241  LEVEHANVAALRSKNGELSKQLQDALCETKRLTDSLHSEKQEFAREMALKQRLIELLNGQ 300

Query: 301  VATMKQDLEKAYDVAKNGGMSDSERERLLNDLFDTKKKLELSQANVSRLEDTIKELLETD 360
            VATMKQDLEKAYDVAKNGGMSDSERERLLNDLFDTKKKLELSQANVSRLEDTIKELLETD
Sbjct: 301  VATMKQDLEKAYDVAKNGGMSDSERERLLNDLFDTKKKLELSQANVSRLEDTIKELLETD 360

Query: 361  NVQSGGRNGIEHANVGSPSGGSTISTVYGDLAALRKQLVQERRHKEELQLQVESFVVELE 420
            NVQSGGRNGIEHANVGSPSGGSTISTVYGDLAALRKQLVQERRHKEELQLQVESFVVELE
Sbjct: 361  NVQSGGRNGIEHANVGSPSGGSTISTVYGDLAALRKQLVQERRHKEELQLQVESFVVELE 420

Query: 421  HKIPVLNSFKKRIEELEKQLNGVTLLLEATARERDEKVVQIKQYKNKVGDYETQVGHLVQ 480
            HKIPVLNSFKKRIEELEKQLNGVTLLLEATARERDEKVVQIKQYKNKVGDYETQVGHLVQ
Sbjct: 421  HKIPVLNSFKKRIEELEKQLNGVTLLLEATARERDEKVVQIKQYKNKVGDYETQVGHLVQ 480

Query: 481  QRSDLARQVQCLLIHISVRDDSSGPLTAEEVEFVKKLQSCRDSATGSDTQAIISNRLVEF 540
            QRSDLARQVQCLLIHISVRDDSSGPLTAEEVEFVKKLQSCRDSATGSDTQAIISNRLVEF
Sbjct: 481  QRSDLARQVQCLLIHISVRDDSSGPLTAEEVEFVKKLQSCRDSATGSDTQAIISNRLVEF 540

Query: 541  KSVVELQQKNAELLNAIRQLAQKLEQEEHKTQSKVKSLEQNTVNEAKEAILSLQEHVQML 600
            KSVVELQQKNAELLNAIRQLAQKLEQEEHKTQSKVKSLEQNTVNEAKEAILSLQEHVQML
Sbjct: 541  KSVVELQQKNAELLNAIRQLAQKLEQEEHKTQSKVKSLEQNTVNEAKEAILSLQEHVQML 600

Query: 601  EDQLETVTTERDSFKLLVSEGKNNSLPNPVGAAALQPQEVADGIAHLEARLKAMAEESEQ 660
            EDQLETVTTERDSFKLLVSEGKNNSLPNPVGAAALQPQEVADGIAHLEARLKAMAEESEQ
Sbjct: 601  EDQLETVTTERDSFKLLVSEGKNNSLPNPVGAAALQPQEVADGIAHLEARLKAMAEESEQ 660

Query: 661  HAKMLNEEIKALYKSNSQLAIXXXXXXXXXXXADEKLSLIQKSLELVKGENADLQNRAGS 720
            HAKMLNEEIKALYKSNSQLAI           ADEKLSLIQKSLELVKGENADLQNRAGS
Sbjct: 661  HAKMLNEEIKALYKSNSQLAIELERERSSRELADEKLSLIQKSLELVKGENADLQNRAGS 720

Query: 721  LQALLLEQDTRRQSTIEEFVSAKSELFSISSQLTILQSERDFLRKVEADLKKENESLNKD 780
            LQALLLEQDTRRQSTIEEFVSAKSELFSISSQLTILQSERDFLRKVEADLKKENESLNKD
Sbjct: 721  LQALLLEQDTRRQSTIEEFVSAKSELFSISSQLTILQSERDFLRKVEADLKKENESLNKD 780

Query: 781  NNDSQLLILQLKTAQKERDSLIEETRKRYETRIEELDGELSATKQQLERKQREYDELSSS 840
            NNDSQLLILQLKTAQKERDSLIEETRKRYETRIEELDGELSATKQQLERKQREYDELSSS
Sbjct: 781  NNDSQLLILQLKTAQKERDSLIEETRKRYETRIEELDGELSATKQQLERKQREYDELSSS 840

Query: 841  SSTQCKWFQSKLDSLKEELGSSKLALKAKTSELDALKARLNSSTSKLEPASMDHQQSSLV 900
            SSTQCKWFQSKLDSLKEELGSSKLALKAKTSELDALKARLNSSTSKLEPASMDHQQSSLV
Sbjct: 841  SSTQCKWFQSKLDSLKEELGSSKLALKAKTSELDALKARLNSSTSKLEPASMDHQQSSLV 900

Query: 901  LESDHASRVQSLSKDLDEANRKLSSAYSEIERYKAASNATERPSLSYNAVQDNKDGSKQA 960
            LESDHASRVQSLSKDLDEANRKLSSAYSEIERYKAASNATERPSLSYNAVQDNKDGSKQA
Sbjct: 901  LESDHASRVQSLSKDLDEANRKLSSAYSEIERYKAASNATERPSLSYNAVQDNKDGSKQA 960

Query: 961  AISLEAELTKLNSDIAMANDRIKVLEDELNRREATYSTERSELQEKINALVTDKQRIEEA 1020
            AISLEAELTKLNSDIAMANDRIKVLEDELNRREATYSTERSELQEKINALVTDKQRIEEA
Sbjct: 961  AISLEAELTKLNSDIAMANDRIKVLEDELNRREATYSTERSELQEKINALVTDKQRIEEA 1020

Query: 1021 KADYQQKITQLQTDLEKQISSTNEAETKYQTALQKQAEISENIESLRKSSESYKSEIAKF 1080
            KADYQQKITQLQTDLEKQISSTNEAETKYQTALQKQAEISENIESLRKSSESYKSEIAKF
Sbjct: 1021 KADYQQKITQLQTDLEKQISSTNEAETKYQTALQKQAEISENIESLRKSSESYKSEIAKF 1080

Query: 1081 KSAAEEARKVLERNEQTWDQQKADIEANLDLAHQRIEELSTQNRLLYDQIXXXXXXXXXX 1140
            KSAAEEARKVLERNEQTWDQQKADIEANLDLAHQRIEELSTQNRLLYDQI          
Sbjct: 1081 KSAAEEARKVLERNEQTWDQQKADIEANLDLAHQRIEELSTQNRLLYDQIELLSRSPSSS 1140

Query: 1141 XXXDTKISSDARELIVTLRRERDILETKIDVSKREEKMLRQRLELTKSELDNLRAQLSES 1200
               DTKISSDARELIVTLRRERDILETKIDVSKREEKMLRQRLELTKSELDNLRAQLSES
Sbjct: 1141 LEPDTKISSDARELIVTLRRERDILETKIDVSKREEKMLRQRLELTKSELDNLRAQLSES 1200

Query: 1201 KGLVTEGTDSSQNQEELFEKLNQLNLLREHNMSLRNESEKVSEHNEFLQNEILSLQEKVQ 1260
            KGLVTEGTDSSQNQEELFEKLNQLNLLREHNMSLRNESEKVSEHNEFLQNEILSLQEKVQ
Sbjct: 1201 KGLVTEGTDSSQNQEELFEKLNQLNLLREHNMSLRNESEKVSEHNEFLQNEILSLQEKVQ 1260

Query: 1261 PMEEQIKSLTATXXXXXXXXXXXXXXSDRWKQRSQDILHKYERIDPEEYRKLASEIEVLK 1320
            PMEEQIKSLTAT              SDRWKQRSQDILHKYERIDPEEYRKLASEIEVLK
Sbjct: 1261 PMEEQIKSLTATLTEKEQKLALLKEESDRWKQRSQDILHKYERIDPEEYRKLASEIEVLK 1320

Query: 1321 AELERKSAESIDSQERFRKLRKQANERLDEFKAAKAKVESELELALSGKSQLEAKLSEAR 1380
            AELERKSAESIDSQERFRKLRKQANERLDEFKAAKAKVESELELALSGKSQLEAKLSEAR
Sbjct: 1321 AELERKSAESIDSQERFRKLRKQANERLDEFKAAKAKVESELELALSGKSQLEAKLSEAR 1380

Query: 1381 EKITSLETQLTERPASEDDNPVSHELEETKTKLQDAENTINMLKSEWSISEESFKKQLDE 1440
            EKITSLETQLTERPASEDDNPVSHELEETKTKLQDAENTINMLKSEWSISEESFKKQLDE
Sbjct: 1381 EKITSLETQLTERPASEDDNPVSHELEETKTKLQDAENTINMLKSEWSISEESFKKQLDE 1440

Query: 1441 LNKQLETIQKNXXXXXXXXXXXXYHEQPTAVLEDFKKQVEEERRTLIESHQQELTARLEA 1500
            LNKQLETIQKN            YHEQPTAVLEDFKKQVEEERRTLIESHQQELTARLEA
Sbjct: 1441 LNKQLETIQKNSAPSSGHSDPSSYHEQPTAVLEDFKKQVEEERRTLIESHQQELTARLEA 1500

Query: 1501 SRKNFXXXXXXXXXXXRDSLTNVSVEAASQNLEALKKKWEEEYEQQTLQRIREAEEALKK 1560
            SRKNF           RDSLTNVSVEAASQNLEALKKKWEEEYEQQTLQRIREAEEALKK
Sbjct: 1501 SRKNFLAEKEKALEELRDSLTNVSVEAASQNLEALKKKWEEEYEQQTLQRIREAEEALKK 1560

Query: 1561 RIRLPSEERINQVIERKQKALEQEFTTKVNATALALLKENPDSIASDKADLIKDHQKEIV 1620
            RIRLPSEERINQVIERKQKALEQEFTTKVNATALALLKENPDSIASDKADLIKDHQKEIV
Sbjct: 1561 RIRLPSEERINQVIERKQKALEQEFTTKVNATALALLKENPDSIASDKADLIKDHQKEIV 1620

Query: 1621 QLKKDLADKFEGQLVQVKKKAFEEGRQQGIMKVKLLESKISKLESQAKAPLGTNVPTKIP 1680
            QLKKDLADKFEGQLVQVKKKAFEEGRQQGIMKVKLLESKISKLESQAKAPLGTNVPTKIP
Sbjct: 1621 QLKKDLADKFEGQLVQVKKKAFEEGRQQGIMKVKLLESKISKLESQAKAPLGTNVPTKIP 1680

Query: 1681 LENTQPLAQQVPVKPSPFQLAYAQATFGNVPFLFNKNSEQKKVEHQDDSDSHQNTGNGNK 1740
            LENTQPLAQQVPVKPSPFQLAYAQATFGNVPFLFNKNSEQKKVEHQDDSDSHQNTGNGNK
Sbjct: 1681 LENTQPLAQQVPVKPSPFQLAYAQATFGNVPFLFNKNSEQKKVEHQDDSDSHQNTGNGNK 1740

Query: 1741 RQSEDRAEESPGKKLREE 1758
            RQSEDRAEESPGKKLREE
Sbjct: 1741 RQSEDRAEESPGKKLREE 1758

>Ecym_4018 Chr4 complement(42777..48086) [5310 bp, 1769 aa] {ON}
            similar to Ashbya gossypii AFR286W
          Length = 1769

 Score = 1420 bits (3677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 829/1771 (46%), Positives = 1185/1771 (66%), Gaps = 42/1771 (2%)

Query: 16   VDYSRLAARXXXXXXXXXXXXXXXXRTLWGREQAFRQLEAENTRLKVSIGAAESACEHGV 75
            VDYS++AA                    + +   F +++A+N RL +SI   +   E  +
Sbjct: 13   VDYSKVAAFLEVDEAKVQELDESMVTVFFLKANEFSKMKADNMRLSISIDGLKCNFEQKI 72

Query: 76   XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPSVPE------RVQQQLEETERRVAAGD 129
                                                +      +++ Q+EE ++ +    
Sbjct: 73   NTFKEQVEKLLSDVASRQQEKQQTEDEKLKLMNEKAQLSMEVLKLRSQVEEAKQGMEIIA 132

Query: 130  SARRDLARLLEEKISDLDASQQELERVLGVNKELRRHEMELEFTVQSQRSQSLREQAEIQ 189
            SA++D+ +LLEEKISDL AS++E +R+L  NKELR+  ++LEF +Q  +SQ LRE++EIQ
Sbjct: 133  SAKQDVTKLLEEKISDLAASKEESDRLLAANKELRKSSIDLEFIIQGYKSQELREKSEIQ 192

Query: 190  RLQQELALVRSNAEWTTGQLNEKNQQLNSYREKTNGEIQSTQVELNIVKNELEVEHANVA 249
            RL QEL LV+SNA+W + +L  KN+QLNS+REKTN E+Q+   ++N +K++LE   AN +
Sbjct: 193  RLHQELNLVKSNADWLSKELESKNEQLNSFREKTNSELQNGYEQVNSLKSQLEFARANNS 252

Query: 250  ALRSKNGELSKQLQDALCETKRLTDSLHSEKQEFAREMALKQRLIELLNGQVATMKQDLE 309
             L++K  ELS QLQ+ L ETK+L D L++EK+EF REM+LKQRLI+LL  QV++MK DLE
Sbjct: 253  TLKAKTAELSNQLQEKLVETKKLADVLNTEKEEFTREMSLKQRLIDLLESQVSSMKSDLE 312

Query: 310  KAYDVAKNGGMSDSERERLLNDLFDTKKKLELSQANVSRLEDTIKELLETDNVQSGGRNG 369
             AY  A   GMS  E+++LL++L DTKK LE +QA   +LE T+ ELL  +     G+NG
Sbjct: 313  NAYQSANQNGMSTPEKDQLLDELIDTKKNLEATQAENIKLEATVNELLSVN-----GKNG 367

Query: 370  IE--HANVGSPSGGSTISTV---YGDLAALRKQLVQERRHKEELQLQVESFVVELEHKIP 424
            +   ++NV   S  S ISTV    GD+  L+KQLVQERR KEELQ QVESFVVELEHKIP
Sbjct: 368  VAVINSNVSDTSLDSKISTVPKLCGDIGILKKQLVQERRQKEELQNQVESFVVELEHKIP 427

Query: 425  VLNSFKKRIEELEKQLNGVTLLLEATARERDEKVVQIKQYKNKVGDYETQVGHLVQQRSD 484
            +LNSFK+R + LE++LN VTLLLE+TA++RD+K +++ QYKNK+ +YE+QV  L+ QRSD
Sbjct: 428  ILNSFKERTDMLERELNDVTLLLESTAKQRDQKTIELNQYKNKINNYESQVCSLIVQRSD 487

Query: 485  LARQVQCLLIHISVRDDSSGPLTAEEVEFVKKLQSCRDSATGSDTQAIISNRLVEFKSVV 544
            LA QVQ LL+ +SVRDD+ GPLT +EVEFVK++ S  D A  SDTQ IIS RLV+FKSV+
Sbjct: 488  LAHQVQYLLMQLSVRDDAHGPLTEQEVEFVKRIISSEDEAPKSDTQGIISERLVQFKSVI 547

Query: 545  ELQQKNAELLNAIRQLAQKLEQEEHKTQSKVKSLEQNTVNEAKEAILSLQEHVQMLEDQL 604
            ELQ KNAELLN IRQLA KLE EE K++ ++KS+E  TV EAKEAILSLQEHVQ LEDQL
Sbjct: 548  ELQSKNAELLNTIRQLADKLEDEEKKSRFRLKSVETQTVKEAKEAILSLQEHVQRLEDQL 607

Query: 605  ETVTTERDSFKLLVSEGK-NNSLPNPVGAAALQPQEVADGIAHLEARLKAMAEESEQHAK 663
            + V+ ERD+FKL  S  K  +S P    ++  Q +++ + I  LE RLK +AE+S+ + K
Sbjct: 608  KIVSKERDAFKLANSANKQGDSAP----SSTYQSKKLDEHIMELEKRLKNLAEQSQDNIK 663

Query: 664  MLNEEIKALYKSNSQLAIXXXXXXXXXXXADEKLSLIQKSLELVKGENADLQNRAGSLQA 723
            +LN+EIKALYK+ S++ +           A+E+L LIQ +L L K EN +L  R+  LQ 
Sbjct: 664  LLNDEIKALYKAKSEVTVILEQERSSKVLAEERLKLIQSTLSLTKEENLELHKRSDDLQR 723

Query: 724  LLLEQDTRRQSTIEEFVSAKSELFSISSQLTILQSERDFLRKVEADLKKENESLNKDNND 783
            +LL+QD + QSTI+E ++ KS+L +++S+L IL SERDFLRK+EA+LK ENE+L K+N  
Sbjct: 724  VLLKQDEKTQSTIDEIIATKSQLSNLTSKLAILTSERDFLRKIEAELKNENEALTKENTT 783

Query: 784  SQLLILQLKTAQKERDSLIEETRKRYETRIEELDGELSATKQQLERKQREYDELSSSSST 843
            S++L+ QL+T Q+ERD L+EE +  Y   IE+L+ +L  T++ L R+ REY+E   S ++
Sbjct: 784  SKILVSQLQTLQRERDILLEEAQTNYRKNIEKLESDLHETREHLVRRTREYEEQRVSDTS 843

Query: 844  QCKWFQSKLDSLKEELGSSKLALKAKTSELDALKARLNSSTSKLEPASMDHQQSSLVLES 903
            Q KWFQ+K+DSL E+L +++  L+ KT+ ++ L+    S T+KLE A +  Q  S++  +
Sbjct: 844  QYKWFQAKVDSLNEQLDNARKTLQEKTNSIETLQLHAKSLTAKLEEAELRTQSYSVLANA 903

Query: 904  DHAS-RVQSLSKDLDEANRKLSSAYSEIERYKAASNATERPSLSYN-AVQDNKDGSKQAA 961
            D  + ++++L K+L++AN  L+ AYS+IE+YK+ +  +E+ ++  + A+++++   ++  
Sbjct: 904  DDITDKIETLRKNLEKANINLADAYSQIEQYKSMAKVSEQSAVEISKALEESQANYRKNI 963

Query: 962  ISLEAELTKLNSDIAMANDRIKVLEDELNRREATYSTERSELQEKINALVTDKQRIEEAK 1021
              LE E   L   IA+ ND+IK L  EL+ +++   +E+SEL +K++ L   ++ ++E K
Sbjct: 964  ALLEQERKSLTDQIALLNDQIKDLNSELDHQKSQNQSEKSELIKKLSILQGSQRSLDELK 1023

Query: 1022 ADYQQKITQLQTDLEKQISSTNEAETKYQTALQKQAEISENIESLRKSSESYKSEIAKFK 1081
            ++Y++KI++LQ DL +Q S  N+A+  Y+  LQK A++++ I  LR+ S+ YKSE+  FK
Sbjct: 1024 SEYEEKISKLQEDLTQQASYANQAQKNYEQELQKHADVTKTISLLREESQKYKSEMEGFK 1083

Query: 1082 SAAEEARKVLERNEQTWDQQKADIEANLDLAHQRIEELSTQNRLLYDQIXXXXXXXXXXX 1141
             +A EA+  LERNEQ+W QQ AD+E+ L LA QR EEL+TQNRLLYDQ+           
Sbjct: 1084 RSASEAKSALERNEQSWCQQVADLESQLSLAQQRTEELNTQNRLLYDQVELLSKATSSDS 1143

Query: 1142 XXDTKISSDARELIVTLRRERDILETKIDVSKREEKMLRQRLELTKSELDNLRAQLSESK 1201
                 +S+++RELI+TLRRERDILETK+DVS REEK+LRQRL L K+EL+N+R + S+++
Sbjct: 1144 EAAASMSAESRELIMTLRRERDILETKLDVSIREEKILRQRLGLAKTELENVRLEFSKTQ 1203

Query: 1202 GLVTEGTDSSQNQEELFEKLNQLNLLREHNMSLRNESEKVSEHNEFLQNEILSLQEKVQP 1261
                +   + ++QE++ EKLNQLNLLRE N++LRNES+K  E ++  QNEI  LQE++QP
Sbjct: 1204 ATAPDSIFARESQEQIMEKLNQLNLLRESNVTLRNESKKYLEQSQHFQNEIAKLQEQLQP 1263

Query: 1262 MEEQIKSLTATXXXXXXXXXXXXXXSDRWKQRSQDILHKYERIDPEEYRKLASEIEVLKA 1321
            +E Q+KSLT T              S RWKQRSQDILHKYERIDP E++KLA E+  LK 
Sbjct: 1264 LESQLKSLTITISERDQQISLLKEESSRWKQRSQDILHKYERIDPVEHQKLADEVTELKN 1323

Query: 1322 ELERKSAESIDSQERFRKLRKQANERLDEFKAAKAKVESELELALSGKSQLEAKLSEARE 1381
            ELE+KS E+++SQERFRKLRKQANERLDEFKAAKAKVESE E     K+QLEA+L++  +
Sbjct: 1324 ELEKKSLENLESQERFRKLRKQANERLDEFKAAKAKVESEFEAVSIAKAQLEAELAQTLD 1383

Query: 1382 KITSLETQLTERPASEDD--NPVSHELEETKTKLQDAENTINMLKSEWSISEESFKKQLD 1439
            K++ LE++L+     ++   + +  ELEE +    +A   +  +K+E + SE+  K Q+ 
Sbjct: 1384 KVSELESKLSSSANEKNGEADSLKEELEELRANFIEANEAVADIKAEAASSEKDLKNQIQ 1443

Query: 1440 ELNKQLETIQKNXXXXXXXXXXXXYHEQPTAVLEDFKKQVEEERRTLIESHQQELTARLE 1499
            EL ++++T++                     ++E+ KK+ EEE++ LI+   +EL  +LE
Sbjct: 1444 ELTEKIKTLESEIEHSELEAKNSNDSPDFAPIVENMKKKFEEEKQVLIQEKDEELRMKLE 1503

Query: 1500 ASRKNFXXXXXXXXXXXRDSLTNVSVEAASQNLEALKKKWEEEYEQQTLQRIREAEEALK 1559
              +K +           + SL   +  A   + E LK K E EYE++TL+RIREAEEALK
Sbjct: 1504 EIQKQYEEERERELSELKASLVESTPNAPLIDEETLKSKLEAEYEKKTLERIREAEEALK 1563

Query: 1560 KRIRLPSEERINQVIERKQKALEQEFTTKVNATALALLKENPDSIASDKADLIKDHQKEI 1619
            KRIRLPSEERINQVIER+Q+AL+QEF  +V A AL L KENP+S   D A LIK+HQ+E+
Sbjct: 1564 KRIRLPSEERINQVIERRQRALDQEFELRVRARALELFKENPESFVGDTAKLIKEHQEEM 1623

Query: 1620 VQLKKDLADKFEGQLVQVKKKAFEEGRQQGIMKVKLLESKISKLESQA-KAPLGTNVPTK 1678
             +L+     KF+ QL  V+KKAFEEG+QQ +MKVKLLESKI+KLE Q  K  L  +VP+K
Sbjct: 1624 DKLEA----KFDEQLALVRKKAFEEGKQQLVMKVKLLESKIAKLEGQPNKINLNNSVPSK 1679

Query: 1679 IPLE---NTQPL-AQQVPVKPSPFQLAYAQATFGNVPFLFNKNS---EQKKVEHQDDSDS 1731
            IP++   N+ P  AQ + +KPSPFQ+A+ +A   N  F   K S    ++ + +  D+ +
Sbjct: 1680 IPIDNNNNSSPQGAQPIAIKPSPFQVAFGKA-MENTSFGSFKGSLLDSKQFIANTADTST 1738

Query: 1732 HQNTG----NGNKRQSEDRAEESPGKKLREE 1758
               TG    N NKRQSED   +SP K+ +++
Sbjct: 1739 STLTGNVGTNTNKRQSEDELAQSPEKRPKDD 1769

>SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} similar
            to uniprot|Q02455 Saccharomyces cerevisiae YKR095W MLP1
            Myosin-like protein associated with the nuclear envelope
            connects the nuclear pore complex with the nuclear
            interior involved in the Tel1p pathway that controls
            telomere length involved in the retention of unspliced
            mRNAs in the nucleus
          Length = 1779

 Score = 1042 bits (2694), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 663/1684 (39%), Positives = 1056/1684 (62%), Gaps = 67/1684 (3%)

Query: 114  VQQQLEETERRVAAGDSARRDLARLLEEKISDLDASQQELERVLGVNKELRRHEMELEFT 173
            ++ QL E +++     S+++D+ +LL EKI DL+ASQ E +++L   K LR+  +ELE  
Sbjct: 120  LKSQLTELKQQNEIFRSSKQDVVQLLNEKIGDLEASQDEAKQLLQNTKTLRKQVLELENE 179

Query: 174  VQSQRSQSLREQAEIQRLQQELALVRSNAEWTTGQLNEKNQQLNSYREKTNGEIQSTQVE 233
            VQ+ +S  LR +AE+QRL QE+ L++SN +W   +L  K+++  SYR++ N E+Q+   E
Sbjct: 180  VQTFKSNDLRGKAEMQRLTQEMNLLKSNNQWLEKELASKSEEFGSYRQRVNSELQTALSE 239

Query: 234  LNIVKNELEVEHANVAALRSKNGELSKQLQDALCETKRLTDSLHSEKQEFAREMALKQRL 293
            LN +++ELE+E ++   L+S+  +LS+QLQD + E K L DS   EKQEF REM LKQRL
Sbjct: 240  LNSIRSELEIERSSSQTLKSRANDLSQQLQDKMTELKSLRDSSSIEKQEFTREMTLKQRL 299

Query: 294  IELLNGQVATMKQDLEKAYDVA-KNGGMSDSERERLLNDLFDTKKKLELSQANVSRLEDT 352
            I+LL  Q+ + K +LE A + +  N    D+ERE+++ +L +TKKKLE+S++   +LE+T
Sbjct: 300  IDLLEKQIESFKTELESARNKSVSNSDHVDAEREKIIEELIETKKKLEISESKAVKLEET 359

Query: 353  IKELLETDNVQSGGRNGIEHANVGSPSGGSTISTVYGDLAALRKQLVQERRHKEELQLQV 412
            + ELL TD    G R     + V   S  S +  ++GD+  L+K+L+QERR KE+LQ QV
Sbjct: 360  VDELLSTD----GERGAGNTSKVSLDSKNSIVPKLHGDIGLLKKRLIQERRQKEQLQYQV 415

Query: 413  ESFVVELEHKIPVLNSFKKRIEELEKQLNGVTLLLEATARERDEKVVQIKQYKNKVGDYE 472
            E+FV+ELEHK+PVLNSFK+R E LEK+L+ V L+LEAT+++++EK  ++   K+K+ DYE
Sbjct: 416  EAFVLELEHKVPVLNSFKERTEMLEKELSDVALMLEATSKDKEEKEHELTSVKSKIADYE 475

Query: 473  TQVGHLVQQRSDLARQVQCLLIHISVRDDSSGPLTAEEVEFVKKLQSCRDSATGSDTQAI 532
            TQ+  LV+QRSDLA QVQ LLI +SVR+DS+GPLT EE  F+KK+ +  +S    D Q I
Sbjct: 476  TQIHSLVRQRSDLAHQVQHLLIQVSVRNDSNGPLTPEETNFIKKIINSSESPVEQDAQRI 535

Query: 533  ISNRLVEFKSVVELQQKNAELLNAIRQLAQKLEQEEHKTQSKVKSLEQNTVNEAKEAILS 592
            IS RLV F+S+VELQ+KN ELLN+IR LA KLE EE +++SK K +E  TV EAKEAIL+
Sbjct: 536  ISERLVRFESMVELQEKNMELLNSIRNLADKLEAEEKESKSKSKEVESETVKEAKEAILT 595

Query: 593  LQEHVQMLEDQLETVTTERDSFKLLVSEGKNNSLPNPVGAAALQPQEVA-DGIAHLEARL 651
            LQE+ + LE QLE +  ERD+FK+L S+   ++ P+ V ++  +   +A + I  LE  L
Sbjct: 596  LQEYNKSLESQLEIIAKERDAFKILASDKGTSNGPSNVNSSENRHLVLAEEKIKELENHL 655

Query: 652  KAMAEESEQHAKMLNEEIKALYKSNSQLAIXXXXXXXXXXXADEKLSLIQKSLELVKGEN 711
             ++ EES ++ K+LNEEI +LY++ +  ++           A+++  LI  +LE+ K EN
Sbjct: 656  SSLTEESAKNIKLLNEEIHSLYRAQADTSVNLEKERSSRILAEDRSKLISNTLEMTKMEN 715

Query: 712  ADLQNRAGSLQALLLEQDTRRQSTIEEFVSAKSELFSISSQLTILQSERDFLRKVEADLK 771
             +L+ R  SLQ  +L+QD++ Q TIE  +S KS+L ++ SQL   QSERD LR ++ +LK
Sbjct: 716  DELRKRFHSLQENILKQDSKTQQTIESLISCKSQLSALQSQLNNSQSERDLLRSIQENLK 775

Query: 772  KENESLNKDNNDSQLLILQLKTAQKERDSLIEETRKRYETRIEELDGELSATKQQLERKQ 831
            KENESL+++ N+ ++LI QL+T Q ER+SL+EET+K ++ +  +L+ ELS T ++L+ K 
Sbjct: 776  KENESLSEERNNMRILITQLQTLQTERESLLEETQKNFQGKTNKLETELSDTLEKLDAKS 835

Query: 832  REYDELSSSSSTQCKWFQSKLDSLKEELGSSKLALKAKTSELDALKARLNSSTSKLEPAS 891
            +E  +  S+  +Q KW+Q K D L EEL +S+  L +K +++  L+ ++ S  +KLE + 
Sbjct: 836  KEISDYISTKDSQEKWYQEKFDRLNEELNNSREKLSSKLTDIQHLELKVESLNNKLEESE 895

Query: 892  MDHQQSSLVLESDHA-SRVQSLSKDLDEANRKLSSAYSEIERYKAASNATERPSLSYNAV 950
               Q  + +  S+   S+ ++L ++L++   KL+ AYS++E+YK+ ++++E    S  A+
Sbjct: 896  ARIQAFNALNYSESVESQTETLRQELEKTRIKLADAYSQVEQYKSMADSSEE---SATAI 952

Query: 951  QDNKDGSKQAAISLEAELTK----LNSDIAMANDRIKVLEDELNRREATYSTERSELQEK 1006
            +D  + SK         LTK        + +  D+I  L +ELN +++ + ++ S+    
Sbjct: 953  KDALEQSKAEYTEKIETLTKERDMFKDQVPILKDQISNLNNELNHQKSQFESQISDYTRN 1012

Query: 1007 INALVTDKQRIEEAKADYQQKITQLQTDLEKQISSTNEAETKYQTALQKQAEISENIESL 1066
            +  L   +  ++  KA+Y+QKI+++Q DL +Q S  N A+  Y+  LQK A++S+ I  L
Sbjct: 1013 LEDLKAKQSELDNMKAEYEQKISKIQEDLNQQTSYANTAQKNYEQELQKHADVSKKISLL 1072

Query: 1067 RKSSESYKSEIAKFKSAAEEARKVLERNEQTWDQQKADIEANLDLAHQRIEELSTQNRLL 1126
            R  ++ YKSE    ++AAE A+K LE++E +W++Q +D E  L LAHQRIE+L+ Q+++L
Sbjct: 1073 RAEAQKYKSETETLRNAAENAKKALEQSELSWEKQSSDYEDELRLAHQRIEDLNAQSKIL 1132

Query: 1127 YDQIXXXXXXXXXXXXXDTKISSDARELIVTLRRERDILETKIDVSKREEKMLRQRLELT 1186
            YDQI                IS++ R L+ +LRRE+DILETK++VS REEK+LRQ+L+L 
Sbjct: 1133 YDQIDFLSKGKPTSSEDLMPISTETRNLLTSLRREKDILETKLEVSTREEKVLRQKLKLI 1192

Query: 1187 KSELDNLRAQLSESKGLVTEGTDSSQNQEELFEKLNQLNLLREHNMSLRNESEKVSEHNE 1246
            +S+L+  R +LS+ +   +  + + ++QEE+  +LNQLNLLRE N++LRNE++K  E + 
Sbjct: 1193 ESDLEGSRIELSKLQRAASGNSATLKDQEEIMTQLNQLNLLRESNITLRNEAQKNGERSR 1252

Query: 1247 FLQNEILSLQEKVQPMEEQIKSLTATXXXXXXXXXXXXXXSDRWKQRSQDILHKYERIDP 1306
             L+ E+ +L  KVQP+E ++  L  +              ++RWKQRSQDILHKYERIDP
Sbjct: 1253 ELKAELDALYGKVQPLESKVTLLQNSVREKDLQISLKNEEAERWKQRSQDILHKYERIDP 1312

Query: 1307 EEYRKLASEIEVLKAELERKSAESIDSQERFRKLRKQANERLDEFKAAKAKVESELELAL 1366
            EE++KLA ++  L+ E++ KS E+ +   RF++L++QA+E+L+  K A++ + S+L    
Sbjct: 1313 EEHQKLADKVSELQQEIKSKSDENEELDTRFKRLKQQAHEKLNAAKTAQSTLTSQLNDLK 1372

Query: 1367 SGKSQLEAKLSEAREKITSLETQLT--ERPASEDDNPVSHELEETKTKLQDAENTINMLK 1424
            + K +LE  L   +E++ +LE+++T  E+  S + N +  +LE ++ KL + EN +  + 
Sbjct: 1373 ATKEKLENDLGSQKEEVKNLESKITDIEKNKSSEKNDLQEQLENSQAKLLETENKLEQVT 1432

Query: 1425 SEWSISEESFKKQLDELNKQLETIQKNXXXXXXXXXXXXYH-----EQPTAVLEDFKKQV 1479
            S  ++ E+   ++++ L  +++ ++++                   E  + ++E+ K + 
Sbjct: 1433 SSSALLEKELNERIESLMNKIKLLEEDLEKAKTESPNDGSQSSELVENTSKIVENLKIEF 1492

Query: 1480 EEERRTLIESHQQELTARLEASRKNFXXXXXXXXXXXRDSLTNVSVEAASQNLEALKKKW 1539
            EEE+  +I   + EL  + E  + +            R+ L    ++    N++ +KKKW
Sbjct: 1493 EEEKAKMISDKESELREQFEEEKASI---LEAKEQELREQLATQKLDPPV-NIDEIKKKW 1548

Query: 1540 EEEYEQQTLQRIREAEEALKKRIRLPSEERINQVIERKQKALEQEFTTKVNATALALLKE 1599
            EEEYEQ+T QRIRE+ E LKKRIRLP+EE+IN+++E+K+  LE EF   V   A   + +
Sbjct: 1549 EEEYEQKTSQRIRESNEQLKKRIRLPTEEKINKIVEKKRLELEAEFEANVQKKA-EEIAK 1607

Query: 1600 NPDSIASDKADLIKDHQKEIVQLKKDLADKFEGQLVQVKKKAFEEGRQQGIMKVKLLESK 1659
            +  +  S+  ++++ H++++  LK+++  KF+  + Q+KK+AFEEG+QQ  MK   LE K
Sbjct: 1608 SKSASNSNSTEVLEKHKQDLENLKQEMQKKFDEDIAQIKKRAFEEGKQQASMKSTFLEKK 1667

Query: 1660 ISKLESQAKA-----PLGTNV--------PTKIPLENTQPL----AQQVPVKPSPFQLAY 1702
            I+KLE+Q KA     P+  N         PT   ++   P+    A  +P KP PF  A+
Sbjct: 1668 IAKLETQIKAHDSAIPINDNSSATPAESGPTTQDVKQLTPILNNQAAILPGKPLPFNPAH 1727

Query: 1703 AQATFGNVPFLFNKNSEQKKVEHQDDSDSHQN---------TGNGNKRQSEDRAEESPGK 1753
                FG +PF             Q  S+S QN         T N  KR SE+    SP K
Sbjct: 1728 --FAFG-MPF------------GQTTSNSFQNPFNSQPPEQTPNSPKRPSEEPVGGSPEK 1772

Query: 1754 KLRE 1757
            K +E
Sbjct: 1773 KPKE 1776

>KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {ON}
            similar to uniprot|Q02455 Saccharomyces cerevisiae
            YKR095W MLP1 Myosin-like protein associated with the
            nuclear envelope connects the nuclear pore complex with
            the nuclear interior involved in the Tel1p pathway that
            controls telomere length involved in the retention of
            unspliced mRNAs in the nucleus
          Length = 1748

 Score =  894 bits (2310), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 604/1682 (35%), Positives = 989/1682 (58%), Gaps = 119/1682 (7%)

Query: 128  GDSARRDLARLLEEKISDLDASQQELERVLGVNKELRRHEMELEFTVQSQRSQSLREQAE 187
             D++++D+A  L EKI +L +++ +L    G NKELR+  +  E  +Q+Q++  LR ++E
Sbjct: 123  ADASKQDIAESLNEKIEELSSTKAKLNEAQGANKELRQKVVNTETELQTQQALELRSKSE 182

Query: 188  IQRLQQELALVRSNAEWTTGQLNEKNQQLNSYREKTNGEIQSTQVELNIVKNELEVEHAN 247
            I R++QE+ L+R N +W T QLN K  QLN +RE T  E+Q +Q++++ +++ELE+   +
Sbjct: 183  ILRMEQEITLLRENNDWLTNQLNTKTVQLNEFRESTISELQDSQLKVSNMESELEIARTS 242

Query: 248  VAALRSKNGELSKQLQDALCETKRLTDSLHSEKQEFAREMALKQRLIELLNGQVATMKQD 307
               L+     L +QL+  L E K + D  +  KQE  +EM+LKQR+I+ L   + ++K++
Sbjct: 243  NQKLKQSVHSLHEQLEQKLSENKEIKDEYNFSKQELTKEMSLKQRMIDALEKHMESLKKE 302

Query: 308  LEKAYDVAKNGGMSDSERERLLNDLFDTKKKLELSQANVSRLEDTIKELLETDNVQSGGR 367
            ++   +   +   ++ ER+ L+ +L   K +L+ S++N  +L++TI EL  T N++    
Sbjct: 303  MDATKNNMDSSYFTEKERDELIEELNAVKYRLDASESNCIKLKETIDEL--TSNIK---- 356

Query: 368  NGIEHANVGSPSGGS-----TISTVYGDLAALRKQLVQERRHKEELQLQVESFVVELEHK 422
              +E + VG+ +  S      I  +YGDL  L+KQLV E+R K+EL++QVE+FVVELEHK
Sbjct: 357  --LEDSEVGNTTASSEKSVSVIPKLYGDLGMLKKQLVIEKRQKDELKMQVEAFVVELEHK 414

Query: 423  IPVLNSFKKRIEELEKQLNGVTLLLEATARERDEKVVQIKQYKNKVGDYETQVGHLVQQR 482
            IPVLNSFK+R E LE++LN VT+LLE+T ++RD+K  Q+   K  V  YETQ+  L +QR
Sbjct: 415  IPVLNSFKERSEMLERELNEVTILLESTGKDRDQKSSQLDYLKATVKSYETQIASLSKQR 474

Query: 483  SDLARQVQCLLIHISVRDDSSGPLTAEEVEFVKKLQSCRDSATGSDTQAIISNRLVEFKS 542
             DLA Q+Q LL++ S++ +  GPL+AEE++FVK L + ++    SDTQ II++RLVEF+S
Sbjct: 475  VDLAHQIQYLLVNESIKSEDGGPLSAEELQFVKNLTNSQEITKTSDTQGIITDRLVEFRS 534

Query: 543  VVELQQKNAELLNAIRQLAQKLEQEEHKTQSKVKSLEQNTVNEAKEAILSLQEHVQMLED 602
            VVELQQKN+ELL+ IR LA +LE+ E + +S+++ LE  TV EAKE IL+L +H Q LE+
Sbjct: 535  VVELQQKNSELLSTIRNLADELERREAENKSQIQVLEDETVREAKETILTLHDHAQNLEN 594

Query: 603  QLETVTTERDSFKLL---VSEGKNNSLPNPVGAAALQPQEVADGIAHLEARLKAMAEESE 659
            QL  ++ ERD++K L    S G N     P       P +  D +  LE RL A+ +E+E
Sbjct: 595  QLVILSKERDAYKALSVNASSGTN----TPKAITYPSP-DNDDKVKDLETRLTAVIQEAE 649

Query: 660  QHAKMLNEEIKALYKSNSQLAIXXXXXXXXXXXADEKLSLIQKSLELVKGENADLQNRAG 719
             +AK  + E   L K   ++++           A+++L+L+Q +LEL K +  +LQ R+ 
Sbjct: 650  NNAKEWSSENSNLRKKLYEISLNFESEKTSRTLAEDRLNLLQSTLELSKRQCEELQKRSS 709

Query: 720  SLQALLLEQDTRRQSTIEEFVSAKSELFSISSQLTILQSERDFLRKVEADLKKENESLNK 779
             LQ +L +QD R Q T++  +  KS L SI S+L+IL+SE+ F+ KV+ +LK ENE  +K
Sbjct: 710  DLQDILTKQDKRTQETVDSLIKTKSTLSSIQSELSILKSEKQFMAKVQKELKAENERFSK 769

Query: 780  DNNDSQLLILQLKTAQKERDSLIEETRKRYETRIEELDGELSATKQQLERKQREYDELSS 839
            ++ + ++LI QL+T Q+ER+ L++ET+  Y+ ++ +L+ ELS + ++LE  ++    ++S
Sbjct: 770  ESVEYKVLIAQLQTLQREREMLLKETQNSYKEKLRKLEIELSGSLERLEEIEKNTTGIAS 829

Query: 840  SSSTQCKWFQSKLDSLKEELGSSKLALKAKTSELDALKARLNSSTSKLEPASMDHQQSSL 899
            +   Q  WFQ K+D L  E    K  L+ K ++L  +++ +N  ++KL+ A    Q  ++
Sbjct: 830  NKEHQYNWFQEKIDKLTSEAAQQKTTLEEKEAQLQKMQSTINEQSAKLKEAEARAQSYTM 889

Query: 900  VLESDHASR-VQSLSKDLDEANRKLSSAYSEIERYKA-ASNATERPSLSYNAVQDNKDGS 957
            +   D A   V++L ++L++ N +LS +YS+IE +K  A  + +  +    A ++ +  S
Sbjct: 890  LSNVDDAQNLVETLRQELEKVNLQLSDSYSQIEHHKTLAEQSVQSVNEVSQAFEEAQKES 949

Query: 958  KQAAISLEAELTKLNSDIAMANDRIKVLEDELNRREATYSTERSELQEKINALVTDKQRI 1017
            ++  I+LE E  +L S + + ND++K L +E+  +++ Y TER+   E+I+ L   K+ +
Sbjct: 950  QKTIITLENERNQLQSTVNILNDQVKDLNNEIFHQKSEYQTERNATMEEISKLQMVKESV 1009

Query: 1018 EEAKADYQQKITQLQTDLEKQISSTNEAETKYQTALQKQAEISENIESLRKSSESYKSEI 1077
            +  KADY++KI  +Q DLE Q    NE++  Y+  LQK A++S+ I SLR  ++SYKS++
Sbjct: 1010 DRTKADYEEKIAMIQKDLEMQTQYANESQRSYELELQKHADVSKTITSLRTEAQSYKSDL 1069

Query: 1078 AKFKSAAEEARKVLERNEQTWDQQKADIEANLDLAHQRIEELSTQNRLLYDQIXXXXXXX 1137
               K+ ++ A + L+ +E+ W++QK + E  L +  QR++ELSTQN+LLYDQI       
Sbjct: 1070 ETLKTQSQLAMENLKNSEKLWNEQKTEYEDKLSVLEQRVQELSTQNKLLYDQI------E 1123

Query: 1138 XXXXXXDTKISSDARELIVTLRRERDILETKIDVSKREEKMLRQRLELTKSELDNLRAQL 1197
                  D   S D+ +L+++LRRERD+LETK++V+  E+ +L+QRL++ KSE+++L  QL
Sbjct: 1124 LLNKTEDRDNSHDSSDLLISLRRERDMLETKLEVALSEQTVLKQRLDIAKSEIEDLNTQL 1183

Query: 1198 SESKGLVTEGTDSSQNQEELFEKLNQLNLLREHNMSLRNESEKVSEHNEFLQNEILSLQE 1257
            S+ K   +E     + QE + ++L+QL+LLRE N++LR+E+    +  + L++++    +
Sbjct: 1184 SQVKNSSSESAHLLEQQENIMKELDQLHLLRESNVTLRSENSSFKKECDNLKSQLQECND 1243

Query: 1258 KVQPMEEQIKSLTATXXXXXXXXXXXXXXSDRWKQRSQDILHKYERIDPEEYRKLASEIE 1317
            ++ P++  I SL                 ++RWK RSQDILHKYERIDPEE+ KL  EI 
Sbjct: 1244 RLAPLQSSISSLQNGIKIKEQELIQSKEEAERWKSRSQDILHKYERIDPEEHGKLKEEIN 1303

Query: 1318 VLKAELERKS-------AESIDSQERFRKLRKQANERLDEFKAAKAKVESELELALSGKS 1370
             +K EL+          AE  D + +F+++R QA +RL+  K  +  + SE+      KS
Sbjct: 1304 DVKNELQTTKDTLQSVIAEKDDWESKFQRIRLQARDRLNASKEKEQSLSSEINQINEAKS 1363

Query: 1371 QLEAKLSEAREKITSLE--TQLTERPASEDDNPVSHELEETKTKLQDAENTINMLKSEWS 1428
            Q+EA L + +     LE   Q+  + A   +   + +L    +KLQ+  ++I +     S
Sbjct: 1364 QVEADLGKCKTACKELEERLQVVTQEAETKEQTFNSQL----SKLQEDLHSIQVQMENAS 1419

Query: 1429 ISEE----------SFKKQLDELN---KQLETIQKNXXXXXXXXXXXXYHEQPTAVLEDF 1475
             +E+          S  + ++ LN   ++LE    N             +E   +++++ 
Sbjct: 1420 KTEQNNADSDEKIKSLTETVEMLNSKIQELEAEASNAQKIVAEHHTPVINEDTKSIVDNL 1479

Query: 1476 KKQVEEERRTLIESHQQELTARLEAS------------RKNFXXXXXXXXXXXRDSLTNV 1523
            K + E E+  LI+  ++EL ++ EA             RK F             +    
Sbjct: 1480 KTEFEAEKEQLIKDKEKELRSKFEAEKESAWNSREEELRKQFEEREKRIREECEKT---- 1535

Query: 1524 SVEAASQ-----NLEALKKKWEEEYEQQTLQRIREAEEALKKRIRLPSEERINQVIERKQ 1578
            +V++ SQ     +++ALK +WE+EYE+QTL++I+ AEEALKKRIRLP++++I++++E ++
Sbjct: 1536 TVQSPSQPTLDIDIDALKNEWEKEYEKQTLEKIKLAEEALKKRIRLPTQQKIDKIVEARK 1595

Query: 1579 KALEQEFTTKVNATALALLKENPDSIASDKADLIKDHQKEIVQLKKDLADKFEGQLVQVK 1638
              LE+ F  KVN  A  L  E    I +D   L K H+ E+  LK  +  +FE  L ++K
Sbjct: 1596 AVLEESFEEKVNEKAQKLAGE----IGNDAITLEK-HRAELNALKDSMRKQFEADLAEIK 1650

Query: 1639 KKAFEEGRQQGIMKVKLLESKISKLESQAKAPLGTNVPTKIPLEN---TQPLAQQVPVKP 1695
            +K+FEEG+QQ  +K+K LESKI  LE Q          T  P+EN       A Q PV  
Sbjct: 1651 QKSFEEGKQQVSLKLKFLESKIRNLEQQK--------STIKPVENDTSNMSAAFQAPVFG 1702

Query: 1696 SPFQLAYAQATFGNVPFLFNKNSEQKKVEHQDDSDSHQNTGNGNKRQSEDRAEESPGKKL 1755
            S        +TF + PF  ++ S                    NKR  +D A E P K+ 
Sbjct: 1703 S-------HSTFTS-PFSTSEIS-------------------PNKRPIDDTATEQPEKRH 1735

Query: 1756 RE 1757
            +E
Sbjct: 1736 KE 1737

>Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {ON}
            YKR095W (MLP1) - colied-coil protein (putative), similar
            to myosin and TPR [contig 159] FULL
          Length = 1760

 Score =  828 bits (2140), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 581/1653 (35%), Positives = 955/1653 (57%), Gaps = 69/1653 (4%)

Query: 132  RRDLARLLEEKISDLDASQQELERVLGVNKELRRHEMELEFTVQSQRSQSLREQAEIQRL 191
            + D+A+LL EKI D+   QQE ER+L   + LR+  +ELE   +  +S+ L+ +A+  +L
Sbjct: 138  KNDVAQLLNEKIGDIATLQQETERLLQEARTLRQQNLELEGQARVYKSEELKHKADFHQL 197

Query: 192  QQELALVRSNAEWTTGQLNEKNQQLNSYREKTNGEIQSTQVELNIVKNELEVEHANVAAL 251
             Q+++L+ +N EW   QLN+KN + N+YR++T  E+ S    L   + +L+     +  L
Sbjct: 198  SQKVSLLNTNNEWLESQLNQKNSEFNAYRQRTQSELASVSQRLETCEGDLQAATKTIKTL 257

Query: 252  RSKNGELSKQLQDALCETKRLTDSLHSEKQEFAREMALKQRLIELLNGQVATMKQDLE-K 310
            R +NG+   +L+      K+LTD L S KQEF REM+LKQRL+ELL GQV+ +K +LE K
Sbjct: 258  REQNGQKESELEGQFQAVKKLTDELTSAKQEFTREMSLKQRLVELLEGQVSALKSELEFK 317

Query: 311  AYDVAKNGGMSDSERERLLNDLFDTKKKLELSQANVSRLEDTIKELLETDNVQSGGRNGI 370
                A     +   + ++ ++L    ++LE S+  + +LE T+++LL  D          
Sbjct: 318  NSPQASTDAATTESQSQIEDELVHKTQQLEESELKIQKLEQTVEQLLSADE--------- 368

Query: 371  EHANVGSPSGGSTISTVYGDLAALRKQLVQERRHKEELQLQVESFVVELEHKIPVLNSFK 430
                  + SG  ++  +Y D+  L+KQ++ ERR KE LQ QVE+FVVELE+K+P+L+SFK
Sbjct: 369  -----KTISGSQSLPDLYADIGILKKQVIHERRQKEFLQNQVEAFVVELENKVPMLSSFK 423

Query: 431  KRIEELEKQLNGVTLLLEATARERDEKVVQIKQYKNKVGDYETQVGHLVQQRSDLARQVQ 490
             R + LEK+L     +L++ ++++DE    +K+ K+++ D E+Q+  L QQRSDLARQVQ
Sbjct: 424  DRNDVLEKELAETAYMLDSISKDKDETAADLKRTKSQIRDLESQISALTQQRSDLARQVQ 483

Query: 491  CLLIHISVRDDSSGPLTAEEVEFVKKLQSCRDSATGSDTQAIISNRLVEFKSVVELQQKN 550
             LLI ++VR DS GPL+AEE  FVKK+ +  ++    D Q IIS RLVEFK++VELQ KN
Sbjct: 484  YLLIQVTVRGDSHGPLSAEETAFVKKVVNMENTQPDGDAQGIISERLVEFKNIVELQAKN 543

Query: 551  AELLNAIRQLAQKLEQEEHKTQSKVKSLEQNTVNEAKEAILSLQEHVQMLEDQLETVTTE 610
            A+LL+ +R LA +LE EE K +SK +++E +T+ EAKEAI++LQ+H+Q LE +++ +T E
Sbjct: 544  ADLLHTVRNLANQLETEERKVKSKTEAIENDTITEAKEAIVTLQDHIQELETRIDVITRE 603

Query: 611  RDSFKLLVS----EGKNNSLPNPVGAAALQPQEVADGIAHLEARLKAMAEESEQHAKMLN 666
            RD++K + S    EG N  L + V A A +  ++   I  LE  L A   E+E + K+L 
Sbjct: 604  RDAYKAIQSQTSHEGSNGGLRD-VNAKASENSDL--KIRELEELLSAAKREAEANVKLLM 660

Query: 667  EEIKALYKSNSQLAIXXXXXXXXXXXADEKLSLIQKSLELVKGENADLQNRAGSLQALLL 726
             E + L +S S+L +           A+E+L + + SL L K EN +L  R   L+  L 
Sbjct: 661  TENQELARSKSELVVNVEKEKSSRLLAEERLKISKSSLLLTKQENEELNKRGLVLENNLA 720

Query: 727  EQDTRRQSTIEEFVSAKSELFSISSQLTILQSERDFLRKVEADLKKENESLNKDNNDSQL 786
            +QDTR Q TI E +  KS+L ++S++L    ++ + L      LK+ NE L K+ N+  +
Sbjct: 721  KQDTRTQETISELIDCKSQLATLSAELKNSIAKENLLNTSHQKLKETNEQLTKERNELTI 780

Query: 787  LILQLKTAQKERDSLIEETRKRYETRIEELDGELSATKQQLERKQREYDELSSSSSTQCK 846
            L+ QL+T QKERD+L++++   ++ +I+ L+ E+S  +  L +K  E  +  S+S ++ +
Sbjct: 781  LVTQLQTLQKERDTLLKDSDDNFKGKIDSLEAEISQLRTLLSQKATELSDFMSTSDSRSR 840

Query: 847  WFQSKLDSLKEELGSSKLALKAKTSELDALKARLNSSTSKLEPASMDHQQSSLVLESDHA 906
            W+Q K+D+L E L S+   L +KT  +  L+++ +  TSKL  A    Q  S++ ++D  
Sbjct: 841  WYQEKIDALNECLKSTTSDLNSKTQMIQELQSQQSLLTSKLRDAETKSQSYSVLNQTDDV 900

Query: 907  -SRVQSLSKDLDEANRKLSSAYSEIERYKAASNAT-ERPSLSYNAVQDNKDGSKQAAISL 964
             ++  +L  +L++    L  A+S+++ YK    +T E  +    A++ +K        +L
Sbjct: 901  LTQTDALRSELEKTRINLKDAFSQVDEYKGLYASTKETLTAMTTALEHSKQDHTIEVETL 960

Query: 965  EAELTKLNSDIAMANDRIKVLEDELNRREATYSTERSELQEKINALVTDKQRIEEAKADY 1024
            + E   L++D A+  D++  L  EL+ ++    T + E  +    + ++K  +   K  Y
Sbjct: 961  KKERDALSNDAAVLKDQLANLNSELDYQKNLLETLKHEHNKCEEEVKSNKTALASMKDQY 1020

Query: 1025 QQKITQLQTDLEKQISSTNEAETKYQTALQKQAEISENIESLRKSSESYKSEIAKFKSAA 1084
            Q ++++L  DL +Q    N+A+  Y+  LQ+ A++S+ I  LR+ ++ +K+++   +++ 
Sbjct: 1021 QLELSKLTEDLNQQAMYANKAQENYEQELQRHADVSKTISQLREEAQKHKNKVHSLEASI 1080

Query: 1085 EEARKVLERNEQTWDQQKADIEANLDLAHQRIEELSTQNRLLYDQIXXXXXXXXXXXXXD 1144
             E +K LE NE  W  QK + E    L+ QRIE+LSTQNRLL+DQI             +
Sbjct: 1081 TELKKSLEENESCWAAQKQEYETQASLSSQRIEDLSTQNRLLFDQI---SLKDTDSIPIN 1137

Query: 1145 TKISSDARELIVTLRRERDILETKIDVSKREEKMLRQRLELTKSELDNLRAQLSESKGLV 1204
             ++ S+ARELI TL+RE DIL+TK++++KR+E  L+Q+LE T+ EL   ++++ +S+  V
Sbjct: 1138 DELKSEARELISTLKRECDILQTKLELAKRDESNLKQKLEFTEQELSVAKSEIRKSQ--V 1195

Query: 1205 TEGTDSSQNQE--ELFEKLNQLNLLREHNMSLRNESEKVSEHNEFLQNEILSLQEKVQPM 1262
            T  T S   +E  ++ E+LNQ+NLLRE N++LRNE ++ S+ N+ L+  +  LQE ++P+
Sbjct: 1196 TSDTRSIMIEENSKILEQLNQVNLLRESNITLRNELQRKSQRNQDLERNVEELQEALKPL 1255

Query: 1263 EEQIKSLTATXXXXXXXXXXXXXXSDRWKQRSQDILHKYERIDPEEYRKLASEIEVLKAE 1322
            E  I +L  +               +RWKQRSQDIL KYER+DPEE++KLA E+   +AE
Sbjct: 1256 ENDILTLQRSVGAKDKQISLITEEVNRWKQRSQDILLKYERVDPEEHKKLAEELSQARAE 1315

Query: 1323 LERKSAESIDSQERFRKLRKQANERLDEFKAAKAKVESELELALSGKSQLEAKLSEAREK 1382
                + +  + ++RF++L+KQA ERLD  +  +  + +EL  A   +  LE  L + REK
Sbjct: 1316 AAANAQQRSELEDRFQRLKKQARERLDNARTTQNTLNAELTEARESQKALEDALDKEREK 1375

Query: 1383 ITSLETQL--TERPASEDDNPVSHELEETKTKLQDAENTINMLKSEWSISEESFKKQLDE 1440
              SL+  +  TE    E+ +    +L++   KL+DA+  IN + +  S  E++ +++L+ 
Sbjct: 1376 TRSLQESIKATEENEIENSSATRDQLQDALQKLEDAQARINEMSTAPSQEEQTLREELER 1435

Query: 1441 LNKQLETIQKNXXXXXXXXXXXXYHEQPTAVLEDFKKQVEEER------RTLIESHQQEL 1494
              + ++ ++++              +    VLE+ K QV          +T +  H  +L
Sbjct: 1436 TRQHVKQLEEHLAKT----------QNEVRVLEEAKNQVSGTEAEIARVKTELIDHSNKL 1485

Query: 1495 TARLEAS-RKNFXXXXXXXXXXXRDSLTNVSVEAASQNLEALKKKWEEEYEQQTLQRIRE 1553
             A  EA  ++ +             SL + S    S ++E LKK+WEEEYEQ+T++RI E
Sbjct: 1486 LAEKEAEIKEKYEKQRLEDKAELEKSLAS-SESLKSSDIENLKKEWEEEYEQRTIKRIEE 1544

Query: 1554 AEEALKKRIRLPSEERINQVIERKQKALEQEFTTKVNATALALLKENPDSIASDKADLIK 1613
            A E L+KRIRLP+EE+IN++IE +++ L++EF  K+      L  E P  + +   +++K
Sbjct: 1545 ANEILRKRIRLPTEEKINKIIENRKRELDEEFEAKLQQRTSELAGEKP--LPATFTEVMK 1602

Query: 1614 DHQKEIVQLKKDLADKFEGQLVQVKKKAFEEGRQQGIMKVKLLESKI----SKLESQAKA 1669
             H++E+ +LK D+  + + ++ Q KKKAF+EG+QQ  MK   LE KI    ++ ++ A+ 
Sbjct: 1603 RHKQEVEKLKADMKREMDEEVAQAKKKAFDEGKQQASMKSMFLEKKIAKLEAQAKAAAEK 1662

Query: 1670 PLGTNV--PTKIPLENTQPLAQ---QVPVKPSPFQLAYAQATFGNVPFLFNKNSE---QK 1721
            P  T V  P +  L+   P+A+   Q        +LA         P   + + E     
Sbjct: 1663 PDDTTVNSPDRKQLDKPSPIAEISHQEDKTHIAEELAEGPRPITTSPIPPSSSGELIDNS 1722

Query: 1722 KVEHQDDSDSHQNTGNGNKRQSEDRAEESPGKK 1754
             VE  +D+    N     KR SE   EESP  K
Sbjct: 1723 SVEPSNDA----NDSVSTKRPSEVSLEESPDSK 1751

>KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {ON}
            similar to uniprot|Q02455 Saccharomyces cerevisiae
            YKR095W MLP1 Myosin-like protein associated with the
            nuclear envelope, connects the nuclear pore complex with
            the nuclear interior; involved in the Tel1p pathway that
            controls telomere length; involved in the retention of
            unspliced mRNAs in the nucleus
          Length = 1771

 Score =  788 bits (2034), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 570/1633 (34%), Positives = 945/1633 (57%), Gaps = 85/1633 (5%)

Query: 127  AGDSARRDLARLLEEKISDLDASQQELERVLGVNKELRRHEMELEFTVQSQRSQSLREQA 186
            A +S++ D+ARLL EKIS+L + +QE + ++  N+ LR+  ++LE   +  +S+ L+ +A
Sbjct: 131  ALESSKNDVARLLNEKISELSSFKQEADDLMQENRRLRQQTLDLESESRVSKSEDLQRKA 190

Query: 187  EIQRLQQELALVRSNAEWTTGQLNEKNQQLNSYREKTNGEIQSTQVELNIVKNELEVEHA 246
            E+ RL QEL+L RSN+EW   QL +KN + N+YR  T  ++ +   +L  ++ EL+    
Sbjct: 191  ELHRLSQELSLCRSNSEWLESQLGQKNAEFNAYRHTTQSQLAALTQKLETLEQELQASTR 250

Query: 247  NVAALRSKNGELSKQLQDALCETKRLTDSLHSEKQEFAREMALKQRLIELLNGQVATMKQ 306
               +LR  N  ++  L+  L   K+LTD+L+SEKQEF REM+LK+RL++LL GQV ++K 
Sbjct: 251  TNKSLREHNARITNDLETQLRNVKKLTDNLNSEKQEFTREMSLKERLVDLLEGQVQSLKS 310

Query: 307  DLE-KAYDVAKNGGMSDSERERLLNDLFDTKKKLELSQANVSRLEDTIKELLETDNVQSG 365
            DLE ++     + G   +    L  +L    ++LE S+  V +LE T+++L+ TD     
Sbjct: 311  DLELRSTAGEGDDGSFSNPLNALSEELAQKTQQLEESEFKVQKLEQTVQDLVSTDKESRL 370

Query: 366  GRNGIEHANVGSPSGGSTISTVYGDLAALRKQLVQERRHKEELQLQVESFVVELEHKIPV 425
              +  E+         ++++ +YGD++ L++Q++ E+R KE LQ QVE+FVVELE K+P+
Sbjct: 371  KSSAHEYP--------ASVTDLYGDISLLKRQVIHEKRQKEHLQNQVEAFVVELESKVPM 422

Query: 426  LNSFKKRIEELEKQLNGVTLLLEATARERDEKVVQIKQYKNKVGDYETQVGHLVQQRSDL 485
            L+SFK R + LE+QL     +LE+ +++++   + +++ K ++ D+E Q+  L +QRSDL
Sbjct: 423  LSSFKDRNDMLEEQLAETAYMLESISKDKESVALDLRRTKAQIHDFEIQISELTRQRSDL 482

Query: 486  ARQVQCLLIHISVRDDSSGPLTAEEVEFVKKLQSCRDSATGSDTQAIISNRLVEFKSVVE 545
            ARQVQ LLI  SVR DS GPLT EE+ FV+++    D +   DTQ +IS RLVEF+ +VE
Sbjct: 483  ARQVQYLLIQASVRSDSKGPLTTEEIAFVRRILEQGDLSLERDTQKVISERLVEFRDIVE 542

Query: 546  LQQKNAELLNAIRQLAQKLEQEEHKTQSKVKSLEQNTVNEAKEAILSLQEHVQMLEDQLE 605
            LQ KN++LL  IR LA KLE EE +++ + K++E + + EAKEAI++LQEH Q LE ++E
Sbjct: 543  LQSKNSDLLRTIRNLADKLESEEEQSKMRSKTVENDAIREAKEAIITLQEHAQELESRIE 602

Query: 606  TVTTERDSFKLLVSEGKNNSLPNPVGAAALQPQEVADGIAHLEARLKAMAEESEQHAKML 665
             +T ERD++K  +    NN       A A    +++  +  LE  L    EE+E++ KML
Sbjct: 603  VLTKERDAYK-AIQPSTNNGNKITEHALANSKGKMSARVDDLERSLVTEREEAEKNMKML 661

Query: 666  NEEIKALYKSNSQLAIXXXXXXXXXXXADEKLSLIQKSLELVKGENADLQNRAGSLQALL 725
            N EI+ L +  ++LAI           A+E+L + Q SL+L K EN +L  R   +Q  L
Sbjct: 662  NSEIQELLRQKTKLAIEIEKERTSKCLAEERLKVSQGSLKLTKQENEELNKRYHIIQDNL 721

Query: 726  LEQDTRRQSTIEEFVSAKSELFSISSQLTILQSERDFLRKVE--ADLKKEN----ESLNK 779
            L+QDT+ Q T+   +  +S+L ++ S+L      +  + K+E  +  +K+N    E L  
Sbjct: 722  LKQDTKTQETLSCLIECQSKLATLESEL------KSSVAKIESLSSCQKKNTESIEQLTA 775

Query: 780  DNNDSQLLILQLKTAQKERDSLIEETRKRYETRIEELDGELSATKQQLERKQREYDELSS 839
            + N+  +L+ QL+T Q ERD L+ ET K Y+ +++ L+ E S  + QL RK  E+++   
Sbjct: 776  ERNNLTILVTQLQTLQGERDKLLAETEKSYKEKVDALEVEASQLRTQLSRKDEEFNDFIQ 835

Query: 840  SSSTQCKWFQSKLDSLKEELG--SSKLALKAKTS-ELDALKARLNSSTSKLEPASMDHQQ 896
            ++ ++ +W+Q K+DSL E L   +S+L  +A+T+ +L++ K  L     ++E  +    Q
Sbjct: 836  TNDSRSQWYQEKIDSLNETLKVVTSQLESQAQTTRDLESQKKLLEGRLKEVETKA----Q 891

Query: 897  SSLVLE--SDHASRVQSLSKDLDEANRKLSSAYSEIE----RYKAASNATERPSLSYNAV 950
            S  VL    D  ++ ++L  +L+++  KL  AYS+IE    RYK+A  A    S   NA 
Sbjct: 892  SYDVLNQTDDVLAQTEALRMELEKSKIKLQDAYSQIEEHRSRYKSAEEAL---SAITNAF 948

Query: 951  QDNKDGSKQAAISLEAELTKLNSDIAMANDRIKVLEDELNRREATYSTERSELQEKINAL 1010
            +  K+   +   +++ +  +L   +     +I  L +EL  ++  + +E++EL+ ++ +L
Sbjct: 949  ERFKNEHSKDFGNMKKKEDELVGQVEALKHQISNLNNELGHQKKQFDSEKNELENQLVSL 1008

Query: 1011 VTDKQRIEEAKADYQQKITQLQTDLEKQISSTNEAETKYQTALQKQAEISENIESLRKSS 1070
             + ++ +   K  Y+Q++ +L  DL +Q +  N+A+  Y+  LQ+ A++S+ I  LR+ S
Sbjct: 1009 QSTQETMNSMKEHYEQQLGKLTQDLNQQAAFANKAQENYEQELQRHADVSKTISQLREES 1068

Query: 1071 ESYKSEIAKFKSAAEEARKVLERNEQTWDQQKADIEANLDLAHQRIEELSTQNRLLYDQI 1130
            + YK++ +  +S+ E+  K L+ ++  W  QK + EA L   +QRIE+L+ QN LL DQ+
Sbjct: 1069 QKYKNQASVLQSSIEQLEKTLDESDGKWLNQKEEYEAQLRSLNQRIEDLTVQNGLLLDQL 1128

Query: 1131 XXXXXXXXXXXXXDTKISSDARELIVTLRRERDILETKIDVSKREEKMLRQRLELTKSEL 1190
                          ++     RELI +LRRERDIL+TK++VSKR E +  ++LE  + EL
Sbjct: 1129 DLEAKDPNSELGQ-SEPQEKVRELITSLRRERDILQTKLEVSKRSETVSLRKLEAIEQEL 1187

Query: 1191 DNLRAQLSESKGLVTEGTDSSQNQEELFEKLNQLNLLREHNMSLRNESEKVSEHNEFLQN 1250
               + +LS  + L ++ +  +    +L E+LNQLNLLRE N++LR+E +K ++  + L+ 
Sbjct: 1188 SFAKEELSSLQALSSQNSIMADEHNKLLEQLNQLNLLRESNITLRSEVQKKTQRCQELEG 1247

Query: 1251 EILSLQEKVQPMEEQIKSLTATXXXXXXXXXXXXXXSDRWKQRSQDILHKYERIDPEEYR 1310
            +I +LQ+ +QP+E ++ SL  +              ++RWKQRSQDIL K+ERIDPEE++
Sbjct: 1248 QIDNLQQSLQPLESELASLKRSVRAKDSQISLISEETNRWKQRSQDILSKFERIDPEEHK 1307

Query: 1311 KLASEIEVLKAELERKSAESIDSQERFRKLRKQANERLDEFKAAKAKVESELELALSGKS 1370
            KL  E+   KAEL  K+ ++ + ++RF++L+KQA ERLD  KA +  +  EL  A   +S
Sbjct: 1308 KLGEELSQAKAELAAKADQNSELEDRFQRLKKQARERLDAAKAVQNNLSVELAQAREAQS 1367

Query: 1371 QLEAKLSEAREKITSLETQLTERPASE--DDNPVSHELEETKTKLQDAENTINMLKSEWS 1428
             +E +L + ++   +L+  L +R  SE   D+    ELE    KL  AE     ++S+ +
Sbjct: 1368 NMELQLRKEQDVNKALQESL-QRVESEAKADSTTQPELESALQKLSQAEKKAQDIESDRA 1426

Query: 1429 ISEESFKKQLDELNKQLETIQKNXXXXXXXXXXXXYHEQP----TAVLEDFKKQVEEERR 1484
              E++ + +L+++    E +++               +Q     ++ LE  K+ +EE   
Sbjct: 1427 QIEKALQSELEKVKSHAEELERRLDEARREVESLEEVKQGAFTDSSELEKMKRDLEEHSN 1486

Query: 1485 TLIESHQQELTARLEASRKNFXXXXXXXXXXXRDSLTNVSVEAASQNLEALKKKWEEEYE 1544
            TLI   + E+ +  E  R               ++  +  V     ++E LKK+WEE+YE
Sbjct: 1487 TLIAEKEAEIRSHYEELR---LKEKATYEKELEENGKHTPV-----DIETLKKQWEEDYE 1538

Query: 1545 QQTLQRIREAEEALKKRIRLPSEERINQVIERKQKALEQEFTTKVNATALALLKENPDSI 1604
            Q+T++RI E+ E L+KRIRLP+EE+IN+++E ++  LEQEF  K+   A  L  E P   
Sbjct: 1539 QKTIKRIEESNEILRKRIRLPTEEKINKIVETRKSELEQEFEAKLQKRASELANEKPQPA 1598

Query: 1605 ASDKADLIKDHQKEIVQLKKDLADKFEGQLVQVKKKAFEEGRQQGIMKVKLLESKISKLE 1664
            +    +++K H++E+ +LK DL  + + ++ QV+KKAF+EG+QQ  MK   LE KI+KLE
Sbjct: 1599 SF--TEVMKRHKQEMEKLKADLTREMDEEMAQVRKKAFDEGKQQASMKSMFLEKKIAKLE 1656

Query: 1665 SQAK---------APLGTNVPTKIP------------LENTQPLAQQVPVK--------P 1695
            +Q K         AP   N PT+ P            L    P  + +P+K        P
Sbjct: 1657 AQVKASGTEAVPSAPTSKNSPTEKPVRILEASPLEDALSRNDPNKESLPIKKISLPSLTP 1716

Query: 1696 SPFQLAYAQATFG 1708
             P Q    +A  G
Sbjct: 1717 EPQQSQPEEAPNG 1729

>TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1810

 Score =  774 bits (1999), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 562/1674 (33%), Positives = 941/1674 (56%), Gaps = 100/1674 (5%)

Query: 130  SARRDLARLLEEKISDLDASQQELERVLGVNKELRRHEMELEFTVQSQRSQSLREQAEIQ 189
            S ++++ +LLEEKIS+L+AS+ E + ++  NK LR+  ME +  VQ+ +   L +++E++
Sbjct: 137  SNKQEVVKLLEEKISELEASKVESQELVNDNKNLRQQLMETQNEVQTLKCNGLGDKSELE 196

Query: 190  RLQQELALVRSNAEWTTGQLNEKNQQLNSYREKTNGEIQSTQVELNIVKNELEVEHANVA 249
             ++Q++ ++  + EW   ++  K +QL  YR++ + E+Q +  E+  +KN+ ++E ++  
Sbjct: 197  IVKQQVGMLTKSNEWLEKEVTSKTEQLIKYRQENDTELQKSLQEVARLKNDYQLEKSSRE 256

Query: 250  ALRSKNGELSKQLQDALCETKRLTDSLHSEKQEFAREMALKQRLIELLNGQVATMKQDL- 308
             L  KN E+S+ LQ+ L E K+L+D L++EKQEF+REM+LKQ+L++L + Q+ + K++L 
Sbjct: 257  FLLKKNQEISQDLQNKLYEIKKLSDELNTEKQEFSREMSLKQKLLDLQDEQLQSFKEELR 316

Query: 309  --EKAYDVAKNGGMSDSERERLLNDLFDTKKKLELSQANVSRLEDTIKELLETDNVQSGG 366
              E+ ++  +   +  +++ R ++DL   +++LE S     RL+  + E++         
Sbjct: 317  LTEEKHNSTEADNLQSTQQARFMDDLAQVRQQLEESNHERLRLQAVVNEVM--------- 367

Query: 367  RNGIEHANVGSPSGGSTISTVYGDLAALRKQLVQERRHKEELQLQVESFVVELEHKIPVL 426
                E  ++ S +  S I  +YGD+  L+KQL++ER  KE LQ Q+ESFVVELE+K+PV+
Sbjct: 368  -GDSEEFDLDSTANVS-IPKLYGDIGVLKKQLIKERHQKENLQRQIESFVVELEYKVPVI 425

Query: 427  NSFKKRIEELEKQLNGVTLLLEATARERDEKVVQIKQYKNKVGDYETQVGHLVQQRSDLA 486
            NS K+R   LEK+L+ + LLLE T+ E++ K  +++    K+   E     L++QRSDLA
Sbjct: 426  NSLKERSYTLEKELSDIALLLEHTSHEKERKTRELESATGKIKQLEINTHTLIRQRSDLA 485

Query: 487  RQVQCLLIHISVRDDSSGPLTAEEVEFVKKLQSCRDSATGSDTQAIISNRLVEFKSVVEL 546
            RQVQ LL + ++++DS GPLTA+EV F+KK+    + +  SD+Q+II+ RLVEFK +  L
Sbjct: 486  RQVQFLLFNGTLQNDSRGPLTADEVAFIKKIIENENPSNESDSQSIITERLVEFKDIATL 545

Query: 547  QQKNAELLNAIRQLAQKLEQEEHKTQSKVKSLEQNTVNEAKEAILSLQEHVQMLEDQLET 606
            Q++N ELL   R LA +LE+EE  +  ++ SLE+ T++EAKEAI++LQE    +E ++ T
Sbjct: 546  QERNTELLKTARTLADRLEEEEKNSNIRIDSLERKTIDEAKEAIITLQERNSEIESKVST 605

Query: 607  VTTERDSFKLLVSEGKNNSLPNPVGAAALQ-PQEVADGIAHLEARLKAMAEESEQHAKML 665
            +  ERD++K ++S+  + S  N   A  ++  QE  + I  LE +L  +  E+ ++ ++L
Sbjct: 606  IEKERDAYKAILSQT-SQSFDNLGDADRMKDSQENQELIKSLEDKLSTLTTETSKNNELL 664

Query: 666  NEEIKALYKSNSQLAIXXXXXXXXXXXADEKLSLIQKSLELVKGENADLQNRAGSLQALL 725
            N+EI+ LY+S +QL I           A+++L L+Q +LE+ K ENA+L  R+  LQ++L
Sbjct: 665  NQEIRNLYQSKTQLTISHEKERSSRTLAEDRLKLLQSTLEMTKNENAELIRRSHELQSIL 724

Query: 726  LEQDTRRQSTIEEFVSAKSELFSISSQLTILQSERDFLRKVEADLKKENESLNKDNNDSQ 785
             +Q+ R   T+ +++S +S+L  + ++   L +E+  L+     L++E + ++ + N   
Sbjct: 725  SKQEARNGETVNKYISCQSKLSVLEARAANLDAEKSLLQSSSDSLRREIQKISVERNSLN 784

Query: 786  LLILQLKTAQKERDSLIEETRKRYETRIEELDGELSATKQQLERKQREYDELSSSSSTQC 845
            L++ QL+T Q ER++L++E++  ++  I +L+ + S  K ++  K  E      +   Q 
Sbjct: 785  LMVTQLQTLQSERENLLKESQASHKAAIAQLEVQTSELKTEISSKDNEIKASEDAKRAQT 844

Query: 846  KWFQSKLDSLKEELGSSKLALKAKTSELDALKARLNSSTSKLEPASMDHQQSSLVLESDH 905
            KWFQ K+D +  + G  +  L  KT+ +  L+  +N    K+E +         + ++ +
Sbjct: 845  KWFQEKIDEMSSDAGKIRDELATKTATVAQLELEVNDLKKKIEESDSRIASYKTLNDAGN 904

Query: 906  ASRVQS-LSKDLDEANRKLSSAYSEIERYKAASNATERP--SLSYNAVQDNKDGSKQAAI 962
                Q  L KDL++   +L  AYS+ E +K  S+  E    +LS N  ++  +  K  A 
Sbjct: 905  GETTQGQLRKDLEKTMIELKHAYSQNEEFKQISSTAEETLKNLS-NEFEERTEALKSNAE 963

Query: 963  SLEAELTKLNSDIAMANDRIKVLEDELNRREATYSTERSELQEKINALVTDKQRIEEAKA 1022
               AE  +L   ++     I  L +E   ++     E++E+ +K+ +L + +  + + K 
Sbjct: 964  KYLAEKVQLEQCVSNLKKNIDFLNNEYALQKNRSEEEKNEILKKLVSLESSEHSLGQVKK 1023

Query: 1023 DYQQKITQLQTDLEKQISSTNEAETKYQTALQKQAEISENIESLRKSSESYKSEIAKFKS 1082
            +Y QK+ QLQ DLE+Q +  N A+  Y+  LQK AE+S+ I  LR   +S +SEI + K+
Sbjct: 1024 EYDQKLYQLQKDLEQQTAYANIAQKNYEEELQKHAEVSKIISQLRSEVQSGRSEIQQLKA 1083

Query: 1083 AAEEARKVLERNEQTWDQQKADIEANLDLAHQRIEELSTQNRLLYDQIXXXXXXXXXXXX 1142
            + ++A++VLE  E++W  QK +++A++D   ++++ +S+QN+LL+ Q+            
Sbjct: 1084 SEQQAKEVLENGEKSWYNQKTELDAHIDDLKRQVDNISSQNKLLFSQV---ELLSKSERE 1140

Query: 1143 XDTKISSDARELIVTLRRERDILETKIDVSKREEKMLRQRLELTKSELDNLRAQLSESKG 1202
             + K+   + EL+++LRRERDILETK+ VSKREEK+L Q+    + EL   R +L + + 
Sbjct: 1141 FENKLLPGSSELLISLRRERDILETKLTVSKREEKLLHQKQVALEDELAEARKKLFKLQE 1200

Query: 1203 LVTEGTDSSQNQEELFEKLNQLNLLREHNMSLRNESEKVSEHNEFLQNEILSLQEKVQPM 1262
              +  +D ++  E++ E+LNQ+NLLRE N++LRN      E N  LQ+E+  LQ K+ P+
Sbjct: 1201 NDSNHSDIAKQHEDIMEQLNQMNLLRESNVTLRNAVNAAQEKNSDLQSELNHLQSKILPL 1260

Query: 1263 EEQIKSLTATXXXXXXXXXXXXXXSDRWKQRSQDILHKYERIDPEEYRKLASEIEVLKAE 1322
              ++     +              +DRWK+RS DIL ++E+IDPEEYRKL  EI  LK E
Sbjct: 1261 NSELSECRQSIEEKDQRIILLIDEADRWKERSHDILRRHEKIDPEEYRKLEEEISNLKKE 1320

Query: 1323 LERKSAESIDSQERFRKLRKQANERLDEFKAAKAKVESELELALSGKSQLEAKLSEAREK 1382
            LE KS E+ D  +RF +L+KQA+E+L+  K A+A + +E+      K+++E  L E + K
Sbjct: 1321 LEAKSKENTDLNDRFTRLKKQAHEKLNASKIAQANLSAEVNELQGTKTKMEEILKETQTK 1380

Query: 1383 ITSLETQLTERPA-SEDDNPVSHELEETKTKLQDAENTINMLKSEWSISEESFKKQLDE- 1440
            + +LE  LTER + S ++  + HEL++   + ++ E  +     E   S E    QL+E 
Sbjct: 1381 VLNLEKLLTERDSESANNEDLRHELDDALERCKEIEVKL----GETVGSSEGLTSQLNEE 1436

Query: 1441 ---LNKQLETIQKNXXXXXXXXXXXXYHEQPTAVLEDFKKQVEEERRTLIESHQQELTAR 1497
               L +Q+   ++                  + V+E  KK  EEE+   I+   +E   +
Sbjct: 1437 INSLKEQVRIFKEKENDSTLEGSQGL-----SNVVESMKKAFEEEKIKFIQEKTEEYNKK 1491

Query: 1498 LEASRKNFXXXXXXXXXXXRDSLTNVSVEAASQNLEALKKKWEEEYEQQTLQRIREAEEA 1557
             E  +                         ++ ++ +LKK+WEEEYE  + QRI+EAEE 
Sbjct: 1492 FEEEKAKLSSENGSPAEP-----------VSAPDVNSLKKQWEEEYEAISQQRIQEAEEN 1540

Query: 1558 LKKRIRLPSEERINQVIERKQKALEQEFTTKVNATALALLKENPDSIASDKADLIKDHQK 1617
            LKKRIR+P+EERI +V+++++  LE+EF  +        LKEN  ++  +  D      K
Sbjct: 1541 LKKRIRMPTEERIKKVLDKRKTELEEEFQRR--------LKEN--NLQPEGGDA-----K 1585

Query: 1618 EIVQLKKDLADKFEGQ----LVQVKKKAFEEGRQQGIMKVKLLESKISKLESQAK----- 1668
            E  +LKK L  +FE +    L   KKKAFEEG+QQ  MK  LLE KISKLESQ       
Sbjct: 1586 EREELKKQLESEFEAKYKEILASTKKKAFEEGKQQAAMKSTLLERKISKLESQLNSSNNP 1645

Query: 1669 -----APLGTNVPTKIPLENTQPLAQQVPV----------KPS----------PFQLAYA 1703
                 A     +PTKI    T+ +A   P           KP+          PF  A  
Sbjct: 1646 TPEKAAATSVGLPTKIDESRTENMATGTPAFGEKVLKLSDKPAFSFQPSSKSNPFTSALP 1705

Query: 1704 --QATFGNVP-FLFNKNSEQKKVEHQDDSDSHQNTGNGNKRQSEDRAEESPGKK 1754
                 FG  P F F   S Q +      S     T      +S  ++EES  +K
Sbjct: 1706 GNNNVFGMKPTFSFTPGSSQPESRPTFGSTGFNTTAEPESNRSSSQSEESIPEK 1759

>Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR095W
            (REAL)
          Length = 1898

 Score =  723 bits (1866), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 561/1672 (33%), Positives = 917/1672 (54%), Gaps = 183/1672 (10%)

Query: 129  DSARRDLARLLEEK----------ISDLDASQQELERVLGVN-------KELRRHEMELE 171
            +S +R L+ L EEK          +  LD   +ELE V   +       K+LR   +ELE
Sbjct: 121  ESIKRKLSDLSEEKKEIQSSQQRTLKILDERLKELEMVKAASNHSDSECKKLRSTILELE 180

Query: 172  FTVQSQRSQSLREQAEIQRLQQELALVRSNAEWTTGQLNEKNQQLNSYREKTNGEIQSTQ 231
               Q+  S  L  +++++R  QEL L++SN +W   +L+ KNQQ  SYR+KTN  I   +
Sbjct: 181  TKQQTYISNDLNSKSQLERRTQELNLLQSNKDWLEKELSSKNQQYLSYRQKTNTIISEIR 240

Query: 232  VELNIVKNELEVEHANVAALRSKNGELSKQLQDALCETKRLTDSLHSEKQEFAREMALKQ 291
             +LN ++N+ ++E  N   LR KN ELSK LQ+ L + K L+DS +SEK++F+ E+ LKQ
Sbjct: 241  NDLNRIRNDFQLEKTNNDVLRQKNNELSKDLQEKLLQIKTLSDSSNSEKRDFSAEITLKQ 300

Query: 292  RLIELLNGQVATMKQDLEKAYDVAKNGGMSD------SERERLLNDLFDTKKKLELSQAN 345
            RLI+LL  Q+  +K++L    +   +   SD      SE E+LL DL  TK KL   +  
Sbjct: 301  RLIDLLESQLNAVKEELNNTRESNYSDVNSDDSKQLISENEKLLKDLQLTKHKLVQCENE 360

Query: 346  VSRLEDTIKELLETDNVQSGGRNGIEHANVGSPSGGSTISTVYGDLAALRKQLVQERRHK 405
              RL    +E        +G  +GI    + S S G        D   L+KQL++E+R K
Sbjct: 361  CLRLSSITEE--------AGKEDGI----LTSKSNG--------DFILLKKQLIKEKRAK 400

Query: 406  EELQLQVESFVVELEHKIPVLNSFKKRIEELEKQLNGVTLLLEATARERDEKVVQIKQYK 465
            E LQ Q+ESF+VELEHK+P++NSFK+R + LE +LN   LLLE T+ E++ K+ ++K   
Sbjct: 401  EHLQNQIESFIVELEHKVPIINSFKERTDTLENELNNAALLLEHTSNEKNAKIKELKVKN 460

Query: 466  NKVGDYETQVGHLVQQRSDLARQVQCLLIHISVRDDSSGPLTAEEVEFVKKLQSCRDSAT 525
             K+ +Y+ ++  L +QR DL RQ+Q LL+  SV +DS GPL  EE++F++ +    DSAT
Sbjct: 461  EKLAEYKDEIHILSKQRLDLCRQIQYLLVTNSVSNDSKGPLRKEEIKFIQNILQNDDSAT 520

Query: 526  G-SDTQAIISNRLVEFKSVVELQQKNAELLNAIRQLAQKLEQEEHKTQSKVKSLEQNTVN 584
              SD+Q I++ RLVEF+ +++LQ+KN+ELL   R LA KLE  E+K+++ +K++E  T+N
Sbjct: 521  TESDSQKIVTERLVEFRDIIQLQEKNSELLRVTRNLADKLESNENKSKNYLKNIENETIN 580

Query: 585  EAKEAILSLQEHVQMLEDQLETVTTERDSFKLLVSE---GKNNSLPNPVGAAALQPQEVA 641
            EAKEAIL+LQ     LE ++  +  ER+ FK    +     NNS+   +       +E+ 
Sbjct: 581  EAKEAILTLQSQKVQLESKIHELEKEREKFKNWTMDQETSPNNSVIQQLTETK---RELE 637

Query: 642  DGIAHLEARLKAMAEESEQHAKMLNEEIKALYKSNSQLAIXXXXXXXXXXXADEKLSLIQ 701
                 L+AR+  +  ES ++  +LN+E++ LY S S L+I           A+E+  L+ 
Sbjct: 638  SQTQDLQARISQVTRESTENMSLLNKELQDLYDSKSSLSIELGREKSSRILAEERFKLLS 697

Query: 702  KSLELVKGENADLQNRAGSLQALLLEQDTRRQSTIEEFVSAKSELFSISSQLTILQSERD 761
             +L+L K EN  L+ R+ +LQ  + +QD++ Q T+ ++VS KS+L +I ++L+ L+ ER 
Sbjct: 698  NTLDLAKAENDQLRKRSINLQNAISKQDSKTQETLNDYVSCKSKLSAIETELSNLKLERT 757

Query: 762  FLRKVEADLKKENESLNKDNNDSQLLILQLKTAQKERDSLIEETRKRYETRIEELDGELS 821
               ++E +LK+E   L+ +     +++ QL+T QKER++L++ET+K  + +I+ L    +
Sbjct: 758  LKIELEKNLKQELSELSSEKTSLHIMVTQLQTLQKERENLLDETKKSCQNKIDALQNAQN 817

Query: 822  ATKQQLERKQREYDELSSSSSTQCKWFQSKLDSLKEELGSSKLALKAKTSELDALKARLN 881
              K +  RK +   +L   + ++ +W+Q+K+++L+++  S   +L  K  E++  +  + 
Sbjct: 818  ELKTEAIRKDQYIKQLEEDNDSKIEWYQNKIETLRKDHESVMSSLNEKQIEVERFQYEIK 877

Query: 882  SSTSKLEPASMDHQQSSLVLESDHASRVQSLSKDLDEANRKLSSAYSEIERYKAASNATE 941
            S   ++E   +     +++   D +    SL ++L+++   L+ AYS+I+ YK     T+
Sbjct: 878  SLEKEIEENKIRLHTYNVL---DESINDDSLRRELEKSKINLTDAYSQIQEYKKLYETTD 934

Query: 942  RP--SLSYNAVQDNKDGSKQAAISLEAELTKLNSDIAMANDRIKVLEDELNRREATYSTE 999
            +    +S    + NK  S Q   +L  E T L   +++  +++  L +EL+ +      E
Sbjct: 935  KSLQEMSSQLDESNKAFSNQIQ-NLTDEKTSLEDKVSLLREQMSNLNNELDLQNQAMEKE 993

Query: 1000 RSELQEKINALVTDKQRIEEAKADYQQKITQLQTDLEKQISSTNEAETKYQTALQKQAEI 1059
            ++E ++KI+ L  + + IE  K +Y+ K++++Q DL++Q    N A+  Y+  LQK A++
Sbjct: 994  KAEFKKKISILQNNNKEIEAVKTEYESKLSKIQKDLDQQTIYANTAQNNYEQELQKHADV 1053

Query: 1060 SENIESLRKSSESYKSEIAKFKSAAEEARKVLERNEQTWDQQKADIEANLDLAHQRIEEL 1119
            S+ I  LR+   +YK ++     A  +  K L+ NE  W+ QK  +   LDL++ RIE+L
Sbjct: 1054 SKTISELREQLHTYKGQVETLNLARGQFEKALKENETNWNSQKESLLEQLDLSNSRIEDL 1113

Query: 1120 STQNRLLYDQIXXXXXXXXXXXXXDTKISSD-ARELIVTLRRERDILETKIDVSKREEKM 1178
            S+QN+LLYDQI             D K  S    ++++TLRRERDIL+TK+ V++R+ KM
Sbjct: 1114 SSQNKLLYDQI--ELYTTTGNKPTDAKSGSVLNNDILITLRRERDILDTKVAVAERDAKM 1171

Query: 1179 LRQRLELTKSELDNLRAQLSESKGLVTEGTDSSQNQEELFEKLNQLNLLREHNMSLRNES 1238
            LRQ++ L   EL   R +L  SK    + +   Q  +E+ EKLNQLNLLRE N +LRNE 
Sbjct: 1172 LRQKISLIDVELQEARTKLCNSKVENEKRSFIIQQHDEVMEKLNQLNLLRESNTTLRNEL 1231

Query: 1239 EKVSEHNEFLQNEILSLQEKVQPMEEQIKSLTATXXXXXXXXXXXXXXSDRWKQRSQDIL 1298
            +  +  N+ LQ+E+  L+  + P+E ++ +L  +                RWK+RSQDI+
Sbjct: 1232 DSSNSKNKELQSELERLRGNIAPIESELAALKFSIQEKEQEIRLTKEEVHRWKKRSQDIM 1291

Query: 1299 HKYERIDPEEYRKLASEIEVLKAELERKSAESIDSQERFRKLRKQANER----------- 1347
             K++++   +Y KL +EIE LKA+LE K+ +  DS+E+F +LR+QA E+           
Sbjct: 1292 EKHQQLSSTDYEKLETEIESLKAQLEDKTQQGADSEEKFNRLRRQAQEKLKASKLSQDSF 1351

Query: 1348 ---LDEFKAAKAKVESELELALSGKSQLE-AKLSEAREKITSLETQLTERPASEDDNPVS 1403
               L+E K AK  +E  L  A +   +LE AK++E R +++ +      +   ED    S
Sbjct: 1352 IEQLNELKDAKLALEKSLNNANARIQELEDAKVAENRNQLSMI------KKLQEDTEENS 1405

Query: 1404 HELEETKTKLQDAENTINMLKSEWSISEESFKKQLDE----LNKQLETIQKNXXXXXXXX 1459
             ELE   TKL+           E +IS +S  K+L+E    L ++LE  ++         
Sbjct: 1406 KELE---TKLE-----------ENAISYDSTVKKLNEEIGILKEELE--KQRQIQQQFQA 1449

Query: 1460 XXXXYHEQPTAVLEDFKKQVEEERRTLIESHQQELTARLEASRKNFXXXXXXXXXXXRDS 1519
                  +  + V+E  K+  EE++   IE   +E+  ++   ++                
Sbjct: 1450 AAGTEQDDLSKVVESMKRSFEEDKIKFIEEKTREVNQKIREFQE-------------AQE 1496

Query: 1520 LTNVSVEAASQNLEALKKKWEEEYEQQTLQRIREAEEALKKRIRLPSEERINQVIERKQK 1579
                 ++ ++ N++ +KK+WE E+ ++  ++IREAEEALKKRIRLP+EE+I+++IERK++
Sbjct: 1497 AEETGLKPSNINIDEIKKQWEAEHNEEVSKKIREAEEALKKRIRLPTEEKISKIIERKKE 1556

Query: 1580 ALEQEFTTKV------------------------------------NATALALLKENP-- 1601
             LE+EF  KV                                    N      L+E P  
Sbjct: 1557 DLEKEFDEKVEERLKSISQSGKMEDIFQKQLESRIQEKQKELENEYNKKLQEKLRELPSS 1616

Query: 1602 DSIASDKADLIKDHQKEIVQLKKDLADKFEGQLVQVKKKAFEEGRQQGIMKVKLLESKIS 1661
            D I+SD  D ++        ++  L ++F  +L  +KKK+FEEG+QQ +MK  LLE K++
Sbjct: 1617 DIISSDDKDKLR------ADIEAQLREEFNHELQTIKKKSFEEGKQQAMMKTTLLERKLA 1670

Query: 1662 KLESQ---------------AKAP---LGTNVPTKIPLENTQPLAQQVPVKP 1695
            K+ESQ               +K P   LG  +P KI  EN+ P     P  P
Sbjct: 1671 KMESQLSETKQSVDSPPKHLSKMPNPLLG--LPRKIE-ENSNP-----PYNP 1714

>YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}
            MLP1Myosin-like protein associated with the nuclear
            envelope, connects the nuclear pore complex with the
            nuclear interior; involved with Tel1p in telomere length
            control; involved with Pml1p and Pml39p in nuclear
            retention of unspliced mRNAs
          Length = 1875

 Score =  695 bits (1793), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 549/1710 (32%), Positives = 931/1710 (54%), Gaps = 162/1710 (9%)

Query: 112  ERVQQQLEE-TERRVAAGDSARRDLARLLEEKISDLDASQQELERVLGVNKELRRHEMEL 170
            E V+++L++ TE +     + +R L ++L+E++ +++  + E  R     K+LR   M+L
Sbjct: 121  EFVKRKLDDLTEEKKETQSNQQRTL-KILDERLKEIELVRVENNRSNSECKKLRSTIMDL 179

Query: 171  EFTVQSQRSQSLREQAEIQRLQQELALVRSNAEWTTGQLNEKNQQLNSYREKTNGEIQST 230
            E   Q   +  L  + E++R  QEL L++SN +W   +L  KN+Q  SYR+KT+  I   
Sbjct: 180  ETKQQGYITNDLNSRTELERKTQELTLLQSNNDWLEKELRSKNEQYLSYRQKTDKVILDI 239

Query: 231  QVELNIVKNELEVEHANVAALRSKNGELSKQLQDALCETKRLTDSLHSEKQEFAREMALK 290
            + ELN ++N+ ++E  N   L+ KN ELSK LQ+ L E K L+DSL+SEKQEF+ EM+LK
Sbjct: 240  RNELNRLRNDFQMERTNNDVLKQKNNELSKSLQEKLLEIKGLSDSLNSEKQEFSAEMSLK 299

Query: 291  QRLIELLNGQVATMKQDLEK------AYDVAKNGGMSDSERERLLNDLFDTKKKLELSQA 344
            QRL++LL  Q+  +K++L        A  +A +      E E LL +L  TK+KL   + 
Sbjct: 300  QRLVDLLESQLNAVKEELNSIRELNTAKVIADDSKKQTPENEDLLKELQLTKEKLAQCEK 359

Query: 345  NVSRLEDTIKELLETDNVQSGGRNGIEHANVGSPSGGSTISTVYGDLAALRKQLVQERRH 404
               RL  +I +  + DN            N+ + S          D   L+KQL++ERR 
Sbjct: 360  ECLRL-SSITDEADEDN-----------ENLSAKSSS--------DFIFLKKQLIKERRT 399

Query: 405  KEELQLQVESFVVELEHKIPVLNSFKKRIEELEKQLNGVTLLLEATARERDEKVVQIKQY 464
            KE LQ Q+E+F+VELEHK+P++NSFK+R + LE +LN   LLLE T+ E++ KV ++   
Sbjct: 400  KEHLQNQIETFIVELEHKVPIINSFKERTDMLENELNNAALLLEHTSNEKNAKVKELNAK 459

Query: 465  KNKVGDYETQVGHLVQQRSDLARQVQCLLIHISVRDDSSGPLTAEEVEFVKKLQSCRDSA 524
              K+ + E  +  L +QR DL RQ+Q LLI  SV +DS GPL  EE++F++ +    DS 
Sbjct: 460  NQKLVECENDLQTLTKQRLDLCRQIQYLLITNSVSNDSKGPLRKEEIQFIQNIMQEDDST 519

Query: 525  -TGSDTQAIISNRLVEFKSVVELQQKNAELLNAIRQLAQKLEQEEHKTQSKVKSLEQNTV 583
             T SD+Q +++ RLVEFK++++LQ+KNAELL  +R LA KLE +E K++  ++ +E  TV
Sbjct: 520  ITESDSQKVVTERLVEFKNIIQLQEKNAELLKVVRNLADKLESKEKKSKQSLQKIESETV 579

Query: 584  NEAKEAILSLQEHVQMLEDQLETVTTERDSFKLLVSEGKNNSLPN--------PVGAAAL 635
            NEAKEAI++L+     LE ++E +  E         E    S+PN         +     
Sbjct: 580  NEAKEAIITLKSEKMDLESRIEELQKE--------LEELKTSVPNEDASYSNVTIKQLTE 631

Query: 636  QPQEVADGIAHLEARLKAMAEESEQHAKMLNEEIKALYKSNSQLAIXXXXXXXXXXXADE 695
              +++   +  L+ R+  +  ES ++  +LN+EI+ LY S S ++I           A+E
Sbjct: 632  TKRDLESQVQDLQTRISQITRESTENMSLLNKEIQDLYDSKSDISIKLGKEKSSRILAEE 691

Query: 696  KLSLIQKSLELVKGENADLQNRAGSLQALLLEQDTRRQSTIEEFVSAKSELFSISSQLTI 755
            +  L+  +L+L K EN  L+ R   LQ  +L+QD++   T+ E+VS KS+L  + ++L  
Sbjct: 692  RFKLLSNTLDLTKAENDQLRKRFDYLQNTILKQDSKTHETLNEYVSCKSKLSIVETELLN 751

Query: 756  LQSERDFLRKVEADLKKENESLNKDNNDSQLLILQLKTAQKERDSLIEETRKRYETRIEE 815
            L+ E+     +E +LK+E   L+ + +  ++++ QL+T QKER+ L+EETRK  + +I+E
Sbjct: 752  LKEEQKLRVHLEKNLKQELNKLSPEKDSLRIMVTQLQTLQKEREDLLEETRKSCQKKIDE 811

Query: 816  LDGELSATKQQLERKQREYDELSSSSSTQCKWFQSKLDSLKEELGSSKLALKAKTSELDA 875
            L+  LS  K++  +K     +L   +++  +W+Q+K+++LK++  S   ++ +K ++++ 
Sbjct: 812  LEDALSELKKETSQKDHHIKQLEEDNNSNIEWYQNKIEALKKDYESVITSVDSKQTDIEK 871

Query: 876  LKARLNSSTSKLEPASMDHQQSSLVLESDHASRVQSLSKDLDEANRKLSSAYSEIERYKA 935
            L+ ++ S   ++E   +     +++   D      SL K+L+++   L+ AYS+I+ YK 
Sbjct: 872  LQYKVKSLEKEIEEDKIRLHTYNVM---DETINDDSLRKELEKSKINLTDAYSQIKEYKD 928

Query: 936  ASNATERPSLSYNAVQDN--KDGSKQAAISLEAELTKLNSDIAMANDRIKVLEDELNRRE 993
                T +     N+  D   KD + Q   +L  E T L   I++  +++  L +EL+ ++
Sbjct: 929  LYETTSQSLQQTNSKLDESFKDFTNQIK-NLTDEKTSLEDKISLLKEQMFNLNNELDLQK 987

Query: 994  ATYSTERSELQEKINALVTDKQRIEEAKADYQQKITQLQTDLEKQISSTNEAETKYQTAL 1053
                 E+++ +++I+ L  + + +E  K++Y+ K++++Q DL++Q    N A+  Y+  L
Sbjct: 988  KGMEKEKADFKKRISILQNNNKEVEAVKSEYESKLSKIQNDLDQQTIYANTAQNNYEQEL 1047

Query: 1054 QKQAEISENIESLRKSSESYKSEIAKFKSAAEEARKVLERNEQTWDQQKADIEANLDLAH 1113
            QK A++S+ I  LR+   +YK ++     + ++    L+ NE++W  QK  +   LDL++
Sbjct: 1048 QKHADVSKTISELREQLHTYKGQVKTLNLSRDQLENALKENEKSWSSQKESLLEQLDLSN 1107

Query: 1114 QRIEELSTQNRLLYDQIXXXXXXXXXXXXXDTKISSDARELIVTLRRERDILETKIDVSK 1173
             RIE+LS+QN+LLYDQI             ++        +++TLRRERDIL+TK+ V++
Sbjct: 1108 SRIEDLSSQNKLLYDQI--QIYTAADKEVNNSTNGPGLNNILITLRRERDILDTKVTVAE 1165

Query: 1174 REEKMLRQRLELTKSELDNLRAQLSESKGLVTEGTDSSQNQEELFEKLNQLNLLREHNMS 1233
            R+ KMLRQ++ L   EL + R +L  S+      +   Q  +++ EKLNQLNLLRE N++
Sbjct: 1166 RDAKMLRQKISLMDVELQDARTKLDNSRVEKENHSSIIQQHDDIMEKLNQLNLLRESNIT 1225

Query: 1234 LRNESEKVSEHNEFLQNEILSLQEKVQPMEEQIKSLTATXXXXXXXXXXXXXXSDRWKQR 1293
            LRNE E  +   + LQ+E+  L++ V P+E ++ +L  +                RWK+R
Sbjct: 1226 LRNELENNNNKKKELQSELDKLKQNVAPIESELTALKYSMQEKEQELKLAKEEVHRWKKR 1285

Query: 1294 SQDILHKYERIDPEEYRKLASEIEVLKAELERKSAESIDSQERFRKLRKQANERLDEFKA 1353
            SQDIL K+E++   +Y KL SEIE LK ELE K  +  +++E+F +LR+QA ERL   K 
Sbjct: 1286 SQDILEKHEQLSSSDYEKLESEIENLKEELENKERQGAEAEEKFNRLRRQAQERLKTSKL 1345

Query: 1354 AKAKVESELELALSGKSQLEAKLSEAREKITSLETQLTERPASEDDNPVSHELEETKTKL 1413
            ++  +  ++      K+ LE  LSEA  +I  L+     +         +++LE  +   
Sbjct: 1346 SQDSLTEQVNSLRDAKNVLENSLSEANARIEELQNAKVAQG--------NNQLEAIRKLQ 1397

Query: 1414 QDAENTINMLKSEWSISEESFKKQLDELNKQLETIQ---KNXXXXXXXXXXXXYHEQP-- 1468
            +DAE     L+++   S  S++  ++ LN+++ T++   +              +EQ   
Sbjct: 1398 EDAEKASRELQAKLEESTTSYESTINGLNEEITTLKEEIEKQRQIQQQLQATSANEQNDL 1457

Query: 1469 TAVLEDFKKQVEEERRTLIESHQQELTARLEASRKNFXXXXXXXXXXXRDSLTNVSVEAA 1528
            + ++E  KK  EE++   I+   QE+  ++  +++                      + +
Sbjct: 1458 SNIVESMKKSFEEDKIKFIKEKTQEVNEKILEAQERLN-------------------QPS 1498

Query: 1529 SQNLEALKKKWEEEYEQQTLQRIREAEEALKKRIRLPSEERINQVI-------------- 1574
            + N+E +KKKWE E+EQ+  Q+IREAEEALKKRIRLP+EE+IN++I              
Sbjct: 1499 NINMEEIKKKWESEHEQEVSQKIREAEEALKKRIRLPTEEKINKIIERKKEELEKEFEEK 1558

Query: 1575 --------------------------ERKQKALEQEFTTKVNATALALLKENPDS--IAS 1606
                                      + KQK LE E+  K+       LK+ P S  I+ 
Sbjct: 1559 VEERIKSMEQSGEIDVVLRKQLEAKVQEKQKELENEYNKKLQEE----LKDVPHSSHISD 1614

Query: 1607 DKADLIKDHQKEIVQLKKDLADKFEGQLVQVKKKAFEEGRQQGIMKVKLLESKISKLESQ 1666
            D+ D ++       +++  L ++F  +L  +KKK+F+EG+QQ +MK  LLE K++K+ESQ
Sbjct: 1615 DERDKLR------AEIESRLREEFNNELQAIKKKSFDEGKQQAMMKTTLLERKLAKMESQ 1668

Query: 1667 -AKAPLGTNVPTKIPLENTQPLAQQVPVK-----PSPF----------QLAYAQATFGNV 1710
             ++       P K  + N Q     +P K      SPF          +L    ++ G  
Sbjct: 1669 LSETKQSAESPPK-SVNNVQNPLLGLPRKIEENSNSPFNPLLSGEKLLKLNSKSSSGGFN 1727

Query: 1711 PF--------LFNKNSEQKKVEHQDDSDSH 1732
            PF        L N N +++ + ++ D  +H
Sbjct: 1728 PFTSPSPNKHLQNDNDKRESLANKTDPPTH 1757

>ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] {ON}
            some similarities with uniprot|Q02455 Saccharomyces
            cerevisiae YKR095W MLP1 Myosin-like protein associated
            with the nuclear envelope, connects the nuclear pore
            complex with the nuclear interior; involved in the Tel1p
            pathway that controls telomere length; involved in the
            retention of unspliced mRNAs in the nucleus
          Length = 1820

 Score =  688 bits (1776), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/1278 (36%), Positives = 760/1278 (59%), Gaps = 38/1278 (2%)

Query: 132  RRDLARLLEEKISDLDASQQELERVLGVNKELRRHEMELEFTVQSQRSQSLREQAEIQRL 191
            +R++  +LEEKI +L++ + E  + L  +K LR+  +ELE TVQ+ +S+ LR+Q+EIQ +
Sbjct: 143  KREVVAVLEEKIKELESFRTESRKSLDDSKRLRQQVLELETTVQNLKSKELRDQSEIQTI 202

Query: 192  QQELALVRSNAEWTTGQLNEKNQQLNSYREKTNGEIQSTQVELNIVKNELEVEHANVAAL 251
             Q L +++ N++W   ++  K +QL S R K + E+     E    KNEL++E +    +
Sbjct: 203  TQRLTILQKNSQWLEEEVTSKTEQLISTRRKNDDELDRLTSESLSCKNELQLEKSRNQVI 262

Query: 252  RSKNGELSKQLQDALCETKRLTDSLHSEKQEFAREMALKQRLIELLNGQVATMKQDLEKA 311
             +KN EL+K LQ+ L E K L+DSL+ EKQEFA EM++KQ+LI+LL  QV +++ +L  +
Sbjct: 263  TTKNEELTKSLQEKLMEMKDLSDSLYREKQEFAHEMSMKQKLIDLLENQVKSLQGELNAS 322

Query: 312  YDVAK----NGGMSDSERERLLNDLFDTKKKLELSQANVSRLEDTIKELLETDNVQSGGR 367
             D         G  ++E E+L+ +L   K+  E S+    RLE  ++EL+  D+ Q    
Sbjct: 323  LDKDNVELLASGERNTENEKLIQELITLKENFEESERERLRLEALVQELIPGDDSQDDIN 382

Query: 368  NGIEHANVGSPSGGSTISTVYGDLAALRKQLVQERRHKEELQLQVESFVVELEHKIPVLN 427
            N     ++ +            D+  L+K+L++ER  KE LQ QVESF+VELE+KIPV+N
Sbjct: 383  NTSSFISLRNKDSS------LRDMGILKKELIKERHQKERLQRQVESFIVELEYKIPVIN 436

Query: 428  SFKKRIEELEKQLNGVTLLLEATARERDEKVVQIKQYKNKVGDYETQVGHLVQQRSDLAR 487
            SFK+R   LEK+LN V LLL+ T+ E++++  + +    KV D E+ +  L +QR+DLA 
Sbjct: 437  SFKERTSMLEKELNDVALLLDHTSNEKEKREREFEALSKKVKDSESSIHTLTRQRTDLAH 496

Query: 488  QVQCLLIHISVRDDSSGPLTAEEVEFVKKLQSCRDSATGSDTQAIISNRLVEFKSVVELQ 547
            QVQ LL++ISV+ DS G L+AEEV F+K++ +  D  + SD+Q +IS RLVEF ++  LQ
Sbjct: 497  QVQFLLMNISVQVDSGGLLSAEEVSFIKRIVNNDDPNSESDSQRVISERLVEFNNIATLQ 556

Query: 548  QKNAELLNAIRQLAQKLEQEEHKTQSKVKSLEQNTVNEAKEAILSLQEHVQMLEDQLETV 607
            +KN ELL  +R+LA+KLE EE     K+++ E +T+ EAKEAI+SLQ++   LE ++E +
Sbjct: 557  EKNMELLKTVRKLAEKLESEEKDVNKKIQTFENDTIKEAKEAIVSLQDYNANLESKVEIL 616

Query: 608  TTERDSFKLLVSEG---KNNSLPNPVGAAALQPQEVADGIAHLEARLKAMAEESEQHAKM 664
            T E D+FK + S     +N SL               + +  LEARL ++  ES Q+ KM
Sbjct: 617  TKECDAFKAICSRNGSDQNGSLSANGTQGNRNGSSDEEKLRTLEARLTSLTVESSQNNKM 676

Query: 665  LNEEIKALYKSNSQLAIXXXXXXXXXXXADEKLSLIQKSLELVKGENADLQNRAGSLQAL 724
            LN EI  LY+S +Q++I            +E+L LIQ +LEL + EN  L  R+ +LQ++
Sbjct: 677  LNNEIHELYRSKTQISIELEKERSSKTLTEERLKLIQHTLELTRNENQQLVKRSQNLQSI 736

Query: 725  LLEQDTRRQSTIEEFVSAKSELFSISSQLTILQSERDFLRKVEADLKKENESLNKDNNDS 784
               QD+R   T+ E ++  S+L  + +++  L++E++ L+  E   ++    L+++ N  
Sbjct: 737  FDRQDSRTAETVNELIACNSKLAVLETKVANLETEKELLQSSERTSRENYLKLSEERNSL 796

Query: 785  QLLILQLKTAQKERDSLIEETRKRYETRIEELDGELSATKQQLERKQREYDELSSSSSTQ 844
            ++++ QL+T Q ER+  ++E +  Y+  ++ L+ E +  + +L+ K +E +++ +S  TQ
Sbjct: 797  RIMVSQLQTLQSEREKFLKEIQTTYKENLDSLEQEKADARARLDAKTKEAEDMENSKRTQ 856

Query: 845  CKWFQSKLDS-------LKEELGSSKLALKAKTSELDALKARLNSSTSKLEPASMDHQQS 897
             +W+Q KLDS       LK+EL +    +    SE+  L+ ++  S +++        QS
Sbjct: 857  IQWYQDKLDSVVAESQHLKQELQTKTFLVTDLESEVRKLEKQVEESEARI--------QS 908

Query: 898  SLVLESDHA--SRVQSLSKDLDEANRKLSSAYSEIERYKAASNATERPSLSYNAVQDNKD 955
              VL       S   SL K+L++    LS  Y+EI++YK   + TE  SLS    QD   
Sbjct: 909  YQVLSGSEVETSPESSLRKELEKTKINLSDTYAEIDQYKNLLSTTEE-SLS-QLTQDYAS 966

Query: 956  GSKQAAI---SLEAELTKLNSDIAMANDRIKVLEDELNRREATYSTERSELQEKINALVT 1012
            G ++  +   +L+ E ++L   +A  N+ +  LE+ L         E++ LQ+KI  L T
Sbjct: 967  GKQELQLQVETLQNEKSQLQDVVAKLNESVTKLEESLQDANKAAENEKNTLQKKIATLET 1026

Query: 1013 DKQRIEEAKADYQQKITQLQTDLEKQISSTNEAETKYQTALQKQAEISENIESLRKSSES 1072
            + +   + K +Y  +I +LQ DLE+Q S  N A+  Y+  LQK + +S+ I  LR+ S+ 
Sbjct: 1027 ESKGSHQLKEEYDAQILKLQRDLEQQASFANRAQRNYEEELQKDSNVSKTISELREQSQK 1086

Query: 1073 YKSEIAKFKSAAEEARKVLERNEQTWDQQKADIEANLDLAHQRIEELSTQNRLLYDQIXX 1132
             +  I + K++ E+ R+VLE+NE++W  QK + E  L+ + Q +E+LSTQN LLYDQI  
Sbjct: 1087 DRIAITRLKNSEEQVRQVLEQNEKSWSAQKEEYERQLETSRQHLEDLSTQNSLLYDQIEL 1146

Query: 1133 XXXXXXXXXXXDTKISSDARELIVTLRRERDILETKIDVSKREEKMLRQRLELTKSELDN 1192
                       +T   ++ RE++  LRRERDIL TK+ VS+REE+ LR  L   ++ELD 
Sbjct: 1147 FSKDNSDGVNGET---AEVREILTNLRRERDILGTKLTVSQREEQTLRGSLASVENELDT 1203

Query: 1193 LRAQLSESKGLVTEGTDSSQNQEELFEKLNQLNLLREHNMSLRNESEKVSEHNEFLQNEI 1252
             + QLS+ +  +T  ++     E++ E+LNQLNLLRE N++LRN +E+ ++ N  LQ E+
Sbjct: 1204 TKRQLSQFQKEITTHSELIGQHEKIIEQLNQLNLLRESNITLRNAAEEENKKNRELQEEL 1263

Query: 1253 LSLQEKVQPMEEQIKSLTATXXXXXXXXXXXXXXSDRWKQRSQDILHKYERIDPEEYRKL 1312
              L+E++ P+E ++ +L  +              ++RWK+RSQ+ILHK++RIDPE++++L
Sbjct: 1264 NQLRERILPLESELNTLHTSVLEKDQQLNLYKEEANRWKERSQEILHKHDRIDPEDHKEL 1323

Query: 1313 ASEIEVLKAELERKSAESIDSQERFRKLRKQANERLDEFKAAKAKVESELELALSGKSQL 1372
              ++ +L+ +L+  + E+ +  +RF +L+KQA+E+L+  K A+  + ++L      KS+L
Sbjct: 1324 KEKVSILETKLDETNKENKELDDRFNRLKKQAHEKLNSSKIAQTTLSNQLNELREAKSEL 1383

Query: 1373 EAKLSEAREKITSLETQL 1390
            E K      K+  L+ +L
Sbjct: 1384 EGKFEAEERKVHELQERL 1401

>Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR095W
            (REAL)
          Length = 1885

 Score =  688 bits (1776), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 541/1618 (33%), Positives = 895/1618 (55%), Gaps = 145/1618 (8%)

Query: 137  RLLEEKISDLDASQQELERVLGVNKELRRHEMELEFTVQSQRSQSLREQAEIQRLQQELA 196
            ++L+E++ +++ ++ E  R     + LR   +ELE   Q+  +  L  ++E++R  QEL 
Sbjct: 146  KILDERLKEVEMAKVENNRTNNECRNLRSTVVELETKQQTYITNDLNSRSELERKTQELN 205

Query: 197  LVRSNAEWTTGQLNEKNQQLNSYREKTNGEIQSTQVELNIVKNELEVEHANVAALRSKNG 256
            L++SN +W   +L+ K++Q  SYR++T+  I   + ELN +KN+ ++E  N   L+ KN 
Sbjct: 206  LLQSNKDWLEKELSSKSEQYLSYRQRTDATISEIRSELNRLKNDFQLEKTNNDVLKQKNN 265

Query: 257  ELSKQLQDALCETKRLTDSLHSEKQEFAREMALKQRLIELLNGQVATMKQDLEKAYDVAK 316
            ELS  LQ+ + + K L+DSL++EKQEF+ E+ALKQRLI+LL  Q+  +K++L+       
Sbjct: 266  ELSNSLQEKVLDLKNLSDSLNTEKQEFSTEIALKQRLIDLLETQLNAVKEELKSIRKSDS 325

Query: 317  NGGMSD------SERERLLNDLFDTKKKLELSQANVSRLEDTIKELLETDNVQSGGRNGI 370
            +   SD      SE E LL DL  TK+KL   ++   RL    +E               
Sbjct: 326  SNVTSDDSRKLISENESLLKDLRLTKEKLAQCESECLRLSSITEE--------------- 370

Query: 371  EHANVGSPSGGSTISTVYGDLAALRKQLVQERRHKEELQLQVESFVVELEHKIPVLNSFK 430
                 G  SG  T S    D   L+KQ ++E+R KE+LQ Q+ESF+VELEHK+PV+NSFK
Sbjct: 371  ----TGEESGTLT-SRSSTDFILLKKQYIKEKRAKEQLQNQIESFIVELEHKVPVINSFK 425

Query: 431  KRIEELEKQLNGVTLLLEATARERDEKVVQIKQYKNKVGDYETQVGHLVQQRSDLARQVQ 490
            +R + LE +LN   LLLE T+ E++ K+ ++     K+   E  +  L +QR DL RQVQ
Sbjct: 426  ERTDMLENELNNSALLLEHTSNEKNAKIRELNIKNEKIAKCENDIHILTRQRLDLCRQVQ 485

Query: 491  CLLIHISVRDDSSGPLTAEEVEFVKK-LQSCRDSATGSDTQAIISNRLVEFKSVVELQQK 549
             LLI  SV +DS GPL  EE++F++  LQ+     T SD+Q I++ RLVEF++V+ELQ+K
Sbjct: 486  YLLITNSVSNDSKGPLRKEEIKFIQNILQNDNSGTTESDSQKILTGRLVEFRNVIELQEK 545

Query: 550  NAELLNAIRQLAQKLEQEEHKTQSKVKSLEQNTVNEAKEAILSLQEHVQMLEDQLETVTT 609
            N ELL   R LA KLE  E K++  +  +E  T+NEAKEAILSLQ     LE ++E +  
Sbjct: 546  NTELLRITRNLADKLESNEIKSKQNLLKIENKTINEAKEAILSLQSEKMSLESKVEELER 605

Query: 610  ERDSFKLLVSE---GKNNSLPNPVGAAALQPQEVADGIAHLEARLKAMAEESEQHAKMLN 666
            ER++ K  +S+     NNS+   +       +E+   +  L+AR+  +  ES Q+  +LN
Sbjct: 606  ERETLKSSISKQASSFNNSVIQQLTKT---KRELESQVQDLQARISQITRESTQNMSLLN 662

Query: 667  EEIKALYKSNSQLAIXXXXXXXXXXXADEKLSLIQKSLELVKGENADLQNRAGSLQALLL 726
            +EI+ +Y S S ++I           A+E+  L+  +L+L K EN  L+ R+ SLQ+ + 
Sbjct: 663  KEIQDIYDSKSDISIELGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRSDSLQSSIS 722

Query: 727  EQDTRRQSTIEEFVSAKSELFSISSQLTILQSERDFLRKVEADLKKENESLNKDNNDSQL 786
            +QD++   T+ E++S KS+L    + L+ L+ E+      E  LK+E + L+ +    ++
Sbjct: 723  KQDSKTHETLNEYISCKSKLSVTETALSNLKLEQKLKIDSEKSLKQELDKLSSEKTSLRI 782

Query: 787  LILQLKTAQKERDSLIEETRKRYETRIEELDGELSATKQQLERKQREYDELSSSSSTQCK 846
            ++ QL+T QKER+ L++E RK  + +I E++   +  K +   K +   +L   ++++ +
Sbjct: 783  MVTQLQTLQKEREDLLDEARKSCQNKINEVEEAYNELKVETSHKDQHIMQLEEDNTSKIE 842

Query: 847  WFQSKLDSLKEELGSSKLALKAKTSELDALKARLNSSTSKLEPASMDHQQSSLVLESDHA 906
            W+Q+K+++LK++  S    +  K +E++ L+ ++ S   ++E   +     +++   D  
Sbjct: 843  WYQNKIETLKKDNDSVMNLVNEKQTEIEKLQYKVKSLEKEIEENKIRLHTYNVM---DET 899

Query: 907  SRVQSLSKDLDEANRKLSSAYSEIERYKAASNATERPSLSYNAVQDNKDGSKQAAI-SLE 965
                SL K+L+ +   L+ AYS+I+ YK    +T +     N+  D  + +    I SL 
Sbjct: 900  INDDSLRKELEMSKINLTEAYSQIQEYKKLYESTAQSLREMNSKLDESNEAFSNQIQSLT 959

Query: 966  AELTKLNSDIAMANDRIKVLEDELNRREATYSTERSELQEKINALVTDKQRIEEAKADYQ 1025
             E   L   +++  ++   L +EL+ ++     ++ E ++ I  L  + + IE  K++Y+
Sbjct: 960  DEKINLEDKVSLLKEQSFNLNNELDLQKNEMEKKKVEFKKIIAILQNNNKEIETVKSEYE 1019

Query: 1026 QKITQLQTDLEKQISSTNEAETKYQTALQKQAEISENIESLRKSSESYKSEIAKFKSAAE 1085
             K++++Q DL++Q    N A+  Y+  LQK A++S+ I  LR+   +Y+ ++     +  
Sbjct: 1020 SKLSKIQDDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRGQVKTLTLSRS 1079

Query: 1086 EARKVLERNEQTWDQQKADIEANLDLAHQRIEELSTQNRLLYDQIXXXXXXXXXXXXXDT 1145
            E   +L+ NE++W  QK  +   LDL++ RIE+LS+QN+LLY+QI               
Sbjct: 1080 ELENILKENEKSWTSQKQSLLEQLDLSNSRIEDLSSQNKLLYNQIELYTAAGNGV----- 1134

Query: 1146 KISSDAR-------ELIVTLRRERDILETKIDVSKREEKMLRQRLELTKSELDNLRAQLS 1198
                DAR       +++VTLRRERDIL+TK+ V++R+ KMLRQ++ L   EL + R +L+
Sbjct: 1135 ---GDARNGPTLNNDILVTLRRERDILDTKVTVAERDAKMLRQKITLMDVELQDARTKLN 1191

Query: 1199 ESKGLVTEGTDSSQNQEELFEKLNQLNLLREHNMSLRNESEKVSEHNEFLQNEILSLQEK 1258
             S+    E +   Q  + + EKLNQLNLLRE N++LRNE E  S+ N+ LQ+E++ L+E 
Sbjct: 1192 NSRVENDERSSIVQQHDVIMEKLNQLNLLRESNITLRNELENCSKKNKELQSELVKLKEI 1251

Query: 1259 VQPMEEQIKSLTATXXXXXXXXXXXXXXSDRWKQRSQDILHKYERIDPEEYRKLASEIEV 1318
            + P+E ++ +L  +                RWK+RSQDIL K++++   +Y KL SE+E 
Sbjct: 1252 IAPIESELSALKYSMQEKEQEIRLAKEEVHRWKKRSQDILEKHQQLSSNDYEKLESEVES 1311

Query: 1319 LKAELERKSAESIDSQERFRKLRKQANERLDEFKAAKAKVESELELALSGKSQLEAKLSE 1378
            LKA+LE K  +  +++ERF +LR+QA E+L   K  +  +  +L      K  LE  L++
Sbjct: 1312 LKAQLEDKMQQGTEAEERFNRLRRQAQEKLKTSKLTQETLTEQLNELKDAKVALERSLND 1371

Query: 1379 AREKITSLE----------TQLTERPASEDDNPVSHELEETKTKLQD----AENTINMLK 1424
            A  +I  LE          +++ +R + ED    S ELEE   KL++      +T+  L 
Sbjct: 1372 ANTRIQELEGEKVAEDNNRSEMIKR-SQEDAEKSSRELEE---KLEENAISYSSTVRKLN 1427

Query: 1425 SEWSISEESFKKQLDELNKQLETIQKNXXXXXXXXXXXXYHEQPTAVLEDFKKQVEEERR 1484
             E +  +E  +KQ  ++ KQL+T                  E  + ++E  KK  EE++ 
Sbjct: 1428 EEIATLKEEIEKQ-GQIQKQLQT------------AAGHRDEDLSNIVESMKKSFEEDKI 1474

Query: 1485 TLIESHQQELTARLEASRKNFXXXXXXXXXXXRDSLTNVSVEAASQNLEALKKKWEEEYE 1544
              IE   +E+  +++ +++                      + +S N++ +KK+WE E+E
Sbjct: 1475 KFIEEKTREVNKKIQEAQERLN-------------------QPSSVNIDEMKKQWEAEHE 1515

Query: 1545 QQTLQRIREAEEALKKRIRLPSEERINQVIERKQKALEQEFTTKVNATAL---------A 1595
            ++  +R+REAEEALKKRIRLP+EE+I+++IERK++ LE+EF  K+              A
Sbjct: 1516 EEVAERVREAEEALKKRIRLPTEEKISKIIERKKEDLEKEFNEKLEEKVKSISGSEQMEA 1575

Query: 1596 LLKENPDSIASDKADLIKDHQKEIVQLK--------------KD---------LADKFEG 1632
            +L++  +    +K   ++D   E +Q K              KD         L ++   
Sbjct: 1576 MLQKQLEIRVQEKQKELEDEYNEKLQEKLKEVSHSSSISVNEKDELRAEIEAKLREELND 1635

Query: 1633 QLVQVKKKAFEEGRQQGIMKVKLLESKISKLESQ-------AKAPL--GTNVPTKIPL 1681
            +L  VKKK+FEEG+QQ  MK  LLE K++K+ESQ       A++P     NVP   PL
Sbjct: 1636 ELQNVKKKSFEEGKQQATMKTTLLERKLAKMESQLSEIKQSAESPPKHANNVPN--PL 1691

>Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR095W
            (REAL)
          Length = 1878

 Score =  685 bits (1768), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 512/1577 (32%), Positives = 883/1577 (55%), Gaps = 109/1577 (6%)

Query: 137  RLLEEKISDLDASQQELERVLGVNKELRRHEMELEFTVQSQRSQSLREQAEIQRLQQELA 196
            ++L+E++ +L+ ++ +  R     K LR   ++LE   Q   +  L  +AE++R  QEL 
Sbjct: 146  KILDERLKELEIARSDNNRSDNECKRLRSTIIDLETKQQDLITSDLNSRAELERKAQELN 205

Query: 197  LVRSNAEWTTGQLNEKNQQLNSYREKTNGEIQSTQVELNIVKNELEVEHANVAALRSKNG 256
            +++S  +W   +L  KN+Q  SYR+KT+  I   + ELN ++++ +VE      L  KN 
Sbjct: 206  ILQSTNDWLEKELCSKNEQYLSYRKKTDKIILEIRNELNHLRSDFQVEKTKNDVLTQKND 265

Query: 257  ELSKQLQDALCETKRLTDSLHSEKQEFAREMALKQRLIELLNGQVATMKQDLE--KAYDV 314
            ELSK LQ+ L E K L+D L SEKQEF+ E+ LKQRL++LL  Q+  +K++L+  +  + 
Sbjct: 266  ELSKSLQEKLLEIKSLSDCLSSEKQEFSTEINLKQRLVDLLESQLNAVKEELDSTRGLET 325

Query: 315  AKNGGMSDSERERLLNDLFDTKKKLELSQANVSRLEDTIKELLETDNVQSGGRNGIEHAN 374
            + +     SE+E L+ +L  TK++L   ++   RL   I E   TD              
Sbjct: 326  SNDSKKHMSEKEDLVKELQLTKEELAQCKSECIRLSSIIGE---TD-------------- 368

Query: 375  VGSPSGGSTISTVYGDLAALRKQLVQERRHKEELQLQVESFVVELEHKIPVLNSFKKRIE 434
                  GS+ S    D   L+KQL++E+R KE LQ Q+ESF++ELEHK+P++NSFK+R +
Sbjct: 369  ---EESGSSTSRSSSDFILLKKQLIKEKRAKEHLQNQIESFILELEHKVPIINSFKERTD 425

Query: 435  ELEKQLNGVTLLLEATARERDEKVVQIKQYKNKVGDYETQVGHLVQQRSDLARQVQCLLI 494
             LE +LN   LLLE T+ E++ K+ ++     K+   E  +  L++QR DL RQVQ LLI
Sbjct: 426  TLENELNNAALLLEHTSNEKNAKIRELSAKSEKLKQCENDIQTLIKQRLDLCRQVQYLLI 485

Query: 495  HISVRDDSSGPLTAEEVEFVKK-LQSCRDSATGSDTQAIISNRLVEFKSVVELQQKNAEL 553
              SV  DS GPL  EE+ F++  LQ+  D+AT +D+Q I++ RLVEF+S++ELQ+KN EL
Sbjct: 486  TNSVSKDSKGPLRKEEIMFIQNILQNDSDTATETDSQKIVTERLVEFRSIIELQEKNTEL 545

Query: 554  LNAIRQLAQKLEQEEHKTQSKVKSLEQNTVNEAKEAILSLQEHVQMLEDQLETVTTERDS 613
            L  +R LA +LE  E++++  ++ +E  T+NEAKEAIL+L+   + LE ++E +  E ++
Sbjct: 546  LKIVRNLADRLESNENESKQSLQKIESETINEAKEAILTLKAEKEQLESKVEELEKECEN 605

Query: 614  FKLLVSEGKNNSLPNPVGAAALQPQEVADGIAHLEARLKAMAEESEQHAKMLNEEIKALY 673
             K L+S  + + L + +       + +   I  L++ +  +  ES ++  +LN+EI+ LY
Sbjct: 606  SKALLSNEETSHLNSTIQQLNETKRNLECQIQDLQSNISQITRESTENMSLLNKEIQDLY 665

Query: 674  KSNSQLAIXXXXXXXXXXXADEKLSLIQKSLELVKGENADLQNRAGSLQALLLEQDTRRQ 733
             S S ++I           A+E+  L+  +L+L K EN  L+ R   LQ+ +L+QD++ Q
Sbjct: 666  DSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQLRKRFDCLQSTILKQDSKTQ 725

Query: 734  STIEEFVSAKSELFSISSQLTILQSERDFLRKVEADLKKENESLNKDNNDSQLLILQLKT 793
             T+ E++S KS+L    ++L  L+ E+      E +LK+E + L+ +    ++++ QL+T
Sbjct: 726  ETLNEYISCKSKLNICETELYNLKEEQKLKIDSEQNLKQEMQKLSSEKTGLRIMVTQLQT 785

Query: 794  AQKERDSLIEETRKRYETRIEELDGELSATKQQLERKQREYDELSSSSSTQCKWFQSKLD 853
             QKER++L++ETRK Y+ +I+EL+   +  K +   K +   +L   +++  +W+Q+K++
Sbjct: 786  LQKERENLLDETRKSYQNKIDELEHAHNELKGEASHKDQRIKQLEEDNNSSIEWYQNKIE 845

Query: 854  SLKEELGSSKLALKAKTSELDALKARLNSSTSKLEPASMDHQQSSLVLESDHASRVQSLS 913
             LK++  S   ++  K +E++ L+ ++ S   +++   +     +++   D      SL 
Sbjct: 846  VLKKDNESIICSMNDKQAEIEKLQHKVKSLEKEIDENKIRLHTYNVI---DGTINDDSLR 902

Query: 914  KDLDEANRKLSSAYSEIERYK--AASNATERPSLSYNAVQDNKDGSKQAAISLEAELTKL 971
            K+L+++   L+ AYS+I+ YK    +NA     +     + +KD S +   +L  E + L
Sbjct: 903  KELEKSKISLTDAYSQIQEYKELYETNAKSLKQMHSKFEESSKDFSNRIK-NLTNEKSSL 961

Query: 972  NSDIAMANDRIKVLEDELNRREATYSTERSELQEKINALVTDKQRIEEAKADYQQKITQL 1031
               I++  ++I  L +EL+ +      E++E ++KI+ L  + + +E  K++Y+ K++++
Sbjct: 962  EEKISLLKEQIFNLNNELDLQNKGMKEEKAEFRKKISILQNNNKEVEAVKSEYESKLSKI 1021

Query: 1032 QTDLEKQISSTNEAETKYQTALQKQAEISENIESLRKSSESYKSEIAKFKSAAEEARKVL 1091
            Q DL++Q    N A+  Y+  LQK A++S+ I  LR+   +Y+ ++     +  +    L
Sbjct: 1022 QKDLDQQTIYANTAQNNYEQELQKHADVSKTISELREQLHTYRVQVNTLTLSRNQLESTL 1081

Query: 1092 ERNEQTWDQQKADIEANLDLAHQRIEELSTQNRLLYDQIXXXXXXXXXXXXXDTKISSDA 1151
            + NE++W  Q+  +   L+ ++ RIE+L++QN+LLYDQI             + K + ++
Sbjct: 1082 KENERSWTSQRKALIEQLESSNSRIEDLTSQNKLLYDQIELYTTADKGVTDTNDKPALNS 1141

Query: 1152 RELIVTLRRERDILETKIDVSKREEKMLRQRLELTKSELDNLRAQLSESKGLVTEGTDSS 1211
              ++++LRRERDIL+TK+ V++R+ KMLRQ++ L   EL   R +L  S+    +     
Sbjct: 1142 --ILLSLRRERDILDTKVTVAERDAKMLRQKISLMDIELQEARTKLDNSRLEEEKRPTII 1199

Query: 1212 QNQEELFEKLNQLNLLREHNMSLRNESEKVSEHNEFLQNEILSLQEKVQPMEEQIKSLTA 1271
            Q  E++ EKLNQLNLLRE N++LRNE E  +E    LQ+E+  L++ + P+E ++ +L  
Sbjct: 1200 QQHEDIMEKLNQLNLLRESNITLRNELENNNEEKRVLQSELDKLKQDIAPIESELAALKY 1259

Query: 1272 TXXXXXXXXXXXXXXSDRWKQRSQDILHKYERIDPEEYRKLASEIEVLKAELERKSAESI 1331
            +                RWK+RSQDIL K+ ++   +Y KL  EI+ LK +L+ K+ +  
Sbjct: 1260 SMQEKEQELRLTKEEVHRWKKRSQDILEKHRQMSSSDYEKLEHEIDSLKVKLDEKTRQGA 1319

Query: 1332 DSQERFRKLRKQANERLDEFKAAKAKVESELELALSGKSQLEAKLSEAREKITSLETQLT 1391
            +++ERF +LR+QA ERL   K +   +  ++    + K +LE  L +A  KI  LE    
Sbjct: 1320 EAEERFNRLRRQAQERLKTSKLSLDTLTEQVNDLKNAKIKLEKSLDDANTKIEELEN--- 1376

Query: 1392 ERPASEDDNPVSHELEETKTKLQDAENTINMLKSEWSISEESFKKQLDELNKQLETIQKN 1451
                +E DN   ++L+  K   QDAEN+    K++       +   + +LN+++ T+++ 
Sbjct: 1377 --AKAEQDN---NQLDAIKRLQQDAENSSKEFKTKLEEKATFYDSTIKKLNEEIITLRE- 1430

Query: 1452 XXXXXXXXXXXXYHEQP-------TAVLEDFKKQVEEERRTLIESHQQELTARLEASRKN 1504
                           +P       + ++E  KK  EE++   I    +E+  ++  +++ 
Sbjct: 1431 -EIEKQRRIQQQLQSEPANEQNDLSKIVESMKKTFEEDKINFIREKTKEVNEKILEAQER 1489

Query: 1505 FXXXXXXXXXXXRDSLTNVSVEAASQNLEALKKKWEEEYEQQTLQRIREAEEALKKRIRL 1564
                                 + ++ N++ LK KW+ E+E++ + RIREAEEALKKRIRL
Sbjct: 1490 LN-------------------QPSNINIDELKIKWKAEHEEEVVNRIREAEEALKKRIRL 1530

Query: 1565 PSEERINQVIERKQKALEQEFTTKVNATALALLKENPDSIASDKADLIKDHQKEI-VQLK 1623
            P+EE+I+++IERK++ LE+EF  KV    + LL +      S + D+    Q EI +Q K
Sbjct: 1531 PTEEKISKIIERKREDLEKEFDEKVEE-RIKLLSQ------SGQMDVTFQKQFEIRIQEK 1583

Query: 1624 -KDLADKF---------------------------------EGQLVQVKKKAFEEGRQQG 1649
             K+L DK+                                 + +L  +KKK+FEEG+QQ 
Sbjct: 1584 QKELEDKYNEKLKELSHSNSISIDERDQLRAEIETKMRKELDNELQHIKKKSFEEGKQQA 1643

Query: 1650 IMKVKLLESKISKLESQ 1666
            +MK  LLE K++K+ESQ
Sbjct: 1644 MMKTTLLERKLAKMESQ 1660

>NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1788

 Score =  645 bits (1663), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 522/1631 (32%), Positives = 878/1631 (53%), Gaps = 104/1631 (6%)

Query: 133  RDLARLLEEKISDLDASQQELER--VLGVNKELRR-----HEMELEFTVQSQRSQSLREQ 185
            +D  +LL+ KIS     Q E+E+   L +  + R      H++E E  +QS +      +
Sbjct: 134  QDTIKLLDRKIS-----QNEVEKELTLKLTNQYRESTAKCHDLEDE--IQSLKYNDSLTE 186

Query: 186  AEIQRLQQELALVRSNAEWTTGQLNEKNQQLNSYREKTNGEIQSTQVELNIVKNELEVEH 245
              + +L Q+L  +    E    +L  K+++++ Y      EIQ+ + +++ ++N   +  
Sbjct: 187  TTMNKLSQDLKSISEIKERLETELENKDKKMSEYYSNCQAEIQTLRKKISTLENNCSIIK 246

Query: 246  ANVAALRSKNGELSKQLQDALCETKRLTDSLHSEKQEFAREMALKQRLIELLNGQVATMK 305
            +   AL+ +N  +S  L +   + + LT+  ++EK+E  +E++LKQ +I++L  QV  ++
Sbjct: 247  SENDALKKENRIVSSNLHEKSSKVQELTNLYNTEKEESQKELSLKQEMIDVLQTQVQKLQ 306

Query: 306  QDLEKAYDVAKNGGMSDSER----ERLLNDLFDTKKKLELSQANVSRLEDTIKELLETDN 361
             D  +  +  +    +D ER    E L   L +T+ +L              KEL E   
Sbjct: 307  DDYTRILNTKQPIVQNDEERNLEVEELKQKLIETETQLN-------------KELEE--- 350

Query: 362  VQSGGRNGIEHANVGSPSGGSTISTVYG-DLAALRKQLVQERRHKEELQLQVESFVVELE 420
                        N+   +  ST+S     DL  ++K+L+QER  KE+LQ QVE F+VELE
Sbjct: 351  ----------RRNITMQTESSTLSNQQQEDLDTIKKELIQERYQKEKLQNQVEIFIVELE 400

Query: 421  HKIPVLNSFKKRIEELEKQLNGVTLLLEATARERDEKVVQIKQYKNKVGDYETQVGHLVQ 480
             K+P +NSFK+R + LEK+L   TLLLE   RE+++   ++   +      + +   L +
Sbjct: 401  KKVPTINSFKQRTDMLEKELTDATLLLENLRREKNQVTNELDALRQNFKSVKWETKSLTK 460

Query: 481  QRSDLARQVQCLLIHISVRDDSSGPLTAEEVEFVKKLQSCRDSATGSDTQAIISNRLVEF 540
            QR+DLA Q+Q +LIH SV++DS+GPL+AEEV F++ +     +   SD+Q +IS RLV F
Sbjct: 461  QRNDLAHQLQYILIHTSVQNDSNGPLSAEEVRFIQDILDNESNEESSDSQQVISERLVTF 520

Query: 541  KSVVELQQKNAELLNAIRQLAQKLE-QEEHKTQSKVKSLEQNTVNEAKEAILSLQEHVQM 599
            +++VELQQKN +LL ++R+LA+KLE QEEH+ QS  + +EQ  ++EAKEAI+SLQ +   
Sbjct: 521  QNIVELQQKNIDLLKSVRELARKLELQEEHQ-QSTSQVVEQQAIDEAKEAIISLQSYNTK 579

Query: 600  LEDQLETVTTERDSFKLLVSEGKNNSLPNP---VGAAALQ-PQEVADGIAHLEARLKAMA 655
            LED+++T+  E D +K         SLP P   V    L+  +E  D I  LE RL    
Sbjct: 580  LEDKIKTLNDELDCYK---------SLPKPDTKVETEHLRLNEENTDLIKELETRLATSR 630

Query: 656  EESEQHAKMLNEEIKALYKSNSQLAIXXXXXXXXXXXADEKLSLIQKSLELVKGENADLQ 715
            EES +    LN EI  + +++SQ              A+++L LIQ SL L K EN  LQ
Sbjct: 631  EESNKTFASLNNEIDDIRRNHSQTVKECQNERASRELAEQRLKLIQNSLSLSKVENEQLQ 690

Query: 716  NRAGSLQALLLEQDTRRQSTIEEFVSAKSELFSISSQLTILQSERDFLRKVEADLKKENE 775
             R   LQ + L+QD R Q T++E+VS K  L +  ++L  +QS+ +  +  E  LK +  
Sbjct: 691  KRLEILQDITLKQDQRTQETLKEYVSCKVALSNSQNELNYIQSQLNISKTNEKSLKDDIT 750

Query: 776  SLNKDNNDSQLLILQLKTAQKERDSLIEETRKRYETRIEELDGELSATKQQLERKQREYD 835
             ++K+ N+ + L+ QL++ Q ER+ +   T+   +TR++ ++ EL    ++L+ K RE  
Sbjct: 751  IVSKERNELKELVSQLQSLQTEREQIFNSTKLDSQTRLDTVERELYDISEKLKNKDREIK 810

Query: 836  ELSSSSSTQCKWFQSKLDSLKEELGSSKLALKAKTSELDALKARLNSSTSKLEPASMDHQ 895
            EL S+  ++ +W+Q+K+D++KE+  + +  L  KT+E+  L   +      L+ +     
Sbjct: 811  ELESNRLSEIEWYQNKIDAIKEKRDAYQDELLEKTNEIGELNYEIKKLQKDLQASESRVT 870

Query: 896  QSSLVLESDH-ASRVQSLSKDLDEANRKLSSAYSEIERYKAASNATERPSLSY-NAVQDN 953
               ++  SD+  +++++L  +L+++   LS AY+E+++YK +++  E    +Y N V++ 
Sbjct: 871  AYKVLNNSDNVGTKMETLQNELEKSKINLSEAYAELDQYKQSASEKEEFLENYQNTVEET 930

Query: 954  KDGSKQAAISLEAELTKLNSDIAMANDRIKVLEDELNRREATYSTERSELQEKINALVTD 1013
            K    +   +L+ +  +L    ++ +++I  L +EL+ +   +  E+SE+ +K+N L+  
Sbjct: 931  KKEFIRKIETLQKDRDELLDTKSILSEQITDLNNELDHQNKAHLEEKSEISKKLNELLAQ 990

Query: 1014 KQRIEEAKADYQQKITQLQTDLEKQISSTNEAETKYQTALQKQAEISENIESLRKSSESY 1073
               IEE    Y+ K++ LQ DLE+Q S  N A+  Y+  LQK AE+++ I  LR+ + +Y
Sbjct: 991  NHNIEEVSNQYELKLSTLQNDLEQQASYANIAQNNYEQELQKHAELAKTISQLREDAHTY 1050

Query: 1074 KSEIAKFKSAAEEARKVLERNEQTWDQQKADIEANLDLAHQRIEELSTQNRLLYDQIXXX 1133
            + ++   ++ A    ++L +NE+ W++Q+   E  +    +RIE+LS+QN+LL+DQ+   
Sbjct: 1051 RKKMDSMQANATTNEELLRKNEKLWEEQRKSYEDQIHALKKRIEDLSSQNKLLFDQVDLL 1110

Query: 1134 XXXXXXXXXXDTKISSDARELIVTLRRERDILETKIDVSKREEKMLRQRLELTKSELDNL 1193
                       +  ++   +L+++LR +RDIL+T++ V++ E K LR +L    +EL N 
Sbjct: 1111 SKSENSYNQQSS--ATPNEDLVLSLRSDRDILQTRLSVTEEEGKALRLKLSSVNTELTNT 1168

Query: 1194 RAQLSESKGLVTEGTDSSQNQEELFEKLNQLNLLREHNMSLRNESEKVSEHNEFLQNEIL 1253
            RA+L+E +        S +  + +  +LNQLNLLRE N++LRNE+    E  + LQ ++ 
Sbjct: 1169 RAKLTEIRQQYENTKISVEEHDNIMNQLNQLNLLRESNITLRNEANDSREKAKQLQEDLE 1228

Query: 1254 SLQEKVQPMEEQIKSLTATXXXXXXXXXXXXXXSDRWKQRSQDILHKYERIDPEEYRKLA 1313
            +L+EKV P+E +   L                  +RWKQRSQDIL K+++IDP E+ KL 
Sbjct: 1229 TLREKVLPLEAEQNRLKEVIKENEQQLNAYKEECNRWKQRSQDILTKHKKIDPVEHEKLE 1288

Query: 1314 SEIEVLKAELERKSAESIDSQERFRKLRKQANERLDEFKAAKAKVESELELALSGKSQLE 1373
            +EI  LK  L  K  E+ +  +RF +++KQA+ERL+  KA +  +  +++      + ++
Sbjct: 1289 AEIATLKQNLADKKKENEELNDRFNRIKKQAHERLNSSKATQQTLIDQIKQLEDENAHIQ 1348

Query: 1374 AKLSEAREKITSLETQLTE-RPASEDDNPVSHELEETKTKLQDAENTINM-LKSEWSISE 1431
            + L   R  I + E +  +    SED   +  +LEE     ++ EN  N  +KS   IS 
Sbjct: 1349 SLLETERGNIQNTEEKFRQMNKQSEDVTALRSQLEEALLSSKEFENKFNASVKSSDEISS 1408

Query: 1432 ESFKKQLDELNKQLETIQKNXXXXXXXXXXXXYHEQP--TAVLEDFKKQVEEERRTLIES 1489
                  +D LN +L  ++++               QP  + V+E+ KK  EEE+   ++ 
Sbjct: 1409 H-LNDVIDSLNNELTHLKESKNNEATVTG------QPDLSNVVEEMKKSFEEEKIKFVQD 1461

Query: 1490 HQQELTARLEASRKNFXXXXXXXXXXXRDSLTNVSVEAASQNLEALKKKWEEEYEQQTLQ 1549
               E   +L    K                L ++S         A +++WE+EYE+  L+
Sbjct: 1462 QTTEFKEKLAEEVKRIEAQATDTQNKNVTPLQDIS---------AQREQWEKEYEEIVLK 1512

Query: 1550 RIREAEEALKKRIRLPSEERINQVIERKQKALEQEFTTKVNATALALLKENPDSIASDKA 1609
            RI +AEE LK+RIRLP+EE+IN VI++K+  LE+E+  KVN  A  LL       + +  
Sbjct: 1513 RIEQAEENLKRRIRLPTEEKINSVIQKKKNELEKEYDEKVNQRAKELLS------SEENK 1566

Query: 1610 DLIKDHQKEIVQLKKDLADKFEGQLVQVKKKAFEEGRQQGIMKVKLLESKISKLESQAKA 1669
              I+D + +I   KK+L    + +L   K KAFEEG+QQ +MK   LE KISKLESQ + 
Sbjct: 1567 TFIEDLKNDI---KKELERNIDQELKNAKAKAFEEGKQQAMMKTTFLEKKISKLESQLQG 1623

Query: 1670 PLGTN-------VPTKIPL-ENTQPLAQQVPV-KP--SPFQLAYAQATFGNVPFLFNKNS 1718
                N       V  K P  EN  P  Q+  + KP  S  Q+A    + G      N++ 
Sbjct: 1624 SNAANENKNDVEVLLKTPSDENNVPSKQEETLSKPQLSKIQIANPLLSTGGTTLALNQSR 1683

Query: 1719 EQKKVEHQDDS 1729
                +++  DS
Sbjct: 1684 APSSLQNGSDS 1694

>CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} similar to
            uniprot|Q02455 Saccharomyces cerevisiae YKR095w MLP1
          Length = 1780

 Score =  607 bits (1564), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 515/1620 (31%), Positives = 862/1620 (53%), Gaps = 108/1620 (6%)

Query: 140  EEKISDLDASQQELERVLGVNKELRRHEMELEFTVQSQRSQSLREQAEIQRLQQELALVR 199
            +EK+++L+  + E + +    K L    +ELE   Q  +S  L  ++E++R  QE+ L+R
Sbjct: 134  DEKVTELEHIRDEKKELQTQIKTLNDKILELELKCQEYQSSELNRKSELERNAQEILLLR 193

Query: 200  SNAEWTTGQLNEKNQQLNSYREKTNGEIQSTQVELNIVKNELEVEHANVAALRSKNGELS 259
             N EW   +L  KNQ    YR+KT+  +      +  +K++L++E ++   L  K  E +
Sbjct: 194  KNQEWLEQELTNKNQHFMFYRKKTDLMVHDAVTNVEKLKSDLKIEKSSKEILSKKLDETT 253

Query: 260  KQLQDALCETKRLTDSLHSEKQEFAREMALKQRLIELLNGQVATMKQDLEKAYDVAKNGG 319
            +QLQ+ L E K L D L  EKQEF +E+++K +LI+L   Q+ +++  L++ +  A+   
Sbjct: 254  EQLQNNLIENKDLKDVLAVEKQEFDKELSIKDKLIKLYENQIKSLESTLQQKFKTAEANE 313

Query: 320  MSDSERERLLND-LFDTKKKLELSQANVSRLEDTIKELLETDNVQSGGRNGI-------- 370
             + SE  + L + L   ++KL+  +    RLE  +       ++Q+ GR           
Sbjct: 314  ENSSEVVKSLKEELSLAERKLQDMEEKCVRLESILDHDSNDVSLQTKGRKRTYSNDSNSN 373

Query: 371  EHANVGSPSGGS-TISTVYGDLAALRKQLVQERRHKEELQLQVESFVVELEHKIPVLNSF 429
                +GS    S ++S + GD+  L++QLVQE+R KE+LQ QVESFV+ELEHKIPV+NSF
Sbjct: 374  SSDELGSFDDSSISLSRMQGDIKILKRQLVQEKRQKEKLQNQVESFVIELEHKIPVINSF 433

Query: 430  KKRIEELEKQLNGVTLLLEATARERDEKVVQIKQYKNKVGDYETQVGHLVQQRSDLARQV 489
            ++R   LEK+L    LLLE   +E + K  +++  K K+ D  +Q+  L++QR+DLA Q+
Sbjct: 434  QERTSVLEKELTDTALLLEHATKENELKTNELQSLKKKISDDNSQLEILLRQRTDLAHQL 493

Query: 490  QCLLIHISVRDDSSGPLTAEEVEFVKKLQSCRDSATGSDTQAIISNRLVEFKSVVELQQK 549
            Q LLI+IS+ +D+   L  +E++F+K L S  + A+ +D+Q +IS  L++FK + +LQ+K
Sbjct: 494  QYLLINISIINDNDHLLNEDEIKFIKNLVSNDNMASTNDSQKVISEHLIKFKDIQQLQEK 553

Query: 550  NAELLNAIRQLAQKLEQEEHKTQSKVKSLEQNTVN-------EAKEAILSLQEHVQMLED 602
            N EL+  +R LAQ+LE+ E K     KS   NTV+       EAKEAIL+L++  + LE 
Sbjct: 554  NMELVKTVRTLAQQLEENEEKK----KSTSNNTVDEDNEIFAEAKEAILTLEKVNENLEK 609

Query: 603  QLETVTTERDSFKLLVSEG--KNNSLPNPVGAAALQPQEVADGIAHLEARLKAMAEESEQ 660
             L+ VT ERD+FKLLVSE   +N    N V             +  LE RL  +  +S  
Sbjct: 610  NLQIVTKERDAFKLLVSEDRERNFKSSNSVHKYHELKSYNETVVKDLENRLTQLTNDSNA 669

Query: 661  HAKMLNEEIKALYKSNSQLAIXXXXXXXXXXXADEKLSLIQKSLELVKGENADLQNRAGS 720
            H+K L EE+  L+K  SQL +           A+E+L + Q S+EL+  EN  L+ R+  
Sbjct: 670  HSKALTEELNLLHKEISQLNVQIEKYRSAKSLAEERLKITQNSMELLSKENEQLRIRSSR 729

Query: 721  LQALLLEQDTRRQSTIEEFVSAKSELFSISSQLTILQSERDFLRKVEADLKKENESLNKD 780
            L+  LL+QD   Q T   +V A S+  S+ + +  L++E   L+  E  LK E  +  ++
Sbjct: 730  LEDSLLQQDKETQKTFSSYVEAISKNSSLETSVRNLETEVTLLKDREISLKSELSNTTEE 789

Query: 781  NNDSQLLILQLKTAQKERDSLIEETRKRYETRIEELDGELSATKQQLERKQREYDELSSS 840
                ++++ QL++ Q ER++L+E  +  ++ RI E++       +QL  +  E D++   
Sbjct: 790  KTKLRIMVTQLQSLQSERETLLERVQSDFKKRISEVNYINEKLDKQLSERVHEIDKIEKE 849

Query: 841  SSTQCKWFQSKLDSLKEELGSSKLALKAKTSELDALKARLNSSTSKLEPASMD-HQQSSL 899
             + Q +W+Q K+D   ++    +  L+ K  EL+ L  +  +   +LE A +  H   ++
Sbjct: 850  RNAQYEWYQKKIDEASQQQQQIQGQLQTKNDELERLHLQNKTLEKELEGAQIRIHTYETI 909

Query: 900  VLESDHASRVQSLSKDLDEANRKLSSAYSEIERYKAASNATERPSLSYNAVQDNKDGSKQ 959
               +        + K+L++   +L+ AYS++E +K  S  +E      NA  + KD   +
Sbjct: 910  NQNNSENQEENDVIKELEKTKIELADAYSQLEEFKNLSQNSEDALKELNASFNAKDRDYR 969

Query: 960  AAI-SLEAELTKLNSDIAMANDRIKVLEDELNRREATYSTERSELQEKINALVTDKQRIE 1018
             AI +L  E T++     +   +++ +++EL  +     +ER  L + I  L    Q IE
Sbjct: 970  DAIKTLTEEKTEIEGRFEILKQQLENIKNELTVQSEEAESERKRLTQTIAELQGAAQPIE 1029

Query: 1019 EAKADYQQKITQLQTDLEKQISSTNEAETKYQTALQKQAEISENIESLRKSSESYKSEIA 1078
            E K  +++K+ +L+ DLE+Q    N A+  Y+  LQ+ A++S+ I  LR+ ++  K++  
Sbjct: 1030 EVKKMFEEKLQKLENDLEEQTVYANNAQKNYEQELQRHADVSKTISELREQNQRLKNDTK 1089

Query: 1079 KFKSAAEEARKVLERNEQTWDQQKADIEANLDLAHQRIEELSTQNRLLYDQIXXXXXXXX 1138
               +  +  +  + +NE+    ++ +    +DLA QRI++++ QN+LLY+QI        
Sbjct: 1090 SLTAELQSLQDQMSQNEKHLKSERDEYRIQIDLAQQRIDDITKQNQLLYNQIDLLNRAES 1149

Query: 1139 XXXXXDTKISSDARELIVTLRRERDILETKIDVSKREEKMLRQRLELTKSELDNLR--AQ 1196
                     ++ +  L+++LRRERDIL+TKI+V + E+  L+Q+L+  ++EL+N +  A 
Sbjct: 1150 VNENSSDDEANGSTALVLSLRRERDILDTKINVIETEKNSLQQKLDDIQNELENTKRSAA 1209

Query: 1197 LSESKGLVTEGTDSSQNQEELFEKLNQLNLLREHNMSLRN-------ESEKVSEHNEFLQ 1249
            L ES+   +E +D   N + +   L QLNLLRE N++LRN       E +K+++  +  +
Sbjct: 1210 LLESE--YSEHSDLINNYQTIRGDLEQLNLLRESNVTLRNELKQALDEKDKIAKDLQICR 1267

Query: 1250 NEILSLQEKVQPMEEQIKSLTATXXXXXXXXXXXXXXSDRWKQRSQDILHKYERIDPEEY 1309
            NE+L LQ  ++     IK                   S RWK R ++++ K+++++ ++Y
Sbjct: 1268 NELLPLQSNLESANNLIK-------EKDLKIASANDESQRWKTRLEEMIEKHQKVNVDDY 1320

Query: 1310 RKLASEIEVLKAELERKSAESIDSQERFRKLRKQANERLDEFK--------------AAK 1355
             KL   +   K  L+ K  E+ +  +RF +L+KQA+E+L+  K              + K
Sbjct: 1321 TKLEETLNETKQLLDNKVQETNELNDRFNRLKKQAHEKLNTSKELQSSLQEQISNLISEK 1380

Query: 1356 AKVESELELALSGKSQLEAKLSEAREKITSLETQLTERPASEDDNPVSHELEETKTKLQD 1415
              +  +L++     S+L ++L+  REK   LET        E+ N    + EE + KLQ 
Sbjct: 1381 DDIRKQLDVKTEENSELLSELNNFREKQNDLET------LREELNKEISKSEELEVKLQ- 1433

Query: 1416 AENTINMLKSEWSISEESFKKQLDELNKQLETIQKNXXXXXXXXXXXXYHEQPTAVLEDF 1475
                 N ++S  S++  +  K+++EL K ++ ++                EQ    +E  
Sbjct: 1434 -----NEIESS-SLASRNTNKEIEELQKVIDDLK-----TQLAANSTDADEQTNRNVEAI 1482

Query: 1476 KKQVEEERRTLIESHQQELTARL----EASRKNFXXXXXXXXXXXRDSLTNVSVEAASQN 1531
            K++ E ++   I    +E   RL    E  R  F            D+  NV V      
Sbjct: 1483 KREFENQKTKFIAEKTEEFNKRLIEETEKIRNEFQENEKP------DTELNVDV------ 1530

Query: 1532 LEALKKKWEEEYEQQTLQRIREAEEALKKRIRLPSEERINQVIERKQKALEQEFTTKVNA 1591
             EAL+K+WEE+ E+   +RI EAE+ LKKRIRLPSEE+IN++IE+++  LE EF  K+  
Sbjct: 1531 -EALRKQWEEDSEELIQKRIAEAEDNLKKRIRLPSEEKINKIIEKRRSELESEFDQKIRD 1589

Query: 1592 TALALLKENPDSIASDKADLIKDHQKEIVQLKKDLADKFEGQLVQVKKKAFEEGRQQGIM 1651
             A  LL        +D ++   +  KE   L+K+L ++FE +L   +KKAFEEG+QQ  M
Sbjct: 1590 KARDLL-------MNDHSNEFNNELKEA--LEKELKERFEDELQAARKKAFEEGKQQATM 1640

Query: 1652 KVKLLESKISKLESQAKAPLGTNVPTK--IPLENTQPLAQQVPVKPSPFQLAYAQATFGN 1709
            K  LLE KI KLESQ +     +  T+   P EN+ P      VK  P  L  +  +FGN
Sbjct: 1641 KTTLLERKIQKLESQIQEKEKDSEETQDVKPEENSTP-----SVKKIPETLNSSDTSFGN 1695

>TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1820

 Score =  512 bits (1319), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 461/1547 (29%), Positives = 845/1547 (54%), Gaps = 63/1547 (4%)

Query: 181  SLREQAEIQRLQQELALVRSNAEWTTGQLNEKNQQLNSYREKTNGEIQSTQVELNIVKNE 240
            S+RE +EIQRL+QE+  +  N    + Q  ++ ++ N  +      + ++ ++L      
Sbjct: 164  SIRE-SEIQRLKQEVTFLNENKSSLSEQWLKEKEEFNKAKLLLEKNLNNSTIKLEEATTT 222

Query: 241  LEVEHANVAALRSKNGELSKQLQDALCETKRLTDSLHSEKQEFAREMALKQRLIELLNGQ 300
            L+   A V+ L  KN +L+K+ ++++ E K L D+L   K +  +E+A+K +LI+LL GQ
Sbjct: 223  LKSMEAKVSVLSDKNNDLTKKYENSIWEIKNLKDNLLVTKDDMNKEIAMKSKLIDLLQGQ 282

Query: 301  VATMKQDLEKAYDV-AKNGGMSD--SERERLLNDLFDTKKKLELSQANVSRLEDTIKELL 357
            +++ +++L +  ++ +K     D  S+ E L +D+ D   K+E  Q     L   I ++ 
Sbjct: 283  LSSTQEELRQNVELNSKFTKFPDLESQNETLKSDIQDLTLKIEELQNENFNLNSMINQMS 342

Query: 358  ETDNVQSGGRNGIEHANVGSPSGGSTISTVYGDLAALRKQLVQERRHKEELQLQVESFVV 417
                         ++ +  S S  S + T+Y  +  L+KQ+ QE+  K+ LQ Q+ESF++
Sbjct: 343  NE-----------QNNSNNSSSIDSNLPTLYSKINLLKKQVTQEKLEKKHLQTQIESFII 391

Query: 418  ELEHKIPVLNSFKKRIEELEKQLNGVTLLLEATARERDEKVVQIKQYKNKVGDYETQVGH 477
            ELE+KIP+++SF+++ + LE +L  +TLLL  T+ E++    ++  Y +K+  Y++ +  
Sbjct: 392  ELENKIPIISSFQEKNQALENELTNLTLLLNKTSNEKNTIQNKLNNYDSKLLTYQSNIKE 451

Query: 478  LVQQRSDLARQVQCLLIHISVRDDSSGPLTAEEVEFVKKLQSCRDSATGSD--TQAIISN 535
            L++QR DLA QV+ LL+ ++V++DS GPLT EE+EF+ K+ +  +   GS+  +Q +IS 
Sbjct: 452  LIRQRLDLANQVKHLLLFVAVKNDSGGPLTREEIEFINKISNNSEDLNGSELTSQHVISE 511

Query: 536  RLVEFKSVVELQQKNAELLNAIRQLAQKLEQEEHKTQSKVKSLEQNTVNEAKEAILSLQE 595
            RLV F ++ ELQ KN ELLN+IR L++ LE  E+    K    +  T+ +AKEAIL+LQ 
Sbjct: 512  RLVTFSNIEELQAKNMELLNSIRSLSENLENIENANSHK--EFQNKTIADAKEAILTLQY 569

Query: 596  HVQMLEDQLETVTTERDSFKLLVSEGK--NNSLPNPVGAAALQPQEVADGIAHLEARLKA 653
            H  +LE +++ +  ERDSFKLL++     ++S+ N   +++  P+     I  L+  ++ 
Sbjct: 570  HNDILESKVKVLEAERDSFKLLLNNNVSIDSSIKNDDLSSSTSPETNEKSIEKLQTLIEE 629

Query: 654  MAEESEQHAKMLNEEIKALYKSNSQLAIXXXXXXXXXXXADEKLSLIQKSLELVKGENAD 713
            +  E +++   L  +I +     S L I             EK+SL + + +++K EN +
Sbjct: 630  LKAELKKNKDALESQIASFTADKSNLTISLEKEKSSNTLMAEKISLTESAFDMLKTENKE 689

Query: 714  LQNRAGSLQALLLEQDTRRQSTIEEFVSAKSELFSISSQLTILQSERDFLRKVEADLKKE 773
            L  R  +LQ ++++Q+++    I ++++ ++E+ ++ +QL+I +SE+DFL K +  L  E
Sbjct: 690  LNKRFENLQNIIIKQESKLGDIINKYITGETEISNLKTQLSIAKSEKDFLVKSQDSLNSE 749

Query: 774  NESLNKDNNDSQLLILQLKTAQKERDSLIEETRKRYETRIEELDGELSATKQQLERKQRE 833
                +++ N  ++++ QL++ Q ER +L+++T+K++ ++I EL+       + L  K  E
Sbjct: 750  LIKTSEEKNKLRIMLSQLQSLQNERMTLLDDTQKKFMSKIHELENNNLDLIKNLGSKMTE 809

Query: 834  YDELSSSSSTQCKWFQSKLDSLKEELGSSKLALKAKTSELDALKARLNSSTSKLEPASMD 893
              +LS S+ +QC W+Q+ +D LK+ + S   A+K + +  ++L + LN+    LE  S  
Sbjct: 810  IQKLSISNESQCTWYQNTIDDLKK-INS---AIKTELTSKNSLISDLNTKIELLESQSYT 865

Query: 894  HQQSSLVLESDHASRVQSLSKDLDEANRKLSSAYSEIERYKAASNATERPSLSYNAVQDN 953
               ++    S   +    +SKDLD     LS AY+++E YK    +TE    S   ++ N
Sbjct: 866  IDTNTRC--SSSGNDFSQISKDLDITKLHLSEAYTQVEEYKQLYTSTEE---SLKTLESN 920

Query: 954  KDGSKQAA---IS-LEAELTKLNSDIAMANDRIKVLEDELNRREATYSTERSELQEKINA 1009
             +  K      IS L +E   L +     + RI  L  +L   +  YS E ++L  +I  
Sbjct: 921  FESVKNLMDDKISKLLSENETLKASTGEYDKRISELSTDLKNEKNKYSEEIAQLNVQITR 980

Query: 1010 LVTDKQRIEEAKADYQQKITQLQTDLEKQISSTNEAETKYQTALQKQAEISENIESLRKS 1069
            L   K+   +  ++Y++KI++LQ+ LE +    + A+ KY++ L K     ++IE  ++ 
Sbjct: 981  LNKFKKDSADTASEYEEKISKLQSQLELKAKFADNAQEKYESLLTKDNANLQSIEEFKEQ 1040

Query: 1070 SESYKSEIAKFKSAAEEARKVLERNEQTWDQQKADIEANLDLAHQRIEELSTQNRLLYDQ 1129
             E     I   +S  E+   +L  NE  W +++    ++L+ + ++I+ L+ QN+L  DQ
Sbjct: 1041 IEKLNQRIVIIESDLEKKTSLLSENESLWKKKQDAFISDLEESKKKIDNLTNQNKLYVDQ 1100

Query: 1130 IXXXXXXXXXXXXXDTKISSDARELIVTLRRERDILETKIDVSKREEKMLRQRLELTKSE 1189
            +                 SS+ + +   LR +RD+LETK+ +++R+ K    +LE  + E
Sbjct: 1101 LELLNKDFSSMDSSQL--SSETKHMFNRLRADRDVLETKLSIAERDSKNNASKLESLRDE 1158

Query: 1190 LDNLRAQLSESKGLVTEGTDSSQNQEELFEKLNQLNLLREHNMSLRNESEKVSEHNEFLQ 1249
            L N++ +L  S+  +   +D  +N E++  +LNQ+ L +E N +LRN+  +++E N+ LQ
Sbjct: 1159 LANVQMKLISSENKLLRHSDLIENHEKIVSELNQITLFKESNETLRNQVSELNEKNKTLQ 1218

Query: 1250 NEILSLQEKVQPMEEQIKSLTATXXXXXXXXXXXXXXSDRWKQRSQDILHKYERIDPEEY 1309
             ++     K+  +  ++KS+  +              S++W+ R++++  + +++D +  
Sbjct: 1219 TKLNEENSKLSNLSMELKSVKESLGDKETDIMLIKEESNKWRLRAEELSVQIDKVDLDSV 1278

Query: 1310 RKLASEIEVLKAELERKSAESIDSQERFRKLRKQANERLDEFKAAKAKVESELELALSGK 1369
             KL++E++ LK + E K  ++ + +ERF  L+KQA+ERL+  K  ++ +  ++    +  
Sbjct: 1279 SKLSTELDALKDDAETKRKQNAELEERFNLLKKQAHERLNASKEIQSSLNKQINELKASN 1338

Query: 1370 SQLEAKLSEAREKITSLETQLTERPASEDDNPVSHELEETKTKLQDAENTINMLKSEWSI 1429
            + +E  LS  ++K   L+  L+       DN V +       KL + E+ +  LK+E + 
Sbjct: 1339 TNIELALSSEQKKSMDLQNTLS-------DNEVKY-----TQKLSNIESELKALKTENNS 1386

Query: 1430 SEESFKKQLDELNKQLETIQKNXXXXXXXXXXXXYHEQPT---AVLEDFKKQVEEERRTL 1486
             + S +K+  EL  ++++++K+                 +   A++E  KK+ EEE+  L
Sbjct: 1387 FKLSSEKEKMELTDEVDSLKKSLVEAQSKLSAIGSDSTDSTMNAMIESMKKEFEEEKLKL 1446

Query: 1487 IESHQQELTARLEASRKNFXXXXXXXXXXXRDSLTNVSVEAASQNLEALKKKWEEEYEQQ 1546
            +E    EL A+ +  +              + + T+ S++   +  ++LKK+WEEEYE+ 
Sbjct: 1447 LEDKTNELEAQWKLEKDKLLKEYEEKIEDLQSARTDQSIKI--EEFQSLKKEWEEEYEKA 1504

Query: 1547 TLQRIREAEEALKKRIRLPSEERINQVIERKQKALEQEFTTKVNATALALLKENPDSIAS 1606
            TL+RI EA+E LKKRIRLPSE +IN+VIE+++  LE E+  K+    L  ++ N +SI +
Sbjct: 1505 TLERIEEAKETLKKRIRLPSETKINRVIEKRKHELENEYEVKLQE-KLNEIEANRNSIET 1563

Query: 1607 DKADLIKDHQKEIVQLKKDLADKFEGQLVQVKKKAFEEGRQQGIMKVKLLESKISKLESQ 1666
                 +++  KE  ++K+D+  KFE  L + KKK+FEEG+QQ  MK  LLE KISKLESQ
Sbjct: 1564 IDPGKLREEIKE--EVKRDMLIKFENDLNEAKKKSFEEGKQQSSMKTTLLERKISKLESQ 1621

Query: 1667 AKAPLGTNV-----PTKIPLENTQPLAQQVPVKPSPFQLAYAQATFG 1708
                +  +      P    L  T  LA   P  PS  + A++   F 
Sbjct: 1622 LSEAIENDKQSDKNPIISDLAQTSTLASIQP--PSAKKPAFSFGGFN 1666

>NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_5.702
            YIL149C
          Length = 1973

 Score =  502 bits (1293), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 411/1340 (30%), Positives = 728/1340 (54%), Gaps = 50/1340 (3%)

Query: 117  QLEETERRVAAGDSARRDLARLLEEKISDLDASQQELERVLGVNKELRRHEMELEFTVQS 176
            Q+   E  V+   S +++L + L+++I++L+  +  +E +     + R   ++LE   Q 
Sbjct: 126  QIHSLEENVSELQSKKQELIKSLDDRITELNEYRHNIELLNNEKSKTRNKILQLENENQD 185

Query: 177  QRSQSLREQAEIQRLQQELALVRSNAEWTTGQLNEKNQQLNSYREKTNGEIQSTQVELNI 236
             +   L ++ +++RL QEL  +     W   +L EK +Q +SYREK+  E Q  +++LN 
Sbjct: 186  LKINDLSQRTQLERLSQELETINKEKLWLEERLGEKGEQFDSYREKSINENQDLKLQLNT 245

Query: 237  VKNELEVEHANVAALRSKNGELSKQLQDALCETKRLTDSLHSEKQEFAREMALKQRLIEL 296
            VKNEL+   +    L+ +  ELS +L+D     K +  S +++K    +E+ LKQ+LI +
Sbjct: 246  VKNELDQMKSTNCVLQERTDELSNKLRDTSTNLKNIQQSRNNDKATHEKELTLKQQLIVV 305

Query: 297  LNGQVATMKQDL--EKAYDVAKNGGMS--DSERERLLNDLFDTKKKLELSQANVSRLEDT 352
            L  Q+  ++++   E +  V+     S  DS+  R +NDL   K +L   Q     LE  
Sbjct: 306  LQSQLNELQRENGNELSLTVSDTASSSRKDSDFTREINDL---KNQLNHVQERNVELEFK 362

Query: 353  IKELLETDNVQSGGRNGIEHANVGSPSGGSTISTVYGDLAALRKQLVQERRHKEELQLQV 412
            ++        +S     + ++   S    ++++  Y D+  L+K+L  E+  +E  +  +
Sbjct: 363  LR--------KSEDYTAVSNS-TSSDDLRNSLAKAYDDIDVLKKKLNDEQSQRENFEKNL 413

Query: 413  ESFVVELEHKIPVLNSFKKRIEELEKQLNGVTLLLEATARERDEKVVQIKQYKNKVGDYE 472
            E F+ +LE ++P L +++ R    E++L   TLLLE   +E+     ++ Q ++++   E
Sbjct: 414  EEFMDDLETELPTLEAYRHRAAAREEELKEATLLLEKANKEKSLVSSELNQAQSRIQSIE 473

Query: 473  TQVGHLVQQRSDLARQVQCLLIHISVRDDSSGPLTAEEVEFVKKLQSCRDSATG--SDTQ 530
             ++  + +QRSDLA Q+Q  L+H SV +DS+GPLT EEV+F++ +    D      +DTQ
Sbjct: 474  QEIKLVAKQRSDLANQLQFFLVHNSVANDSAGPLTDEEVKFIRNIIQEDDEMHDKETDTQ 533

Query: 531  AIISNRLVEFKSVVELQQKNAELLNAIRQLAQKLEQEEHKTQSKVKSLEQNTVNEAKEAI 590
             +IS RL +FK ++ELQQKN ELL   R+LA KLE+E+   Q++   +E+ T+ EAKEAI
Sbjct: 534  KVISERLTKFKDIIELQQKNMELLKTTRELATKLEEEDKIKQAEKSRIEEETIAEAKEAI 593

Query: 591  LSLQEHVQMLEDQLETVTTERDSFKLLVSEGKNNSLPNPVGAAALQPQ-EVADGIAHLEA 649
            L+LQ +   L  ++  +T E +++K+L S  +++S P        Q + E    +  LE 
Sbjct: 594  LTLQNYNSSLTAKIAALTKELETYKVL-SNTEDSSTPADFDKQREQREIEHTQLVKELET 652

Query: 650  RLKAMAEESEQHAKMLNEEIKALYKSNSQLAIXXXXXXXXXXXADEKLSLIQKSLELVKG 709
            R+ ++ +ES+++A +LN++I AL + N+ ++I           A+E+L L+QKS+++   
Sbjct: 653  RIASIIQESKENANILNDKIFALDEKNNHISIELAREKSAKQLAEERLKLLQKSMDMTIT 712

Query: 710  ENADLQNRAGSLQALLLEQDTRRQSTIEEFVSAKSELFSISSQLTILQSERDFLRKVEAD 769
            EN  LQ R  SL+ +++EQD R   TI   +  +SEL ++ ++  + Q+E   L   E  
Sbjct: 713  ENERLQKRLNSLRNVVVEQDKRTHETINSLIKTRSELATVENKWNVSQNEIKLLHSSEEM 772

Query: 770  LKKENESLNKDNNDSQLLILQLKTAQKERDSLIEETRKRYETRIEELDGELSATKQQLER 829
            LK E   LN++ N  +LL+ +L+T Q ER+ L+  T+ ++   + +L+G  +  +++L+ 
Sbjct: 773  LKNELTRLNEEKNSMKLLVTRLQTLQSEREHLLSTTQDKFNKELNDLEGTCNDLRKKLKE 832

Query: 830  KQREYDELSSSSSTQCKWFQSKLDSLKEELGSSKLALKAKTSELDALKARLNSSTSKLEP 889
             +  Y  L   ++     F+ K  SLKEE+ +    ++ + SE+   K R     +K E 
Sbjct: 833  AEENYGSLMEETTELKDDFRQKKKSLKEEMSN----VEKRYSEI-VEKER----ETKWEN 883

Query: 890  ASMDHQ---QSSLVLESDHAS-------RVQSLSKDLDEANRKLSSAYSEIERYKAASNA 939
              +  Q   ++ L+ +   AS        + SL K+L     +L+ +YS+ E Y+     
Sbjct: 884  TRLTKQLKEKTELIEKYKAASDDEGKLEEISSLQKELQVLKNELTESYSQTESYRKDIEL 943

Query: 940  TERPSLSYNAVQDNKDGSKQAAISLEAELTKLNSDIAMANDRIKVLEDELNR----REAT 995
              +     N    NK+ + +  I+ E EL K N  IA +N  +K   D+LN     ++  
Sbjct: 944  LNQSIADINKQVLNKEAAFKERIT-EVELAKNN--IADSNTVLKTQIDDLNNELEVQKKL 1000

Query: 996  YSTERSELQEKINALVTDKQRIEEAKADYQQKITQLQTDLEKQISSTNEAETKYQTALQK 1055
            Y  E+       N L    + +E++K DY+ K+  L  DLE+Q+   N+A+  Y+  LQ 
Sbjct: 1001 YEDEKINFTRNANELERVTKGLEQSKRDYEDKLKSLMKDLEEQVKYANKAQNNYEQELQN 1060

Query: 1056 QAEISENIESLRKSSESYKSEIAKFKSAAEEARKVLERNEQTWDQQKADIEANLDLAHQR 1115
             A +S+ I  LR+ ++ Y++EIA+   +A +A+++L  N+ +W +Q+ + E  ++   +R
Sbjct: 1061 HANVSKTISQLREQTQHYRTEIAELTISATDAKRLLNENQISWQKQRDEYEKQIEFFKKR 1120

Query: 1116 IEELSTQNRLLYDQIXXXXXXXXXXXXXDTKISS--DARELIVTLRRERDILETKIDVSK 1173
            IEE S QN++L++Q               + ++S     +L+++LR ERD+L+ +++V++
Sbjct: 1121 IEEESEQNKMLFEQSKLTTQANDEDNAESSGVNSIEGDNKLVLSLRSERDLLQERLNVTE 1180

Query: 1174 REEKMLRQRLELTKSELDNLRAQLSESKGLVTEGTDSSQNQEELFEKLNQLNLLREHNMS 1233
             EEK+LR+RL   + +      +L + K       D  +  + +  +L QL+LLRE N++
Sbjct: 1181 AEEKLLRERLTSIEKDFRATDLELQKIKEETHNYPDLLEQHKTVMSQLTQLDLLRESNIT 1240

Query: 1234 LRNESEKVSEHNEFLQNEILSLQEKVQPMEEQIKSLTATXXXXXXXXXXXXXXSDRWKQR 1293
            LRNE+ ++   N+ LQ E+ +L +K+ P+E ++++LT                S+RWKQR
Sbjct: 1241 LRNETIELQSKNQHLQTEVENLHDKLLPLETELQTLTNLIEEKDKQLSICHEESERWKQR 1300

Query: 1294 SQDILHKYERIDPEEYRKLASEIEVLKAELERKSAESIDSQERFRKLRKQANERLDEFKA 1353
            SQDIL KY+RIDP E+  LA E   L+A+LE KS E+ +   RF KL+KQA+E+L+  K 
Sbjct: 1301 SQDILSKYQRIDPVEHENLAEERNRLQAQLEEKSKENEELGNRFEKLKKQAHEKLNASKI 1360

Query: 1354 AKAKVESELELALSGKSQLEAKLSEAREKITSLETQL-TERPASEDDNPVSHELEETKTK 1412
            ++  +  ++    + K +L ++L   +E   SLE +L      S D   +  +LEE   K
Sbjct: 1361 SQNSLTIQINDLEAKKKELLSQLETEKEGKLSLEKRLEVTMKNSHDIVSIQSQLEEALMK 1420

Query: 1413 LQDAENT-INMLKSEWSISE 1431
             +D E   IN ++S   I E
Sbjct: 1421 SKDFETKFINSVESSKQIEE 1440

>Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON}
            YIL149C (REAL)
          Length = 1682

 Score =  390 bits (1001), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 467/1633 (28%), Positives = 773/1633 (47%), Gaps = 221/1633 (13%)

Query: 152  ELER-VLGV-NKELRRHEMELEFTVQSQRSQSLREQAEIQRLQQELALVRSNAEWTTGQL 209
            +LER  LG  NK LRR  +E+E  +Q+ +S +L  + +   + QE  L+  N +W   QL
Sbjct: 136  DLERSALGHENKLLRRKLLEMENILQTCKSNTLSLKLKYDTVVQEKELILENKKWMEEQL 195

Query: 210  NEKNQQLNSYR-EKT-------NGEIQSTQVELNIVKNELEVEHANVAALRSKNGELSKQ 261
                    S+R EKT          +Q+ + +LN  +N+ E    N   L ++N +LS  
Sbjct: 196  --------SFRDEKTLVDDVTRTSHVQNLEEQLNRTQNDYESVSTNNQFLLAQNKQLSHS 247

Query: 262  LQDALCETKRLTDSLHSEKQEFAREMALKQRLIELLNGQVATMKQDLEKAYDVA-----K 316
            ++  + E K L D+++ EK +F++EM L++ + +LL  Q+ +     EK Y ++      
Sbjct: 248  MEQKILEIKNLKDTVNIEKADFSKEMTLQKNMNDLLRSQLTS----FEKNYSLSAREKDN 303

Query: 317  NGGMSDSERERLLNDLFDTKKKLELSQANVSRLEDTIKELLETDNVQSGGRNGIEHANVG 376
            +    +S+   +++ L DTK +LE S+    RL++ + + +E D       + ++     
Sbjct: 304  DDPCKNSQHANVVDKLIDTKLQLEKSKDECQRLQNIVADCIEEDEAAFDNTHNVD----- 358

Query: 377  SPSGGSTISTVYGDLAALRKQLVQERRHKEELQLQVESFVVELEHKIPVLNSFKKRIEEL 436
             PS    ++ V+ D+ AL++QL++ER  K +LQ Q+ESF+ ELE K P L SFK+R E L
Sbjct: 359  -PS----VNKVFSDIKALKRQLIKERNQKFQLQNQMESFIKELERKTPELISFKERTESL 413

Query: 437  EKQLNGVTLLLE--ATARERDEKVVQIKQYKNKVGDYETQVGHLVQQRSDLARQVQCLLI 494
            E++L   T LLE  + A+ +DEK  ++   + K+ + E  +  LV+QR DLARQV+ LL+
Sbjct: 414  EQELKNSTDLLETISLAKRKDEK--ELTSLRQKINNCEANIHSLVKQRLDLARQVKLLLL 471

Query: 495  HISVRDDSSGPLTAEEVEFVKKLQSCRDSATGSDTQAIISNRLVEFKSVVELQQKNAELL 554
            +IS     + PL+ +E+  +KKL    D     D+Q II+ RLVEF +  ELQ+KN ELL
Sbjct: 472  NISAVQKKASPLSNDELISLKKLLESGDVPNEKDSQIIITERLVEFNNTNELQEKNMELL 531

Query: 555  NAIRQLAQKLEQEEHKTQSKVKSLEQNTVNEAKEAILSLQEHVQ-MLEDQLETVTTERDS 613
            N +R LA KLE  E K    +  LE  T+ EAK+AI+ L EHV   LE +++ ++ ERDS
Sbjct: 532  NCVRVLADKLENHEGKQDKSLAKLENQTIKEAKDAIIEL-EHVNSTLESRIDILSRERDS 590

Query: 614  FKLLVSEGKNNSLPNPVGAAALQPQEVAD--GIAHLEARLKAMAEESEQHAKMLNEEIKA 671
            +KLL S        N + A A    E A+   I  LE+ L     E+    + LN+E+  
Sbjct: 591  YKLLASAN-----GNKIYADAANKTEAANLKKIKELESELSLTKVENSAVVQRLNKELLT 645

Query: 672  LYKSNSQLAIXXXXXXXXXXXADEKLSLIQKSLELVKGENADLQNRAGSLQALLLEQDTR 731
              KS S   I           A EK +L              LQ R   L+  L +Q + 
Sbjct: 646  CKKSQSNGQIALQEFSNFKVLAIEKENL--------------LQTRIDDLKTKLEKQRSS 691

Query: 732  RQSTIEEFV-SAKSELFSISSQLTILQSERDFLRKVEADLKKENESLNKD--NNDSQLLI 788
              S+I   + S ++EL    ++   L  E   L K   DL+   ESL +D      + + 
Sbjct: 692  APSSIHGSIGSEETELSQYKNKTKSLMCEISNLSKKNTDLRCMKESLTRDLERCCKEKMQ 751

Query: 789  LQLK-----TAQKERDSLIEETRKRYETRIEELDGELSATKQQLERKQREYDELSSSSST 843
            LQ+K     T+  E+    +  + +Y T+I+ L+        +L  K +E + L +S ++
Sbjct: 752  LQMKLTESETSHNEQKLKSDSKQVQYNTKIKNLEKNCEELNNRLHSKVQEIETLQTSKNS 811

Query: 844  QCKWFQSKLD-------SLKEELGSSKLALKAKTSELDALKARLNSSTSKLEPASMDHQQ 896
            Q KW Q+ +D       SL  +L   K  ++  + E+  L+  L    +KL+   +++  
Sbjct: 812  QLKWAQNTIDDTEKNMKSLSTDLSEKKTTIRKLSLEMKDLEIEL--QKTKLQYKLLNNSS 869

Query: 897  SSLVLESDHASRVQSLSKDLDEANRKLSSAYSEIERYKAASNATERPSLSYNAVQDNKDG 956
             +  LE+       +L K+L+ +   L  A+S+IE Y+   +  E               
Sbjct: 870  DANTLET-------ALKKELERSQIDLKDAHSQIEAYEEIISTDENT------------- 909

Query: 957  SKQAAISLEAELTKLNSDIAMANDRIKV----LEDELNRREATYSTERSELQE------- 1005
                       L +LN  +    + +KV    L++E N +E   S  R EL E       
Sbjct: 910  -----------LKELNDQLTKTKEELKVKSQSLDEENNAKEEEISFLRRELDEIRGLQPK 958

Query: 1006 -KINALVTDKQRIEEAKADYQQKITQLQTDLEKQISST---NEAET-KYQTALQKQAEIS 1060
             K  AL   +Q   E   +  Q+I  +   ++K  +      E ET +YQ  L+   ++S
Sbjct: 959  LKEGALRLVQQS--EKLGNQTQRIQAMNEKIDKMTTIVELHQEVETSQYQAKLKANKDLS 1016

Query: 1061 ENIESLRKSSESYKSEIAKFKSAAEEARKVLERNEQTWDQQKADIEANLDLAHQRIEELS 1120
              +  L      Y++E+ K KS+    +++L+++E+ W ++KAD E  L    ++ E L 
Sbjct: 1017 ALVLRLENEVLDYQTELKKTKSSLHSTQELLDKHERKWMEEKADYERELISNIEQTESLR 1076

Query: 1121 TQNRLLYDQIXXXXXXXXXXXXXDTKISSDARELIVTLRRERDILETKIDVSKREEKMLR 1180
             +N  L ++I                +S     L  +LR ER+ LETK+   KR+  + +
Sbjct: 1077 VENSALVEKIDDGTGENNGDKEYLKLVS-----LFSSLRHERNTLETKLTTCKRDLALAK 1131

Query: 1181 QR-LELTKSELDNLRAQLSESKGLVTEGTDSSQNQEELFEKLNQLNLLREHNMSLRNESE 1239
            Q+   L KS  D  +  L   K  V   TD     E++ +++ Q+N+L+E+N  L+   +
Sbjct: 1132 QKNANLEKSVNDMQQTHLVSRKD-VQCSTDIIDEFEDIMKEIAQVNILKENNTILQKSLK 1190

Query: 1240 KVSEHNEFLQNEILSLQEKVQPMEEQIKSLTATXXXXXXXXXXXXXXSDRWKQRSQDILH 1299
            KV+E NE +  E  SLQ ++  ++  +                     ++WKQR  ++  
Sbjct: 1191 KVTEKNEAIYKEHTSLQYEISQLQGDLAQTKEQVSVNANKVLVYESEIEQWKQRYDNLSQ 1250

Query: 1300 KYERIDPEEYRKLASEIEVLKAELERKSAESIDSQERFRKLRKQANERLDEFKAAKAKVE 1359
            + +    +E  KL +EI  LKA+L      + D  ++F +L+KQA+E+LD  K  +  + 
Sbjct: 1251 QQKETHKDETEKLFNEISDLKAKLLNAQNANADLNDKFNRLKKQAHEKLDASKKQQTALT 1310

Query: 1360 SELELALSGKSQLEAKLSEAREKITSLETQLTERPASEDDNPVSHELEETKTKLQDAENT 1419
            +E++     K++LE  L     K+  LE +L +     +   VS + EE  +K    E  
Sbjct: 1311 NEVDELKDMKNELEESLHSEESKVLELEAKLKKHLVQAE--GVSKDQEEDTSKPLMEE-- 1366

Query: 1420 INMLKSEWSISEESFKKQLDELNKQLETIQKNXXXXXXXXXXXXYHEQPTAVLEDFKKQV 1479
            I +LK E  +    FK+  D                             +  +E  K+ +
Sbjct: 1367 IELLKRELQV----FKETSD----------------------------SSDTIEKMKEIM 1394

Query: 1480 EEERRTLIESHQQELTARLE-ASRKNFXXXXXXXXXXXRDSLTNVSVEAASQNLEALKKK 1538
            E E+  +IE    E   +LE A+ KN                T  ++E   +N+E LKK+
Sbjct: 1395 EAEKNKIIEEKTTEFERKLEEATGKN----------------TGATIENG-ENMEELKKQ 1437

Query: 1539 WEEEYEQQTLQRIREAEEALKKRIRLPSEERINQVIERKQKALEQEFTTKVNATALALLK 1598
            W ++YE++T++RI+EAEE LKKRIRLPSEERI ++I ++++ LEQEF  K+ A + +   
Sbjct: 1438 WLKQYEEETMRRIKEAEENLKKRIRLPSEERIQKIISKRKEELEQEFQRKLKANSGSF-- 1495

Query: 1599 ENPDSIASDKADLIKDHQKEIVQLKKDLADKFEGQLVQVKKKAFEEGRQQGIMKVKLLES 1658
                +++SDK    K+++   V  + DL +       +         RQ+ ++  + L++
Sbjct: 1496 ----TLSSDK----KENE---VNAEDDLWNSPSKGNSEKPSVVTNLIRQKNLILQEQLKN 1544

Query: 1659 KISKLESQAKAPLGTN----VPTKIPLENTQPLAQQV--PVKPS----------PFQLAY 1702
                + S    P  +N    +P     EN  PLA     P+ PS          PF  A 
Sbjct: 1545 PKKGIISNDSRPTSSNKENDIPGSTTAENKAPLAFNFGKPLFPSNTSSFQSFQNPFTPAA 1604

Query: 1703 AQATFGNVPFLFN 1715
                 G  P +FN
Sbjct: 1605 TSFNTGVSP-VFN 1616

>Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON}
            YIL149C (REAL)
          Length = 1680

 Score =  373 bits (957), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 411/1474 (27%), Positives = 709/1474 (48%), Gaps = 150/1474 (10%)

Query: 160  NKELRRHEMELEFTVQSQRSQSLREQAEIQRLQQELALVRSNAEWTTGQLNEKNQQLNSY 219
            NK L+R  +E+E  +Q  +S ++  Q +     QE  L   N +WT  +L+  NQ+    
Sbjct: 146  NKLLQRKLLEMENILQVCKSNAVSLQFKYDTASQEKELWLQNKKWTEERLSSCNQKALVD 205

Query: 220  REKTNGEIQSTQVELNIVKNELEVEHANVAALRSKNGELSKQLQDALCETKRLTDSLHSE 279
                   +Q+ + +LN  + E E        L  +N +LS  +++ L E K L D+ ++E
Sbjct: 206  EVTKTSYLQNLEEKLNQTQTENESVSTYNKFLLDQNKKLSHLVEEKLLEIKNLKDTANTE 265

Query: 280  KQEFAREMALKQRLIELLNGQVATMKQDL-----EKAYD-VAKNGGMSDSERERLLNDLF 333
            K EF++EM L++++ +LL  Q+ + ++       EK  D + KN    D   E     L 
Sbjct: 266  KSEFSKEMTLQKKMNDLLRSQLTSFERGHSLRPKEKGDDKLCKNPEHIDVAEE-----LI 320

Query: 334  DTKKKLELSQANVSRLEDTIKELLETDNVQSGGRNGIEHANVGSPSGGSTISTVYGDLAA 393
            D K KLE S+     L++ + + +E         NG     V + +   T+  ++ ++  
Sbjct: 321  DAKLKLEKSKEECQLLKNIVSDCIE--------ENG---TTVNTNTAAPTVGKLFSNIKT 369

Query: 394  LRKQLVQERRHKEELQLQVESFVVELEHKIPVLNSFKKRIEELEKQLNGVTLLLE--ATA 451
            L++QLV+ER  K ++Q Q++ FV+ELEHK P L SFK+R E LE +L   T LLE  + A
Sbjct: 370  LKRQLVKERSQKFQVQNQLKDFVLELEHKTPALVSFKERTELLEHELKCSTELLETMSLA 429

Query: 452  RERDEKVVQIKQYKNKVGDYETQVGHLVQQRSDLARQVQCLLIHISVRDDSSGPLTAEEV 511
            + +DEK  ++   + K+  YE  +  LV+QR DLARQV+ LL +IS    ++ PL+ +E+
Sbjct: 430  KRKDEK--KLTSLEQKINSYEANIHSLVRQRLDLARQVKILLSNISAIQTTTSPLSNDEL 487

Query: 512  EFVKKLQSCRDSATGSDTQAIISNRLVEFKSVVELQQKNAELLNAIRQLAQKLEQEEHKT 571
              ++KL    ++    D+Q II+ +LVEFK++ ELQ+KN ELL+ IR LA KLE  E + 
Sbjct: 488  MSLRKLLESENTVNERDSQIIITEKLVEFKNIDELQEKNMELLDCIRILADKLETNEGEA 547

Query: 572  QSKVKSLEQNTVNEAKEAILSLQEHVQMLEDQLETVTTERDSFKLLVSEGKNNSLPNPVG 631
               V  +E  T+ EAKEAI+ ++     L  ++  +T ERDS+KLL S   N +  +  G
Sbjct: 548  DKTVAKIENQTIKEAKEAIIEMESINSKLALRVNILTRERDSYKLLASANDNKTHADTEG 607

Query: 632  AAALQPQEVADGIAHLEARLKAMAEESEQHAKMLNEEIKALYKSNSQLAIXXXXXXXXXX 691
                  ++    I  L+++L +   ES    + LN ++    KS +   I          
Sbjct: 608  ITEATYEK---KIRELQSKLSSTRVESSAIIQNLNGQLLTYKKSQTDGKIALQEFENFKV 664

Query: 692  XADEKLSLIQKSLELVKGENADLQNRAGSLQALLLEQDTRRQSTIEEFVSAKSELFSISS 751
               EK +++Q+ +  +K      Q     L A    QD +  S + +   +++++ S+  
Sbjct: 665  LVAEKEAMLQERINHLKT-----QLEKQRLSAAPPVQDYKY-SNLTDLSHSENKIGSLKY 718

Query: 752  QLTILQSERDFLRKVEADLKKENESLNKDNNDSQLLILQLKTAQKERDSLIEETRKRYET 811
            +++ L+ E   L  ++  L ++ E   K+     + + + +T+  E++ +      +Y T
Sbjct: 719  EISNLKKENTGLIAMKESLTRDLERCCKEKMQLHVKLSESETSHNEQNLIFGSKELQYST 778

Query: 812  RIEELDGELSATKQQLERKQREYDELSSSSSTQCKWFQSKLDSLKEELGSSKLALKAKTS 871
            RI+ L+  L     +LE K++E   L SS ++Q KW Q+ +D  ++ L S    L  K +
Sbjct: 779  RIKVLEKNLKELNVRLESKEQEIKTLQSSKNSQLKWAQNTIDDTEKNLKSVSAELSNKET 838

Query: 872  ELDALKARLNSSTSKLEPASMDHQQSSLVLESDHASRVQSLSKDLDEANRKLSSAYSEIE 931
             +  L   + +  ++L    +  Q   L   SD  +   +L K+L +   +L  A+S+I+
Sbjct: 839  TIGRLSLEIENLGNELRMTKL--QYKFLSNTSDTNTLEPTLRKELKQTQIELKDAHSQIK 896

Query: 932  RYKAASNATERPSLSYNAVQDNKDGSKQAAISLEA--------ELTKLNSDIAMANDRIK 983
             Y+   +  E      N          +  I LE         EL+ L  ++    D I+
Sbjct: 897  AYEEIISTNENVLKELNGELKKAKEDCETKIQLENKEKGAKEEELSHLRKEL----DEIR 952

Query: 984  VLEDELNRREATYSTERSELQEKINALVTDK-QRIEEAKADYQQKITQLQTDLEKQISST 1042
             L+ +L R  A+Y   +SE        V D+ QRI+E K     KI ++   +E   +  
Sbjct: 953  CLQPKL-REGASYLVLQSE-------KVGDQAQRIQEMK----NKIDKMAAIIE---AYQ 997

Query: 1043 NEAETKYQTALQKQAEISENIESLRKSSESYKSEIAKFKSAAEEARKVLERNEQTWDQQK 1102
             E  ++YQ+ L+   ++SE +  L K +  Y++E+ K K +    +++L+R+E+ W ++K
Sbjct: 998  KEESSQYQSELKTNKDLSEWVMRLEKEAFDYQTELKKTKKSLYSTQELLDRHEKKWMEEK 1057

Query: 1103 ADIEANLDLAHQRIEELSTQNRLLYDQIXXXXXXXXXXXXXDTKISSDARELIVTLRRER 1162
            AD E  L    ++ E L  +N +L ++I                +S     L   LR ER
Sbjct: 1058 ADYERELISNIEQTESLRVENSVLIEKIDGATEGSNSNEKYLELVS-----LFSNLRHER 1112

Query: 1163 DILETKIDVSKREEKMLRQRLELTKSELDNLRAQLSESKGLVTEGTDSSQNQ-------- 1214
              LETK+   KR+  +LRQ+            A L +S G +       +N+        
Sbjct: 1113 SSLETKLTTCKRDLALLRQK-----------NASLEKSIGDLQRANTVPRNKVQCPAVII 1161

Query: 1215 ---EELFEKLNQLNLLREHNMSLRNESEKVSEHNEFLQNEILSLQEKVQPMEEQIKSLTA 1271
               E++ +++ Q+N+LRE+N  L    + V+E NE +  E++++QE++  ++  +     
Sbjct: 1162 DEYEKIIKEIAQVNILRENNAILHKSLKNVTEKNEAIYKELINMQEEISRLQGHLIQTKE 1221

Query: 1272 TXXXXXXXXXXXXXXSDRWKQRSQDILHKYERIDPEEYRKLASEIEVLKAELERKSAESI 1331
                            ++ KQR QD+  + +     E  KL + I  L+ +L      + 
Sbjct: 1222 QVSINANKVLAYESEIEQCKQRYQDLSQQQKLTHKNETEKLHNVIGDLEVKLLNVQNANA 1281

Query: 1332 DSQERFRKLRKQANERLDEFKAAKAKVESELELALSGKSQLEAKLSEAREKITSLETQLT 1391
            D + +F +L+KQA+E+LD  K  +  + +EL      K +LE  L     K+  LE +L 
Sbjct: 1282 DLENKFNRLKKQAHEKLDASKKQQTALTNELNELKETKDKLEENLHNEESKVVDLELKLK 1341

Query: 1392 ERPASEDDNPVSHELEETKTKLQDAENTINMLKSEWSISEESFKKQLDELNKQLETIQKN 1451
            E                    LQ  E    + K   SI+ + F ++++ L K+L+  +  
Sbjct: 1342 EHG------------------LQVGE----VSKDHDSIAFKPFVEEIESLKKELQVFRN- 1378

Query: 1452 XXXXXXXXXXXXYHEQPTAVLEDFKKQVEEERRTLIESHQQELTARLEASRKNFXXXXXX 1511
                             +   E  K  +EEE+  +I+   ++   +L+ +          
Sbjct: 1379 -------------ANDASDAFEKIKNNMEEEKNKIIDEKTKDFEKKLQDA---------- 1415

Query: 1512 XXXXXRDSLTNVSVEAASQNLEALKKKWEEEYEQQTLQRIREAEEALKKRIRLPSEERIN 1571
                   S +N S    S+++EALKK+W +EYE++T++RI+EAEE LKKRIRLPSEERI 
Sbjct: 1416 ----VNKSKSNESEVENSEHIEALKKEWLKEYEEETVKRIKEAEENLKKRIRLPSEERIQ 1471

Query: 1572 QVIERKQKALEQEFTTKVNATALALLKENPDSIA 1605
            ++I +++  LEQEF  K        LKEN  S+ 
Sbjct: 1472 KIISKRKGELEQEFERK--------LKENNKSLV 1497

>Smik_9.20 Chr9 complement(40653..45701) [5049 bp, 1682 aa] {ON}
            YIL149C (REAL)
          Length = 1682

 Score =  363 bits (932), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 415/1539 (26%), Positives = 739/1539 (48%), Gaps = 179/1539 (11%)

Query: 112  ERVQQQLEETERRVAAG----DSARRDLARLLEEKISDLDASQQELER---------VLG 158
            +++ Q  E   R++ A     DS+R  + RL +EK    DA ++ + R         V  
Sbjct: 85   DQLMQDRERCRRKIDALNKQLDSSRDAIKRLNDEK----DAKEESMIRQSKHQNVNSVQN 140

Query: 159  V----NKELRRHEMELEFTVQSQRSQSLREQAEIQRLQQELALVRSNAEWTTGQLNEKNQ 214
            V    NK LRR  ME+E  +Q  +S S+  Q +   + QE  L+  N +WT  +L+  N 
Sbjct: 141  VLDKENKLLRRKLMEMENILQICKSNSVSLQLKYDTIVQEKELMLQNKKWTEEKLSSYNN 200

Query: 215  QLNSYREKTNGEIQSTQVELNIVKNELEVEHANVAALRSKNGELSKQLQDALCETKRLTD 274
            +  +        I++ + +L   + + E   +    L  +N +LS  +++ + E K L D
Sbjct: 201  KTLADESTKASRIRNLEEKLYQAQADRESALSYSQLLLDQNKQLSHSVEEKILEIKNLKD 260

Query: 275  SLHSEKQEFAREMALKQRLIELLNGQVATMKQDLEKAYDVAKNGG--MSDSERERLLNDL 332
            +   EK EF++EM L++ + +LL+ Q+A+ ++D   + ++ K+      D +   + ++L
Sbjct: 261  TACIEKTEFSKEMTLQKSMNDLLSSQLASFERD-HSSGEIGKDDDNLCKDPDHNNVTDEL 319

Query: 333  FDTKKKLELSQANVSRLEDTIKELLETDNVQSGGRNGIEHANVGSPSGGSTISTVYGDLA 392
             +TK + + SQ    RL++ I + ++ D            A V +     T+  ++ D+ 
Sbjct: 320  MNTKVQFQKSQDECQRLQNIISDFVQED-----------KATVDTNGASHTVGKLFSDIK 368

Query: 393  ALRKQLVQERRHKEELQLQVESFVVELEHKIPVLNSFKKRIEELEKQLNGVTLLLE--AT 450
             LRKQL++ER  K +LQ Q+E F++ELEHK P L SFK+R + LE +L   T LLE  + 
Sbjct: 369  VLRKQLIKERSQKFQLQNQMEDFILELEHKTPELVSFKERTKSLEHELKRSTELLETISM 428

Query: 451  ARERDEKVVQIKQYKNKVGDYETQVGHLVQQRSDLARQVQCLLIHISVRDDSSGPLTAEE 510
            A+ +DE+  ++   + K+   E  +  LV+QR DLARQV+ LL++ S    ++ PL+ ++
Sbjct: 429  AKRKDER--ELTSLRQKINSCEANIHLLVKQRLDLARQVKVLLLNTSAIQKTTLPLSKDD 486

Query: 511  VEFVKKLQSCRDSATGSDTQAIISNRLVEFKSVVELQQKNAELLNAIRQLAQKLEQEEHK 570
            +  ++K+         +D QAIIS RLVEF ++ ELQ+KN ELL  IR LA KLE  E K
Sbjct: 487  LISLRKILESGSDVNENDAQAIISERLVEFNNINELQEKNVELLYCIRTLADKLEFHEGK 546

Query: 571  TQSKVKSLEQNTVNEAKEAILSLQEHVQMLEDQLETVTTERDSFKLLVSEGKNNSLPNPV 630
              + +  +E+ T+ EAK+AI+ L+     +E ++  +  ERDS+KLL S  +NN     V
Sbjct: 547  KDTTLAEVEKQTIKEAKDAIIELENTNMKMESRINILLRERDSYKLLASSKENN-----V 601

Query: 631  GAAALQPQEVAD--GIAHLEARLKAMAEESEQHAKMLNEEIKALYKSNSQLAIXXXXXXX 688
               A    E++    I  LEA L +   ES    + L +E+    K      I       
Sbjct: 602  NVNAKNFTEISHEKKIKELEAELSSTKVESSAVIQNLRKELTTYKKLLCDKKIASQDFEN 661

Query: 689  XXXXADEKLSLIQKSLELVKGENADLQNRAGSLQALLLEQDTRRQSTIEEFVSAKSELFS 748
                A EK S+++  +  +K    DL+ +  S+ + +  QD +        V   +EL  
Sbjct: 662  FKMLAKEKESILETRVNNLK---TDLEKQKLSVPSFV--QDNK--------VRDSTELLQ 708

Query: 749  ISSQLTILQSERDFLRKVEADLKKENESLNKDNNDSQLLILQLKTAQKERDSLIEETRK- 807
              ++  IL  E   L+K  A+     ESL +D        +QL+   KE +  + E +  
Sbjct: 709  SRTKTEILMHEISSLKKETANSMVLKESLTRDLERCCKEKIQLQMKLKESEISLNEQKVN 768

Query: 808  ------RYETRIEELDGELSATKQQLERKQREYDELSSSSSTQCKWFQSKLDSLKEELGS 861
                  +Y+ RI++L+  L   + +L+ K +E   L SS  +Q KW Q+ +D  +E+L S
Sbjct: 769  FDSKGIKYDARIKQLEESLERLRIELKSKAQEIKSLQSSKDSQLKWAQNTIDDTEEKLKS 828

Query: 862  SKLALKAKTSELDALKARLNSSTSKLEPASMDHQQSSLVLESDHASRVQSLSKDLDEANR 921
                L  K   +  L +++ +  ++L    + ++   L   SD ++   +L K+L++   
Sbjct: 829  VLTELSRKEKTVVTLSSKIENLDNELRENKLKYE--FLNNTSDASTLQPALRKELEQTQL 886

Query: 922  KLSSAYSEIERYKAASNATERPSLSYNAVQDNKDGSKQAAISLEA--------ELTKLNS 973
            +L  A+S++  Y+   +  E+     N+   +      A I LE         EL+ L  
Sbjct: 887  ELKDAHSQVRTYEEIISTNEKALKELNSQLASMKEDYDARIELECKEKLANEEELSLLRR 946

Query: 974  DIAMANDRIKVLEDELNRREATYSTERSELQEKINALVTDKQRIEEAKADYQQKITQLQT 1033
            ++    D I+ L+ +L  +E T       L ++   L    ++I+E KA    KI ++  
Sbjct: 947  EL----DEIRSLQPKL--KEGTVC-----LVKQSEKLRNQAEKIQEMKA----KIDKMNW 991

Query: 1034 DLEKQISSTNEAETKYQTALQKQAEISENIESLRKSSESYKSEIAKFKSAAEEARKVLER 1093
            +++       E  +++Q+ ++   E+SE +  L K +   + E+ K KS+  + + +L+ 
Sbjct: 992  NVQ---VYKKEKTSQFQSIMKANKELSELVTRLEKEATDSQMELKKLKSSLHKTQDLLDT 1048

Query: 1094 NEQTWDQQKADIEANLDLAHQRIEELSTQNRLLYDQIXXXXXXXXXXXXXDTKISSDARE 1153
            +E+ W ++KAD E  L    ++ E L  +N +L ++I                  SD  E
Sbjct: 1049 HEKKWMEEKADYERELISNIEQTESLRVENSVLIEKIGSVTE------------GSDGNE 1096

Query: 1154 -------LIVTLRRERDILETKIDVSKREEKMLRQRLELTKSELDNLR-------AQLSE 1199
                       LR ER+ LETK+   KR+  +++Q+    +  +++L+        +L  
Sbjct: 1097 DYLKLVSFFSNLRHERNSLETKLTTCKRDLALVKQKNASLEKNINDLQIDQPASQTELQC 1156

Query: 1200 SKGLVTEGTDSSQNQEELFEKLNQLNLLREHNMSLRNESEKVSEHNEFLQNEILSLQEKV 1259
            S  ++ E  D       + +++ Q+NLL+E+N  L+   + V+E N  +  E+   QE+V
Sbjct: 1157 SAVIIDEFND-------ITKEIAQVNLLKENNAILQKSLKNVTEKNREIYEELTIRQEEV 1209

Query: 1260 QPMEEQIKSLTATXXXXXXXXXXXXXXSDRWKQRSQDILHKYERIDPEEYRKLASEIEVL 1319
              ++  +                     D+ KQR  D+  +   +  +   KL SEI   
Sbjct: 1210 SQLKSDLIKTKEQVSVNANKILIYESEMDQCKQRYHDLSTQQREVQKKTIEKLNSEISDF 1269

Query: 1320 KAELERKSAESIDSQERFRKLRKQANERLDEFKAAKAKVESELELALSGKSQLEAKLSEA 1379
            KA+L        + + +F +L+KQA+E+LD  K  +  + +EL+   + + +LE  L+  
Sbjct: 1270 KAKLLDAENTKTELENKFNRLKKQAHEKLDASKKQQTALTNELKELKAVRDKLEQDLNSK 1329

Query: 1380 REKITSLETQLTERPASEDDNPVSHELEETKTKLQDAENTINMLKSEWSISEESFKKQLD 1439
              K   L+T+           P  H ++           + ++L+ +  ++     ++++
Sbjct: 1330 NFKTVDLDTE-----------PKEHTVQ-----------SGDLLRDQEKVASLPLIEEIE 1367

Query: 1440 ELNKQLETIQKNXXXXXXXXXXXXYHEQPTAVLEDFKKQVEEERRTLIESHQQELTARLE 1499
             L ++L+   KN                 +   E  +  +EEE+  +I    +E   +LE
Sbjct: 1368 SLKRELQVF-KNAN-------------NSSDAFEKLRDNMEEEKNKIINERTKEFEKKLE 1413

Query: 1500 ASRKNFXXXXXXXXXXXRDSLTNVSVEAASQNLEALKKKWEEEYEQQTLQRIREAEEALK 1559
                               S +   V   S+N+E LKK+W +EYE++T++RIREAEE LK
Sbjct: 1414 --------------EIVSKSKSTGKVADNSENIETLKKEWLKEYEEETIRRIREAEENLK 1459

Query: 1560 KRIRLPSEERINQVIERKQKALEQEFTTKV--NATALAL 1596
            KRIRLPSEERI ++I ++++ LE+EF  K+  NA++L  
Sbjct: 1460 KRIRLPSEERIQKIISKRKEELEEEFQRKLKENASSLTF 1498

>YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}
            MLP2Myosin-like protein associated with the nuclear
            envelope, connects the nuclear pore complex with the
            nuclear interior; involved in the Tel1p pathway that
            controls telomere length
          Length = 1679

 Score =  349 bits (896), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 402/1488 (27%), Positives = 728/1488 (48%), Gaps = 187/1488 (12%)

Query: 160  NKELRRHEMELEFTVQSQRSQSLREQAEIQRLQQELALVRSNAEWTTGQLNEKNQQLNSY 219
            NK LRR  ME+E  +Q  +S ++  Q +     QE  L+       + +L E  ++L+S+
Sbjct: 146  NKLLRRKLMEMENILQRCKSNAISLQLKYDTSVQEKELM-----LQSKKLIE--EKLSSF 198

Query: 220  REKTNGE--IQSTQVE-----LNIVKNELEVEHANVAALRSKNGELSKQLQDALCETKRL 272
             +KT  E   +S+ VE     L  +++  E        L ++N +LS+ +++ + E K L
Sbjct: 199  SKKTLTEEVTKSSHVENLEEKLYQMQSNYESVFTYNKFLLNQNKQLSQSVEEKVLEMKNL 258

Query: 273  TDSLHSEKQEFAREMALKQRLIELLNGQVATMKQDLE-KAYDVAKNGGMSDSERERLLND 331
             D+   EK EF++EM L++ + +LL  Q+ ++++D   +A +   +    + E   ++++
Sbjct: 259  KDTASVEKAEFSKEMTLQKNMNDLLRSQLTSLEKDCSLRAIEKNDDNSCRNPEHTDVIDE 318

Query: 332  LFDTKKKLELSQANVSRLEDTIKELLETDNVQSGGRNGIEHANVGSPSGGSTISTVYGDL 391
            L DTK +LE S+    RL++ + +  +            E A + + +   T+  ++ D+
Sbjct: 319  LIDTKLRLEKSKNECQRLQNIVMDCTKE-----------EEATMTTSAVSPTVGKLFSDI 367

Query: 392  AALRKQLVQERRHKEELQLQVESFVVELEHKIPVLNSFKKRIEELEKQLNGVTLLLEATA 451
              L++QL++ER  K +LQ Q+E F++ELEHK P L SFK+R + LE +L   T LLE  +
Sbjct: 368  KVLKRQLIKERNQKFQLQNQLEDFILELEHKTPELISFKERTKSLEHELKRSTELLETVS 427

Query: 452  RERDEKVVQIKQYKNKVGDYETQVGHLVQQRSDLARQVQCLLIHISVRDDSSGPLTAEEV 511
              + ++  +I   + K+   E  +  LV+QR DLARQV+ LL++ S   +++ PL+ +E+
Sbjct: 428  LTKRKQEREITSLRQKINGCEANIHSLVKQRLDLARQVKLLLLNTSAIQETASPLSQDEL 487

Query: 512  EFVKKLQSCRDSATGSDTQAIISNRLVEFKSVVELQQKNAELLNAIRQLAQKLEQEEHKT 571
              ++K+    +    +D+QAII+ RLVEF +V ELQ+KN ELLN IR LA KLE  E K 
Sbjct: 488  ISLRKILESSNIVNENDSQAIITERLVEFSNVNELQEKNVELLNCIRILADKLENYEGKQ 547

Query: 572  QSKVKSLEQNTVNEAKEAILSLQEHVQMLEDQLETVTTERDSFKLLVSEGKNNSLPNPVG 631
               ++ +E  T+ EAK+AI+ L+     +E ++  +  ERDS+KLL S  +N +  N V 
Sbjct: 548  DKTLQKVENQTIKEAKDAIIELENINAKMETRINILLRERDSYKLLASTEENKANTNSVT 607

Query: 632  A--AALQPQEVADGIAHLEARLKAMAEESEQHAKMLNEEIKALYKSNSQLAIXXXXXXXX 689
            +  AA + +     I  LEA L +   E+    + L +E+    KS  +           
Sbjct: 608  SMEAAREKK-----IRELEAELSSTKVENSAIIQNLRKELLIYKKSQCKKKTTLEDFENF 662

Query: 690  XXXADEKLSLIQKSLELVKGENADLQNRAGSLQALLLEQDTRRQSTIEEFVSAKSELFSI 749
               A EK  +++++++ +K E      +  S     +  +  R ST  E   ++ ++ S+
Sbjct: 663  KGLAKEKERMLEEAIDHLKAE----LEKQKSWVPSYIHVEKERAST--ELSQSRIKIKSL 716

Query: 750  SSQLTILQSERDFLRKVEADLKKENESLNKDNNDSQLLILQLKTAQKERDSLIEETRKRY 809
              +++ L+ E       +  L ++ E   K+  + Q+ + + + +  E          +Y
Sbjct: 717  EYEISKLKKETASFIPTKESLTRDFEQCCKEKKELQMRLKESEISHNENKMDFSSKEGQY 776

Query: 810  ETRIEELDGELSATKQQLERKQREYDELSSSSSTQCKWFQSKLD-------SLKEELGSS 862
            + +I+EL+  L   +  L+ K +E + + S   +Q KW Q+ +D       SL  EL + 
Sbjct: 777  KAKIKELENNLERLRSDLQSKIQEIESIRSCKDSQLKWAQNTIDDTEMKMKSLLTELSNK 836

Query: 863  KLALKAKTSELDALKARLNSSTSKLEPASMDHQQSSLVLESDHASRVQSLSKDLDEANRK 922
            +  ++  +SE++ L   L    +K +   +D    +  LE        +L K+L++   +
Sbjct: 837  ETTIEKLSSEIENLDKELRK--TKFQYKFLDQNSDASTLEP-------TLRKELEQIQVQ 887

Query: 923  LSSAYSEIERYKAASNATERPSLSYNAVQDNKDGSKQAAISLEAEL--TKLNSDIAMAND 980
            L  A S+I+ Y+   ++ E                  A I L+ EL  TK N D      
Sbjct: 888  LKDANSQIQAYEEIISSNE-----------------NALIELKNELAKTKENYDA----- 925

Query: 981  RIKVLEDELNRREATYSTERSELQEKINALVTDKQRIEEAKADYQQKITQLQTDLEK--- 1037
            +I++ + E   RE   S  R EL E I AL   + +++E    + Q+  +L+ ++E+   
Sbjct: 926  KIELEKKEKWAREEDLSRLRGELGE-IRAL---QPKLKEGALHFVQQSEKLRNEVERIQK 981

Query: 1038 ------------QISSTNEAETKYQTALQKQAEISENIESLRKSSESYKSEIAKFKSAAE 1085
                        Q+    E  ++YQ+ +++  ++SE +  L K +   ++E+ K KS+  
Sbjct: 982  MIEKIEKMSTIVQLCKKKEM-SQYQSTMKENKDLSELVIRLEKDAADCQAELTKTKSSLY 1040

Query: 1086 EARKVLERNEQTWDQQKADIEANLDLAHQRIEELSTQNRLLYDQIXXXXXXXXXXXXXDT 1145
             A+ +L+++E+ W ++KAD E  L    ++ E L  +N +L +++             DT
Sbjct: 1041 SAQDLLDKHERKWMEEKADYERELISNIEQTESLRVENSVLIEKV------------DDT 1088

Query: 1146 KISSDARE------LIVTLRRERDILETKIDVSKREEKMLRQRLELTKSELDNL-RAQ-L 1197
              ++  ++      L   LR ER+ LETK+   KRE   ++Q+ +  +  +++L R Q L
Sbjct: 1089 AANNGDKDHLKLVSLFSNLRHERNSLETKLTTCKRELAFVKQKNDSLEKTINDLQRTQTL 1148

Query: 1198 SE-----SKGLVTEGTDSSQNQEELFEKLNQLNLLREHNMSLRNESEKVSEHNEFLQNEI 1252
            SE     S  ++ E  D       + +++ Q+N+L+E+N  L+   + V+E N  +  ++
Sbjct: 1149 SEKEYQCSAVIIDEFKD-------ITKEVTQVNILKENNAILQKSLKNVTEKNREIYKQL 1201

Query: 1253 LSLQEKVQPMEEQIKSLTATXXXXXXXXXXXXXXSDRWKQRSQDILHKYERIDPEEYRKL 1312
               QE++  ++  +                     ++ KQR QD+  + +    ++  KL
Sbjct: 1202 NDRQEEISRLQRDLIQTKEQVSINSNKILVYESEMEQCKQRYQDLSQQQKDAQKKDIEKL 1261

Query: 1313 ASEIEVLKAELERKSAESIDSQERFRKLRKQANERLDEFKAAKAKVESELELALSGKSQL 1372
             +EI  LK +L      + D + +F +L+KQA+E+LD  K  +A + +EL    + K +L
Sbjct: 1262 TNEISDLKGKLSSAENANADLENKFNRLKKQAHEKLDASKKQQAALTNELNELKAIKDKL 1321

Query: 1373 EAKLSEAREKITSLETQLTERPASEDDNPVSHELEETKTKLQDAENTINMLKSEWSISEE 1432
            E  L     K+  L+T+L       +D    HE +  +T +++ E+    LK E  I   
Sbjct: 1322 EQDLHFENAKVIDLDTKLKAHELQSEDVSRDHEKDTYRTLMEEIES----LKKELQI--- 1374

Query: 1433 SFKKQLDELNKQLETIQKNXXXXXXXXXXXXYHEQPTAVLEDFKKQVEEERRTLIESHQQ 1492
             FK                                 +   E  K  +E+E+  +I+   +
Sbjct: 1375 -FK----------------------------TANSSSDAFEKLKVNMEKEKDRIIDERTK 1405

Query: 1493 ELTARLEASRKNFXXXXXXXXXXXRDSLTNVSVEA-ASQNLEALKKKWEEEYEQQTLQRI 1551
            E   +L+ +                    + S EA  S+++E LKK+W +EYE +TL+RI
Sbjct: 1406 EFEKKLQETLNK-----------------STSSEAEYSKDIETLKKEWLKEYEDETLRRI 1448

Query: 1552 REAEEALKKRIRLPSEERINQVIERKQKALEQEFTTKV--NATALALL 1597
            +EAEE LKKRIRLPSEERI ++I ++++ LE+EF  K+  NA +L  L
Sbjct: 1449 KEAEENLKKRIRLPSEERIQKIISKRKEELEEEFRKKLKENAGSLTFL 1496

>KAFR0D02220 Chr4 complement(443928..448952) [5025 bp, 1674 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1674

 Score =  342 bits (877), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 406/1545 (26%), Positives = 744/1545 (48%), Gaps = 174/1545 (11%)

Query: 156  VLGVNKELRRHEMELEFTVQSQRSQSLREQAEIQRLQQELALVRSNAEW-------TTGQ 208
            +  +N E+   + ELE      +S+ L  Q+E +R  ++  LVR + +W       TT +
Sbjct: 96   ISNINDEILTLQRELE----RAKSEHLISQSEAERSLKQSELVREHNQWLEEHLVKTTEE 151

Query: 209  LNEKNQQLNSYREKTNGEIQSTQVELNIVKNELEVEHANVAALRSKNGELSKQLQDALCE 268
            L  + Q +    EK + EI + + E++I+K        N   L  KN ELS+ +Q+ L E
Sbjct: 152  LMTQKQSILKMEEK-DQEIDNLRHEVSILK-------KNNDLLLGKNQELSENVQEKLIE 203

Query: 269  TKRLTDSLHSEKQEFAREMALKQRLIELLNGQVATMKQDLEKAYDVAKNGGMSDSERERL 328
             K+ +D   +++QEF  E+ LK R+    N  + T  +++++   +      S +E +++
Sbjct: 204  IKQKSDDYSTKQQEFLHEIGLKDRI----NSSLETQLKEIQQEKSIQNEDNTSRAESQKI 259

Query: 329  LNDLFDTKKKLELSQANVSRLEDTIKELLETDNVQSGGRNGIEHANVGSPSGGSTISTVY 388
            +  L DT+K+L+ S+   +RL+  + E                            I+ V 
Sbjct: 260  MEQLIDTRKQLKDSRNECTRLKSYVNEF---------------------------INDVN 292

Query: 389  GDLAALRKQLVQERR----HKEELQLQVESFVVELEHKIPVLNSFKKRIEELEKQLNGVT 444
            G+ ++    L +E       K+ L+ QVE+F+ ELE K+PV++S +K+ ++LEK+L+ VT
Sbjct: 293  GEYSSSSSLLKKELLKVKEQKDYLETQVENFITELEIKVPVIDSLEKKNKDLEKELSDVT 352

Query: 445  LLLEATARERDEKVVQIKQYKNKVGDYETQVGHLVQQRSDLARQVQCLLIHISVRDDSSG 504
             L++  + ER+    + + +K K    +  +  L  QRSDLA Q+Q LL+ +  +  ++ 
Sbjct: 353  SLVDRISIERESLEKEFQSFKRKSEHNDGMIQTLTTQRSDLAHQIQFLLLILGEQATTNA 412

Query: 505  PLTAEEVEFVKKLQSCRDSATGSDTQAIISNRLVEFKSVVELQQKNAELLNAIRQLAQKL 564
             L+ +E +F+++L      A  +D+Q+IIS RL++F  + ELQ++N ++L  +R LA +L
Sbjct: 413  LLSKDETDFIRRLTENDTYARNNDSQSIISERLLKFADITELQKQNMDILATVRHLAGQL 472

Query: 565  EQEEHKTQSKVKSLEQNTVNEAKEAILSLQEHVQMLEDQLETVTTERDSFKLLVSEGKNN 624
            E++E   Q+   ++E+ T+ EAK+A+L LQE+   LE +LET   ERD +KLL S+GK  
Sbjct: 473  EEQEKLRQADHHTIERKTLEEAKKALLDLQEYTNSLERKLETFRKERDVYKLL-SKGK-- 529

Query: 625  SLPNPVGAAALQPQEVADGIAHLEARLKAMAEESEQHAKMLNEEIKALYKSN-------S 677
                    ++ +P E  D   H   +L+    E +Q  + L +EI+ L ++N        
Sbjct: 530  ------SPSSNKPSECNDIDKHTTGKLQ---NELQQTREYLTKEIEKLTRTNKDILNKKK 580

Query: 678  QLAIXXXXXXXXXXXADEKLSLIQKSLELVKGENADLQNRAGSLQALLLEQDTRRQSTIE 737
            +L             A+ K  LI+ +L +++     +  +   LQ LL +++ +     +
Sbjct: 581  ELEYSMKKMESAKEYAEGKAELIENNLLMLQENRKSVLEQNDHLQQLLSQKEAKLAELTQ 640

Query: 738  EFVSAKSELFSISSQLTILQSERDFLRKVEADLKKENESLNKDNNDSQLLILQLKTAQKE 797
            +     S+   +  + T  QS+ + LR      +KE   + ++ N  ++ I +L+ ++ E
Sbjct: 641  DLHELTSQYNLLQIRFTDTQSQSNSLRTQHQTTQKELFEVVEEKNALKVKIHELEISRNE 700

Query: 798  RDSLIEETRKRYETRIEELDGELSATKQQLERKQREYDELSSSSSTQCKWFQSKLDSLKE 857
               +      +   R+ E         + +E+++ +  ++    + +  W+Q    +  E
Sbjct: 701  CKGIQATVELKLNERLTEYQLHEQDLLKIIEKQEDQIRDMEVKRAEELNWYQKNFPTQTE 760

Query: 858  -ELG----SSKLALKAKTSELDALKARLNSSTSKLEPASMDHQQSSLVLESDHASRVQSL 912
             E+G      K     + S  D L+++ + S    +  +    + S  L      R +  
Sbjct: 761  TEIGLPVDMKKEGETGRQSNRDTLESQKSGSPGFTDLGTDSSVRKSTSLPVMQVGRTEEE 820

Query: 913  SKDLDEANRKLSSAYSEIERYKAASNATERPSLSYNAVQDNKDGSKQAAISLEAELTKLN 972
            SK              E ++  A +++++   L  N  +  KD   Q    L ++  +L 
Sbjct: 821  SK--------------EAKKCDALTDSSQVVGLPENVTKKEKDLIAQIE-QLASDKKELK 865

Query: 973  SDIAMANDRIKVLEDELNRREATYSTERSELQEKINALVTDKQRIEEAKADYQQKITQLQ 1032
            + +       + L D+L   + ++ TE++ L  +++ ++ +    E AK         L+
Sbjct: 866  TSLQAIRAEYQHLHDQLQLEKNSFDTEKASLNNELDKIMENNSLTEVAKK-------SLE 918

Query: 1033 TDLEKQISSTNEAETKYQTALQKQAEISENIESLRKSSESYKSEIAKFKSAAEEARKVLE 1092
             DL       ++ E K +   QK  E +  +       E    EI+ ++   EE  K  E
Sbjct: 919  DDL-------HDVEMKLEEERQKHEETNATLSEKELLCEKMIEEISGYR---EELSKSAE 968

Query: 1093 RNEQTWDQQKADIEANLDLAHQRIEELSTQNRLLYDQIXXXXXXXXXXXXXDTKISSDAR 1152
               Q   Q   ++E  LDLA++RI++L TQN LL++Q+             DT+   D +
Sbjct: 969  M--QVDIQHTRELEDLLDLANKRIDDLCTQNNLLHEQL------NATLDLEDTQNKDDIK 1020

Query: 1153 ELIVTLRRERDILETKIDVSKREEKMLRQRLELTKSELDNLRAQLSESKGLVTEGTDSSQ 1212
            ++IV ++RERD L+ K+ + +RE ++LR+R    KSELD +      SKG        S 
Sbjct: 1021 DIIVCMKRERDTLQKKLAIVEREGEVLRERCAGLKSELDAV------SKGQQWHNLPLSN 1074

Query: 1213 ---NQEELFEKLNQLNLLREHNMSLRNESEKVSEHNEFLQNEILSLQEKVQPMEEQIKSL 1269
                 E++ ++L +++LLRE+N+SL  E  ++   N  L +E+  +++   P+++Q  + 
Sbjct: 1075 LLTGHEKILDELKEVHLLRENNVSLLTEVNQLKHDNCILNDELSQVRKLSGPLQDQKNNT 1134

Query: 1270 TATXXXXXXXXXXXXXXSDRWKQRSQDILHKYERIDPEEYRKLASEIEVLKAELERKSAE 1329
                              +RWK+R Q ++H+ +     E     +EI+ LK  +E ++ E
Sbjct: 1135 ERYFKEKDQEISLYKDEIERWKKRWQQMVHRQDDTLGLEAN-FKNEIDSLKGLIEERTKE 1193

Query: 1330 SIDSQERFRKLRKQANERLDEFKAAKAKVESELELALSGKSQLEAKLSEAREKITSLETQ 1389
                 E+F+ L+KQA+E+LD  K     + ++L    +   QLE  + E  +KI  +E  
Sbjct: 1194 KEKLSEKFQLLKKQAHEKLDANKIHIQTLNNDLSEIKASNLQLEEVMKEKDKKIREIELT 1253

Query: 1390 LTER--PASEDDNPVSHE-LEETKTKLQDAENTINMLKSEWSISEESFKKQLDELNKQLE 1446
            L E      +D+  VS +  +E + KL     TI ML+       E+  +++  L +++ 
Sbjct: 1254 LKENLEKFDKDEKLVSEKTFKENEAKLN---KTITMLQK----LNETLNQEVVSLREEIN 1306

Query: 1447 TIQKNXXXXXXXXXXXXYHEQPTAVLEDFKKQVEEERRTLIESHQQELTARLEASRKNFX 1506
             ++K               ++   ++   K   E E+  LIE   +EL  + E+ R    
Sbjct: 1307 VLRKKD-------------DETNQLISTMKLDFEREKDRLIEEKVRELNEKFESGRNEVL 1353

Query: 1507 XXXXXXXXXXRDSLTNVSVEAASQNLEALKKKWEEEYEQQTLQRIREAEEALKKRIRLPS 1566
                           NV+ +    N++ LK++  +++E+QTLQRI EA+E LK+ IRLPS
Sbjct: 1354 SKQSE----------NVTNDNTGSNVDKLKQELRKDWEEQTLQRIEEAKENLKRHIRLPS 1403

Query: 1567 EERINQVIERKQKALEQEFTTKV--NATALALLKENPDSIASDKADLIKDHQKEIV--QL 1622
            EE+I ++IE+++  LE +F  +V   A  +AL         +DKAD+  D  K+ V  +L
Sbjct: 1404 EEKIQRIIEKRRAELESDFDKRVEEKANLIAL---------ADKADMSPDELKQKVRREL 1454

Query: 1623 KKDLADKFEGQLVQVKKKAFEEGRQQGIMKVKLLESKISKLESQA 1667
            +  +    + +L  ++ KAFEEG++Q  MK  LLE K+SKLESQ 
Sbjct: 1455 EHAIEQDLQAKLETIRTKAFEEGKRQAEMKTTLLERKLSKLESQV 1499

>KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5.702
            YIL149C
          Length = 1608

 Score =  287 bits (734), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 439/1648 (26%), Positives = 745/1648 (45%), Gaps = 276/1648 (16%)

Query: 135  LARLLEEKISDLDASQQELERVLGVNKELRR-HEMELEFTVQSQRSQSLREQAEIQR--L 191
            L+R LEEK   LD  Q     V   N ELR   E  +E   +   S++ R Q+E+QR  L
Sbjct: 64   LSRSLEEKTGILDTVQSS---VSTANAELRSAREQVVELRQRLGESETQRFQSELQRDRL 120

Query: 192  QQELALVRSNAEWTTGQLNEKNQQLNSYREKTNGEIQSTQVELNIVKNELEVEHANVAAL 251
             ++L         T G+L E  ++L  +        Q    ++ +++ +L+   + + AL
Sbjct: 121  SEQLKQGERYINATNGRLLESTKKLLDF--------QRDDRQVGVIRGKLDQSLSEIKAL 172

Query: 252  RSKNGEL-------SKQLQDALCETKRLTDSLHSEKQEFAREMALKQRLIELLNGQVATM 304
            R  N  L       +++L D     K L+D L S++ +F RE+A + +L  +L  QV ++
Sbjct: 173  RDSNSALLDSLERINRELTDKAALNKTLSDQLSSQRHDFERELATRDKLNAVLKKQVNSL 232

Query: 305  KQDLEKAYDVAKNGGMSDSERERLLNDLFDTKKKLELSQANVSRLEDTIKELLETDNVQS 364
              +L        NGG + +  E   ND F   K+    +  +S  ++ ++ELL       
Sbjct: 233  HSEL-------GNGGETPAHAEP--NDQF--AKQSSQHEEEISNYKEQVEELL------- 274

Query: 365  GGRNGIEHANVGSPSGGSTISTVYGDLAALRKQLVQERRHKEELQLQVESFVVELEHKIP 424
                GI     G+PS           +A LRK L++ER+    L+ Q+ESFV+ELEH++P
Sbjct: 275  ----GI--LGQGAPS-----------IAHLRKLLLKERKENVSLKKQMESFVIELEHRLP 317

Query: 425  VLNSFKKRIEELEKQLNGVT--LLLEATARERDEKVVQIKQYKNKVGDYETQVGH-LVQQ 481
             L   +K+ +E++++L+  T  ++ E+ A+ R ++  ++   + KV D+  Q+ H L  Q
Sbjct: 318  GLQILEKQNKEVQQKLHAATNKMIEESKAKIRTQR--ELSSSRQKV-DHLNQIFHKLRVQ 374

Query: 482  RSDLARQVQCLLIHISVRDDSSGPLTAEEVEFVKKLQSCRDSATGSDTQAIISNRLVEFK 541
            RSDLA Q+Q LL      + S   L   E+ F+K +    +     D+Q I+S+RL+ F 
Sbjct: 375  RSDLAHQIQFLL----TVNSSDTVLPPSELSFIKTIIENENWDAYKDSQRIVSDRLLRFD 430

Query: 542  SVVELQQKNAELLNAIRQLAQKLEQEEHKTQSKVKSLEQNTVNEAKEAILSLQEHVQMLE 601
            ++ ELQ++N +L++ +R L  K+E  E    S +      T+  AK  I  L++    LE
Sbjct: 431  NIPELQEQNMKLVSTVRSLVDKVESWEADNDSGL------TLEAAKLQISKLEQSNAQLE 484

Query: 602  DQLETVTTERDSFKLLVSEGKNNSLPNPVGAAALQPQEVADGIAHLEARLKAMAEESEQH 661
             +++      ++ K        +SL + +    ++ Q+    I  LE++L  + E   Q 
Sbjct: 485  SEVKNWEALMETLK------DGDSLDSKINVTMVEQQK---KIEELESKLTDVGESHVQK 535

Query: 662  AK--------------MLNEEIKALYKSNSQLAIXXXXXXXXXXXADEKLSLIQKSLELV 707
                            MLNE+IK   KS+                  E LSL Q+     
Sbjct: 536  INVLNKTIDRNQSTINMLNEQIKNTVKSD------MNAKSELIACKRENLSLTQQI---- 585

Query: 708  KGENADLQNRAGSLQALLLEQDTRRQSTIEEFVSAKSELFSISSQLTIL--------QSE 759
                +  QN    L +   +++   Q  I E   A ++  S  +   +L        Q +
Sbjct: 586  ----STKQNELDELNSKSAQKERDYQLKIAELSVAANKCKSWENSFHLLTEEKTQMEQKQ 641

Query: 760  RDFLRKVEADLKKENESLNKDNNDSQLLILQLKTAQKERDSLI---EETRKRYE----TR 812
            R    K++ + KK               +LQL+T  KE +  I   E  RKR E    ++
Sbjct: 642  RSLFDKIQQESKK---------------LLQLETRNKELEVKISGKELHRKRSEETLSSK 686

Query: 813  IEELDGELSATKQQLERKQREYDELSSSSSTQCKWFQSKLDSLKEELGSSKLALKAKTSE 872
            I  L  E  +    L  K+ E  +    S  Q KW+Q  +D L E+        K K+++
Sbjct: 687  ITFLSEENKSLHNDLAFKEEEVKQFIEKSEKQIKWYQQNIDELSEQN-------KNKSNK 739

Query: 873  LDALKARLNSSTSKLEPASMDHQQSSLVLESDHASRVQSLSKDLDEANRKLSSAYSEIER 932
            +  L  +L   + K                        SLS        +L    +E+  
Sbjct: 740  IIELNDKLRLLSEK------------------------SLSNKPYPVGTELKELQNELNG 775

Query: 933  YKAASNATERPSLSY-NAVQDNKDGSKQAAISLEAELTKLNSDIAMANDRIKVLEDELNR 991
             KAA   +E  +  Y + ++ N++    + +S +  +++L S     + + + L++++  
Sbjct: 776  MKAALEVSESQATLYKDTLERNQNFYNNSTLSFQNTISELQSKNEALSKQHETLQNQITE 835

Query: 992  REAT--------------YSTERSELQEKINALVTDKQRIEEAKADYQQKITQLQTDLEK 1037
             E                 ++E++ L+EK+N+L   +++I E K +Y  +I +++++L+ 
Sbjct: 836  TENQSKGIQLEHQTIIDRLTSEKTALEEKLNSLSHSEEKIAEMKGEYDAQIQKIESNLKI 895

Query: 1038 QISSTNEAETKYQTAL-QKQAEISE---NIESLRKSSESYKSEIAKFKSAAEEARKVLER 1093
            Q    ++    +++AL  K+ E++     IE L        S+IA     AE ARK L +
Sbjct: 896  Q----SDTRLNFESALTSKEKELTSYAVQIEQLNTEIAKLNSDIAALTEPAE-ARKTLIK 950

Query: 1094 NEQTWDQQKADIEANLDLAHQRIEELSTQNRLLYDQIXXXXXXXXXXXXXDTKISSDARE 1153
               +  Q+       L LA+QRIE L+ QN +LYD               D + + D R 
Sbjct: 951  ERDSLGQE-------LKLANQRIESLAAQNSILYDTFSGMRHVDA-----DAEPNEDLRN 998

Query: 1154 LIVTLRRERDILETKIDVSKREEKMLRQRLELTKSELDNLRAQLSESKGLVTEGTDSSQN 1213
            L++ LR ERD+ +++   ++R+ K+L++ L+    +L     ++ E      +    +  
Sbjct: 999  LVINLRIERDMHQSQETTAQRDVKLLKKNLKEITEKLAITCPEIDEPTNTEKDDFSLTVT 1058

Query: 1214 QEELFEKLNQLNLLREHNMSLRNESEKVSEHNEFLQNEILSLQEKVQPMEEQIK--SLTA 1271
             E++  +L  L   +E N+ L    + ++E    LQ E+  L+E     EE  K  S   
Sbjct: 1059 HEKIMRELEGLTNTKEENLYLDESIKSLNEDKRTLQEEVSRLRES----EELAKKNSSAI 1114

Query: 1272 TXXXXXXXXXXXXXXSDRWKQRSQDILHKYERIDPEEYRKLASEIEVLKAELERKSAESI 1331
            +              S++WK   Q +          E + L  ++E  KA+++ K+ E+ 
Sbjct: 1115 SEQEWQQKIETYQQESEKWKLMCQQMSENT----ATEIQNLQQQLETFKADIQLKTQEND 1170

Query: 1332 DSQERFRKLRKQANERLDEFKAAKAKVESELELALSGKSQLEAKLSEAREKITSLETQLT 1391
            D  +RF +L+KQA+E+L+  KA    +  EL       S+L+      +EK+ + ET   
Sbjct: 1171 DLNDRFTRLKKQAHEKLNASKATSDSLAIEL-------SELKTVNDALQEKLNNQETNSV 1223

Query: 1392 ERPASEDDNPVSHELEETKTKLQDAENTINMLKSEWSISEESFKKQLDELNKQLETIQKN 1451
            +   SE +  +  +L+E   + +        L+ E   S +S +K + ++ K+L T+++N
Sbjct: 1224 D---SESNAALILQLKEENKQAKS-------LELELRHSVDSSEKLIADMTKELTTLKEN 1273

Query: 1452 XXXXXXXXXXXXYHEQPTAVLEDFKKQVEEERRTLIESHQQELTARLEASRKNFXXXXXX 1511
                          E  T  LE  K + E+E+R LIE    ELT R E  +K        
Sbjct: 1274 PIQGSVNV------EDYTHRLEQLKSEFEDEKRVLIEKTTSELTERFEREKKELMNN--- 1324

Query: 1512 XXXXXRDSLTNVSVEAASQNLEALKKKWEEEYEQQTLQRIREAEEALKKRIRLPSEERIN 1571
                             + NLE L+K  EEE+E++TLQRI EA+E LKK IRLP+EE+I 
Sbjct: 1325 -----------------NANLEELRKPLEEEWERKTLQRIEEAKENLKKHIRLPTEEKIE 1367

Query: 1572 QVIERKQKALEQEFTTKVNATALALLKENPDSIASDKADLIKDHQKEIVQLKKDLADKFE 1631
            +VI +++  LE++F TKV A    LLK     +++  AD ++   +E  ++K  L + FE
Sbjct: 1368 RVIAKRKAQLEEQFQTKV-AEQANLLK--LSELSNKTADELEKEVRE--EIKTRLEEDFE 1422

Query: 1632 GQLVQVKKKAFEEGRQQGIMKVKLLESKISKLESQAKAPLG----TNVPTKI----PLEN 1683
                 +KKKAFEEGRQQ  MK  LLE KI+KLE++ +   G     N   KI    PL  
Sbjct: 1423 ----LLKKKAFEEGRQQASMKTTLLERKIAKLEARLQGGTGPLKSANGLNKINIDSPLMV 1478

Query: 1684 TQPLAQQVPVKPSPFQLAYAQATFGNVP 1711
              PL  +  +   P   A A  T  + P
Sbjct: 1479 AGPLTNEPVLDEKPNAFAGATTTTISQP 1506

>KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON} Anc_5.702
            YIL149C
          Length = 1651

 Score =  272 bits (696), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 347/1373 (25%), Positives = 656/1373 (47%), Gaps = 137/1373 (9%)

Query: 375  VGSPSGGSTISTVYGDLAALRKQLVQERRHKEELQLQVESFVVELEHKIPVLNSFKKRIE 434
             G+     ++S +  +++ L  +L +E   K++L+ QV  FV ELE   P++ SFK++ E
Sbjct: 276  TGNDETSHSMSELNNNISILSNRLKRETLSKQKLEKQVHKFVTELEQTAPIIKSFKQKSE 335

Query: 435  ELEKQLNGVTLLLEATARERDEKVVQIKQYKNKVGDYETQVGHLVQQRSDLARQVQCLLI 494
            + + Q++ + L LE   ++++    +++QYK ++     Q   L ++R DLARQ+Q LL+
Sbjct: 336  QSDAQIHKLQLHLEHVTKDKETIFQEVEQYKKQLEQISGQDKILRRERFDLARQLQYLLL 395

Query: 495  HISVRDDSSGPLTAEEVEFVKKLQSC---RDSATGSDTQAIISNRLVEFKSVVELQQKNA 551
            +  V+D S  PLT+ E  ++K++ +      + + +D+Q IIS R+++FKS+VELQQ+N 
Sbjct: 396  NGFVKD-SDDPLTSSEFSYIKEILNTDPEEGNTSSTDSQLIISKRMLKFKSIVELQQQNI 454

Query: 552  ELLNAIRQLAQKLEQEEHKTQSKVKSLEQNTVNEAKEAILSLQEHVQMLEDQLETVTTER 611
             LL+A+R L+ + E  E K +S   S+E   +NEAK+ +L LQ++   LE ++E++T   
Sbjct: 455  NLLSAVRTLSDRAETLERKLESG-DSIE--AINEAKQTLLDLQQYNSSLEAKVESLTN-- 509

Query: 612  DSFKLLVSEGKNNSLPNPVGAAALQPQEVADG--IAHLEARLKAMAEESEQHAKMLNEEI 669
               KL     K N     +G       +++DG  I  L+ +  ++  ES +    L  +I
Sbjct: 510  ---KL-----KANEHFTSIGDGEFGNSDLSDGNNIQALKNKYDSLMAESSETIGHLYSQI 561

Query: 670  KALYKSNSQLAIXXXXXXXXXXXADEKLSLIQKSLELVKGENADLQNRAGSLQALLLEQD 729
              L +S S LA             +++L + Q  L+L K EN+ L+NR  +    L E++
Sbjct: 562  NNLQQSKSDLAKECESLINSKHLIEDRLKITQDMLDLSKNENSTLRNRIKNTSQALKERE 621

Query: 730  TRRQSTIEEFVSAKSELFSISSQLTILQSERDFLRKVEADLK-KENESLNKDNNDSQLLI 788
                 TI++++   ++L  I  QL     E+D L+  ++ ++ K N++L K+ N+ Q LI
Sbjct: 622  VETSQTIKKYLDCVAKLDVIQRQLENTLVEKDILQNAQSSIENKLNQAL-KERNNFQGLI 680

Query: 789  LQLKTAQKERDSLIEETRKRYETRIEELDGELSATKQQLERKQREYDELSSSSSTQCKWF 848
             QL+  QK +D  +++ +   + +I++L+ E +  + +++ K+       ++   + +W+
Sbjct: 681  PQLRALQKNQDEQLKDIQVSLQNKIDDLELENTELRNKIDTKETSPSSALTNPKAELEWY 740

Query: 849  QSKLDSLKEELGSSKLALKAKTSELDALKARLNSSTSKLEPASMDHQQSSLVL-ESDHAS 907
            Q+K DSL    GS+           DAL  ++    S +E  ++  Q   ++L E++  +
Sbjct: 741  QTKFDSLS---GSN-----------DALNEKMIECASTIETLTVKTQTLDILLQEANSKN 786

Query: 908  RVQSLSKDLDEANRKLSSAYSEIERYKAASNATERPSLSYNAVQDNKDGSKQAAIS---- 963
            ++    + +D+ N+   +  +E+        AT R  L+        D S++  IS    
Sbjct: 787  KLLEARETVDDVNKLTGALETEL--------ATSRTRLT--------DTSRELEISSNTI 830

Query: 964  --LEAELTKLN---SDIAMAN----DRIKVLEDELNRREATYSTERSELQEKINALVTDK 1014
               ++E+  LN   S++   N    D I +L DEL      +  E+  L +K++ L   +
Sbjct: 831  RQYQSEIKVLNERQSELENENKHLRDEIAILRDELTHNGGEFEREKEALMKKLSNLEIRQ 890

Query: 1015 QRIEEAKADYQQKITQLQTDLEKQISSTNEAETKYQTALQKQAEISENIESLRKSSESYK 1074
              + + + DY  +I +L+ DL+KQ     E          K A   E  E   +++E+Y+
Sbjct: 891  AELTKLEEDYTAEIEKLKLDLDKQAMLGKEI---------KLAHDEEVREVQNRNTETYR 941

Query: 1075 SEIAKFKSAAEEAR--KVLERNEQTWDQQKADIEANLDLAHQRIEELSTQNRLLYDQIXX 1132
            +E+        E R  KV    E+  + +   +   ++L  +R+++ S +  LL +Q+  
Sbjct: 942  NELELV-----EIRQTKVFVEKEKELESRIKILNEQIELDKERMKQFSDEESLLREQV-K 995

Query: 1133 XXXXXXXXXXXDTKISSDARELIVTLRRERDILETKIDVSKREEKMLRQRLELTKSELDN 1192
                       D  +S +  +L+  L  E+  LE+K+  S+ E+  LR++L  T+SE+  
Sbjct: 996  LLADEKASDLVDAGVSPEYTDLVRKLSDEKKNLESKLFASQSEKNRLREQLTKTESEIAV 1055

Query: 1193 LRAQLSESKGLVTEGTDSSQNQEELFEKLNQLNLLREHNMSLRNESEKVSEHNEFLQNEI 1252
            L     ++K  V    ++   + E  E + QL  L+E NMSL NE +     N  +  E+
Sbjct: 1056 LNMNYEQAKKEVAAEVNNESGRAE--EHIAQLESLKESNMSLTNEVKLAQMRNGEIIAEL 1113

Query: 1253 LSLQEKVQPMEEQIKSLTATXXXXXXXXXXXXXXSDRWKQRSQDILHKYERIDPEE-YRK 1311
              L+ K + +E Q+                      R K  S D+     +    E    
Sbjct: 1114 NELKTKFKSVESQLDEARNVLSSKDMKLMELQTECSRLKATSHDMPQNGNKDSSSELVGA 1173

Query: 1312 LASEIEVLKAELERKSAESIDSQERFRKLRKQANERLDEFKAAKAKVESELELALSGKSQ 1371
            L S +  L  +++     + + ++RF +L++QA ERLD  K     +   +E     K+ 
Sbjct: 1174 LQSSVATLTEQVDNLKHANTELEDRFGRLKRQARERLDASKVTINSLRDNVETLTKDKTA 1233

Query: 1372 LEAKLSEAREKITSLETQLTERPASEDDNPVSHELEETKTKLQDAENTINMLKSEWSISE 1431
            L+  +  +++++  L  ++ E   +      S  ++E KT+L    +    +++E + + 
Sbjct: 1234 LQDVIERSKDELNELRAKIQEHIET------SAVMKELKTELAAVMSKNKDIEAELNETS 1287

Query: 1432 ESFKKQLDELNKQLETIQKNXXX-XXXXXXXXXYHEQPTAVLEDFKKQVEEERRTLIESH 1490
            +S  +    LN+++E+++                +E+ + V+E  +K  E+E+   +++ 
Sbjct: 1288 KSSNQLTTALNEEIESLKHEVQYLKEASSAEPQGNEEMSGVVESMRKAFEDEKIAFMKAT 1347

Query: 1491 QQELTARLEASRKNFXXXXXXXXXXXRDSLTNVSVEAASQNLEALKKKWEEEYEQQTLQR 1550
             ++  ARL   R              +DSL         +N  AL K   +  + +TLQ+
Sbjct: 1348 SEDSEARLAEERGKL-KREMEALEKEKDSLVMEKTRLGEENT-ALMKARSDVPDIETLQK 1405

Query: 1551 IREAEEALKKRIRLPSEERINQVIERKQKALEQEFTTKVNATALALLKENPDSIASDKAD 1610
              EA    K+R+ L  +E+ +Q++  K   LE++F  +V                     
Sbjct: 1406 QWEASN--KERLVLLYKEKSDQMMRAKMDELEEQFQNRV--------------------- 1442

Query: 1611 LIKDHQKEIVQLKKDLADKF----EGQLVQVKKKAFEEGRQQGIMKVKLLESKISKLESQ 1666
              ++ +KE+  LK ++ +K     E  L+ VKK+AFEEG+QQ  MK+ +LE KI+KLE++
Sbjct: 1443 --RNKEKELNALKDEIEEKCKTGHEDTLIAVKKRAFEEGKQQATMKMSILERKIAKLEAE 1500

Query: 1667 AKAP-LGTNVPTKIPLENTQPLAQQVPVKPSPFQLAYAQATFGNVPFLFNKNS 1718
            +KA   G+++           +++  P   +P      QA   N PFL    S
Sbjct: 1501 SKATKSGSDM----------SVSEDAPRFVTPNNNKVQQA---NQPFLATAGS 1540

>KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1454

 Score =  256 bits (653), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 282/1147 (24%), Positives = 576/1147 (50%), Gaps = 51/1147 (4%)

Query: 127  AGDSARRDLARLLEEKISDLDASQQELERVLGVNKELRRHEMELEFTVQSQRSQSLREQA 186
            A    + +L +LLEE+I+ +D  + +L +V+  NK L  +  +L   +++ + + L  + 
Sbjct: 69   ASQETKNELLKLLEERINQIDTLKADLNKVVEENKNLYENSHKLTKEIETSKDEKLLLRT 128

Query: 187  EIQRLQQELALVRSNAEWTTGQLNEKNQQLNSYREKTNGEIQSTQVELNIVKNELEVEHA 246
            ++ ++   L+L     + T  +   K +   SY+++   E Q+    L  + NEL + + 
Sbjct: 129  QLDKVTFTLSLTMKQKQHTESEYLSKEKHFESYKDRKELEYQNVMENLTAIDNELRMTNG 188

Query: 247  NVAALRSKNGELSKQLQDALCETKRLTDSLHSEKQEFAREMALKQRLIELLNGQVATMKQ 306
              A L  +N ELSK L+  + E K L +SL +   +F  E  L+ +LI  L  Q+ T+++
Sbjct: 189  KNAELFKRNEELSKDLRGKISEIKSLENSLKTSNGDFLSEKQLQDQLINALQNQIKTLQE 248

Query: 307  DLEKAYD-VAKNGGMSDSERERLLNDLFDTKKKLELSQANVSRLEDTIKELLETDNVQSG 365
             LE   D    + G    ++  LL  + +  +KLE+S+     L  +++E     N+   
Sbjct: 249  QLESLSDEKFDDPGTQKLDKHELLRQIKNLNEKLEISERERLSLVHSMEEF---QNIPEE 305

Query: 366  GRNGIEHANVGSPSGGSTISTVYGDLAALRKQLVQERRHKEELQLQVESFVVELEHKIPV 425
              + +     G  +   ++S   GD+  LRK  ++ER+ K +L+ Q+   + ELE  +P 
Sbjct: 306  ESSSVSSHASGRNNSALSLS---GDVNILRKHFLKERQQKRQLEEQMRQILQELERNMPS 362

Query: 426  LNSFKKRIEELEKQLNGVTLLLEATARERDEKVVQIKQYKNKVGDYETQVGHLVQQRSDL 485
            L+S+K+R   LEK+LN   +LLE   +E  +K  ++++ +++  +  + +  L  QR+ L
Sbjct: 363  LSSYKERSTFLEKELNSSNILLEHIKKENLDKSAELEKKESECSNLRSSINSLAFQRTVL 422

Query: 486  ARQVQCLLIHISVRDDSSGPLTAEEVEFVKKLQSCRDSATGSDTQAIISNRLVEFKSVVE 545
            ARQV+ LL+ I   +     L  +++E + +  +   +   SD++ I+  RL +FK+V E
Sbjct: 423  ARQVKYLLLIIQNNETLGSSLGRKDLELLGQYLAANTAEAMSDSEKILLERLAQFKNVKE 482

Query: 546  LQQKNAELLNAIRQLAQKLEQEEHKTQSKVKSLEQNTVNEAKEAILSLQEHVQMLEDQLE 605
            LQ +N +LL   R+LA K E+ E     ++ S E  T+N+AKEAIL LQE+ Q LE Q++
Sbjct: 483  LQNRNMQLLQVSRELASKAEKLEKVNLKQISSEEDETINDAKEAILVLQEYSQKLESQIK 542

Query: 606  TVTTERDSFKLLVSEGKNNSLPNPVGAAALQPQEVADGIAHLEARLKAMAEESEQHAKML 665
             ++ E      L  + K  +    + A +    + +     L  +L A  + S+     L
Sbjct: 543  ELSDE------LAVQKKEKTEKESISAMSKIEDDASSHTIDLGKQLSANLKHSKDIIDAL 596

Query: 666  NEEIKALYKSNSQLAIXXXXXXXXXXXADEKLSLIQKSLELVKGENADLQNRAGSLQALL 725
            N EI+ L+++N+ + I           A+++ +L++ ++ L+K E  +LQ     LQ  +
Sbjct: 597  NSEIENLHQANTDVNISLDKEKSARKLAEDRYNLLEYNVSLLKSEKEELQEEVNKLQQNI 656

Query: 726  LEQDTRRQSTIEEFVSAKSELFSISSQLTILQSERDFLRKVEADLKKENESLNKDNNDSQ 785
            L+++ +   +  +++S KS+L +  +++T L++E +   + +  L+ + E+L  + N+ +
Sbjct: 657  LDKEKQFSYSSRDYISCKSKLSTAEAEITSLRAENELSIETQTTLRTKKEALLNERNNLR 716

Query: 786  LLILQLKTAQKERDSLIEETRKRYETRIEELDGELSATKQQLERKQREYDELSSSSSTQC 845
            + + Q+ +   E  +L++ET+  Y+ +++    + + T  QL+  Q+   EL S + ++ 
Sbjct: 717  MTVTQMNSLNNELQTLLKETKSGYDDKLKISALKCTQTNNQLQLVQQRMSELKSQNDSEI 776

Query: 846  KWFQSKLDSLKEELGSSKLALKAKTSELDALKARLNSSTSKLEPASMDHQQSSLVLESDH 905
            KW+++ +D LK  +      LK K  +++     L +  ++L          +L    D 
Sbjct: 777  KWYKATIDDLKANVFELNEELKQKEEKIEEFSKTLENVQNEL----------TLANSKDV 826

Query: 906  ASRVQSLSKDLDEANRKLSSAYSEIERYKAASNATERPSLSYNAVQDNKDGSKQAAISLE 965
            +   ++L K+L E   +L  +  E++ Y+   + ++R S    ++Q  +D  K  A  L+
Sbjct: 827  SEEKRALEKELSEVKSQLEKSNLEVKEYENVISTSKR-SFENKSIQ-YEDRIKALASKLD 884

Query: 966  AEL---TKLNSDIAMANDRIKVLEDELNRREATYSTERSELQEKINALVTDKQRIEEAKA 1022
            +EL   T L  +++    R+ V +DEL     T     SEL+   ++L+ +++  ++ +A
Sbjct: 885  SELRERTTLQENLSTLQARMVVQQDELTSNNNTL----SELRVSYDSLLLEQKTFKDKEA 940

Query: 1023 DYQQKITQLQTDLEKQISSTNEAETKYQTALQKQAEISENIESLRKSSESYKSEIAKFKS 1082
                   +L++ +  +  + +     Y+  +Q+ +E+S+ +E LR+  ++  S   K + 
Sbjct: 941  -------ELRSVIAVKTGNYDSLSKSYERIMQENSELSKVVELLREEVKNRTSNGEK-EG 992

Query: 1083 AAEEARKVLERNEQTWDQQKADIEANLDLAHQRIEELSTQNRLLYDQIXXXXXXXXXXXX 1142
              E+   ++++ +  WD++K   E  +   ++R+ EL  +N  L  ++            
Sbjct: 993  DLEDTESIIKKGQDVWDEEKKVFEVQITNLNERLSELLEENESLLARLESQDKGNNSPSA 1052

Query: 1143 XDTKISSDARELIVTLRRERDILETKIDVSKREEKMLRQRLELTKSELDNLRAQLSESKG 1202
                 ++   E +  LR ER  L  K+  +++EE+ +R +L  T+  L     +L + K 
Sbjct: 1053 ETN--AAGNEETLAALRSERTSLIEKLTAAQKEERSVRHKLRETEHALSENAFELKKIKS 1110

Query: 1203 LVTEGTDSSQNQEELFEKLNQLNLLREHNMSLRNESEKVSEHNEFLQ--NEILS-LQEKV 1259
             + E +   QN+ ++   L  L   RE       +++     N++++  N++ +  QEK+
Sbjct: 1111 QIFELSSLPQNEHDILRHLVHLKEQREE------KNKDALGTNKYMEQPNKVTTEAQEKI 1164

Query: 1260 QPMEEQI 1266
            Q +EEQ+
Sbjct: 1165 QDLEEQL 1171

 Score = 89.4 bits (220), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 82/131 (62%), Gaps = 8/131 (6%)

Query: 1537 KKWEEEYEQQTLQRIREAEEALKKRIRLPSEERINQVIERKQKALEQEFTTKVNATALAL 1596
            +K  E YE++  +++ +AEE LKKRIRLP+EE+IN +IE+++  LE  F  K+   A +L
Sbjct: 1218 RKLREFYEEEIQKKVSQAEENLKKRIRLPTEEKINGIIEKRKSELESSFEQKIKEEAKSL 1277

Query: 1597 LKENPDSIASDKADLIKDHQKEIVQLKKD-LADKFEGQLVQVKKKAFEEGRQQGIMKVKL 1655
            L  + D       D IK   KEI +  ++ L  +F+ QL  V+KKAFEEG+Q  +MK   
Sbjct: 1278 LLHSDD-------DKIKKIYKEIEESGRETLQQEFDEQLNIVRKKAFEEGKQHVLMKSAF 1330

Query: 1656 LESKISKLESQ 1666
            LE KIS LE Q
Sbjct: 1331 LERKISMLEGQ 1341

>NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1554

 Score =  227 bits (578), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 188/536 (35%), Positives = 297/536 (55%), Gaps = 40/536 (7%)

Query: 146 LDASQQELERVLGVNKELRRHEMELEFTVQSQRSQSLREQAEIQRLQQELALVRSNAEWT 205
           L+ S+ EL+  L  N  L+      E  + S   +      E ++LQ  + L+R N  + 
Sbjct: 145 LEQSKLELQDSLTENSALKEQIGVFEGKLDSMTQELWLANTENKKLQTGMKLLRENNLYL 204

Query: 206 TGQLNE--KNQQLNSYREKTNGEIQSTQVELNIVKNELEVEHANVAALRSKNGELSKQLQ 263
             +  E  KN++L S  E    +    Q +L IV +E+    + +A L+  N  LS  LQ
Sbjct: 205 EIKCKETDKNKKLYSSAE----DASRLQDQLQIVSSEILSLKSEIATLKYMNESLSTDLQ 260

Query: 264 DALCETKRLTDSLHSEKQEFAREMALKQRLIELLNGQVATMKQDLEKAYDVAKNGGMSDS 323
             L   K L D+L+S KQEFA+E+ LKQR+ ELL+ ++A+ K+ +E+    +KN    ++
Sbjct: 261 RKLFRIKDLDDNLNSSKQEFAKEITLKQRVNELLHNEIASYKKQIERL--TSKNL---ET 315

Query: 324 ERERLLNDLFDTKKKLELSQANVSRLEDTIKELLETDNVQSGGRNGIEHANVGSPSGGST 383
             ++++ +L D K+KL  S+   + L+ T+ + +  D  +   +        G+P     
Sbjct: 316 PEKKIIQELVDLKEKLVNSEKECNELKSTVDKYINIDEKKLISK-------FGNPKKLIE 368

Query: 384 ISTVYGDLAALRKQLVQERRHKEELQLQVESFVVELEHKIPVLNSFKKRIEELEKQLNGV 443
           I         LR+QLV+E+RHK+ LQ QVESF+VELE K+P+++SFK+R   LE++L  +
Sbjct: 369 I---------LRRQLVKEKRHKDTLQRQVESFLVELEQKLPMIDSFKERNSSLERELLRI 419

Query: 444 TLLLEATARERDEKVVQIKQYKNKVGDYETQVGHLVQQRSDLARQVQCLLIHISVRDDSS 503
           T  LE TA+ERD K  ++   + K+ + E     L++QRSDLA QVQ LL+ I    D+ 
Sbjct: 420 TSSLEETAKERDIKDRELTNLQKKISNNEQFNDELLRQRSDLAHQVQYLLLCI----DNK 475

Query: 504 GPLTAEEVEFVKKLQSCRDSATGSDTQAIISNRLVEFKSVVELQQKNAELLNAIRQLAQK 563
            P T +E   VKK+ S  ++   +D+  IIS RL+ F++V ELQQKN ELL   RQL Q 
Sbjct: 476 SPFTEKEATLVKKIVSNENTENDTDSHKIISKRLLHFQNVKELQQKNMELLRTTRQLVQT 535

Query: 564 LEQEEHKTQSKVKSLEQNTVNE-AKEAILSLQEHVQMLEDQLETVTTERDSFKLLVSEGK 622
           LE++E + Q  ++  + N + E AK   + L++H++ LE ++  ++ ERDS+KLLV+   
Sbjct: 536 LERQEQEQQKTLRITDNNKIVESAKSTSVDLEKHIKTLESKINIISQERDSYKLLVTNST 595

Query: 623 NNSLPNPVGAAALQPQEVADGIAHLEARLKAMAEESEQHAKMLNE---EIKALYKS 675
             S  +    ++LQ  E+      L   L +M    +QH K+L E   +IK L KS
Sbjct: 596 IQSNTSNNSISSLQQCELEK--ERLTNELSSM---KQQHVKVLEELENKIKTLQKS 646

>Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON}
           (147247..151212) [3966 nt, 1322 aa]
          Length = 1321

 Score =  199 bits (505), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 140/476 (29%), Positives = 266/476 (55%), Gaps = 22/476 (4%)

Query: 408 LQLQVESFVVELEHKIPVLNSFKKRIEELEKQLNGVTLLLEATARERDEKVVQIKQYKNK 467
           L+  +++++ ELE ++P++ +FK  IE L+  LN   L++E+   ++ E +  +   K  
Sbjct: 214 LKSDIQNYLNELEQQLPLIENFKAEIENLQDNLNKKNLIIESLQNDKKENLKLMDSMKKT 273

Query: 468 VGDYETQVGHLVQQRSDLARQVQCLLIHISVRDDSSGPLTAEEVEFVKKLQSCRDSATGS 527
           + +  + +  L  QR+DLA Q+Q LLIH S+++D++GPL+  E+ F++ L +       S
Sbjct: 274 INEKSSSIEALDIQRTDLAHQLQYLLIHSSIQNDNNGPLSKSEILFMQNLINKDKQRLSS 333

Query: 528 DTQAIISNRLVEFKSVVELQQKNAELLNAIRQLAQKLEQEEHKTQSKVKSLEQNTVNEAK 587
           D Q++IS+RL++FK +V LQ+KN EL  +IR LA  LE +E + ++  ++ + +T+NEAK
Sbjct: 334 DVQSVISDRLIKFKDIVSLQEKNMELTKSIRNLAFSLESKESEIKNSRENYDNDTINEAK 393

Query: 588 EAILSLQEHVQMLEDQLETVTTERDSFKLLVSEGKNNSLPNPVGAAALQPQEVADGIAHL 647
           E ILSLQE+  +L+ ++ T+ ++       +SE + +S+PN   +        ++ +  L
Sbjct: 394 ETILSLQEYNNVLKLEIGTLQSK-------ISELQ-SSIPNSKESEKQHFNYHSNLVKDL 445

Query: 648 EARLKAMAEESEQHAKMLNEEIKALYKSNSQLAIXXXXXXXXXXXADEKLSLIQKSLELV 707
           E++L  ++  S+   + LN++I+ LY   + + I           A+EKL+L+Q S +L+
Sbjct: 446 ESKLSKLSAYSQSTIENLNKDIQNLYNERTDILINLEKEKSSTILANEKLTLLQNSYDLL 505

Query: 708 KGENADLQNRAGSLQALLLEQDTRRQSTIEEFVSAKSELFSISSQLTILQSERDFLRKVE 767
             EN +L ++   L+  L E++    S + +++  K+ L   +++LT+L + +       
Sbjct: 506 TLENEELSSKNSMLEQQLNEEEKNLNSVLNDYIKCKTNLLDFTNRLTLLNNNK------- 558

Query: 768 ADLKKENESLNKDNNDSQLLILQLKTAQKERDSLIEETRKRYETRIEELDGELSATKQQ- 826
             L++EN SL ++   +   I  L +  K  +  +E    +Y  +++EL+  +S   +Q 
Sbjct: 559 LGLEEENNSLKQEIKSNYEQIKDLDSKSKHLEQSLENEISKYTDKVKELELNISKLNEQK 618

Query: 827 ------LERKQREYDELSSSSSTQCKWFQSKLDSLKEELGSSKLALKAKTSELDAL 876
                 L+ K  E D+L+SS+  Q  W+Q KLD  ++ + + +  L A T    AL
Sbjct: 619 LILERKLQNKNIEIDDLNSSNYDQISWYQKKLDQYEKTIKTLESRLPADTQNSKAL 674

 Score = 92.0 bits (227), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 76/125 (60%), Gaps = 24/125 (19%)

Query: 1542 EYEQQTLQRIREAEEALKKRIRLPSEERINQVIERKQKALEQEFTTKVNATALALLKENP 1601
            EYE    +R+ EAEEALK++IRLPSEE+IN +IE K   LE+++  K+            
Sbjct: 1098 EYEGDIQKRVAEAEEALKRKIRLPSEEKINTIIESKVADLEEDYKKKL------------ 1145

Query: 1602 DSIASDKADLIKDHQKEIVQLKKDLADKFEGQLVQVKKKAFEEGRQQGIMKVKLLESKIS 1661
            ++++++  D+ K  Q            +FE  LV  KKKAFEEG+QQ  MK K LE+KI+
Sbjct: 1146 ETVSAESTDIEKIKQ------------EFEDNLVNAKKKAFEEGKQQASMKTKFLENKIA 1193

Query: 1662 KLESQ 1666
            KLESQ
Sbjct: 1194 KLESQ 1198

>TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1284

 Score =  129 bits (325), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 152/619 (24%), Positives = 282/619 (45%), Gaps = 98/619 (15%)

Query: 283 FAREMALKQRLIELLNGQVATMKQDLEK---------AYDVAKNGGMSDS------ERER 327
           F  E  LK  +IE  +  +A +  ++E          + D+    G + S      E +R
Sbjct: 193 FKSETKLKDEIIEEKDYLIANLTNEIESLKNREINEHSSDINIEYGKNSSIIVDKQEYQR 252

Query: 328 LLNDLFDTKKKLELSQANVSRLEDTIKELLETDNVQSGGRNGIEHANVGSPSGGSTISTV 387
           LLN+     +K++     V+RL  T+ E                     S +G + +ST 
Sbjct: 253 LLNEALINNEKIDEYDLKVARLTATVNEF-------------------QSKTGINFVSTD 293

Query: 388 -YGDLAALRKQLVQERRHKEELQLQVESFVVELEHKIPVLNSFKKRIEELEKQLNGVTLL 446
            + D   L+K++ +    ++ LQ ++E  + ELE+  P LN+   +I ELE       LL
Sbjct: 294 DFCDFIILKKEIQKLEGQRDLLQEKLEYLIHELENHAPELNNQYDKINELE-------LL 346

Query: 447 LEATARERDEKVVQIKQYKN---------KVGDYETQVGHLVQQRSDLARQVQCLLIHIS 497
           L       +     IK+ +N         K+ D   ++  L ++ +DL  Q+Q +LI  S
Sbjct: 347 LSKEKNTSEHFKTTIKEIENEKKNIISRLKLSD--DKIETLREENNDLTNQIQFMLISNS 404

Query: 498 VRDDSSGPLTAEEVEFVKKLQSCRDSATGS------DTQAIISNRLVEFKSVVELQQKNA 551
           +++D  G LT  E++F+K L   R+  T +      ++Q IIS+RL+ F+SV+ LQQKN 
Sbjct: 405 IQNDKYGELTENEIKFIKAL---REKGTETSFNELYNSQDIISDRLIRFESVISLQQKNM 461

Query: 552 ELLNAIRQLAQKLEQEEHKTQSKVKSLEQNTVNEAKEAILS-------LQEHVQMLEDQL 604
           EL+  +R + +KL+ +EH+ ++K ++   + +NEAKE IL        L+E +  L+ QL
Sbjct: 462 ELIKTLRLITKKLDNQEHELRAKWEAENDDVLNEAKEEILKVVSESDKLKEKISELQQQL 521

Query: 605 ET---VTTERDSFKLLVSEGKNNSLPNPVGAAALQPQEVADGIAHLEARLKAMAEESEQH 661
                V+ E++  + +++E K            L  +     +  L+  +    +++   
Sbjct: 522 NANRPVSHEKNGHESVLAENK------------LYTEGDRLILDELKNNIPEFTKQASNI 569

Query: 662 AKMLNEEIKALYKSNSQLAIXXXXXXXXXXXADEKLSLIQKSLELVKGENADLQNRAGSL 721
             M  +++ +LY  N +L               +KL L+Q   + +   N  L+     +
Sbjct: 570 ISMNFDQLTSLYNKNLELTADRLKAYQSRDITQKKLDLLQDKYDYLSISNEKLKEHMEVI 629

Query: 722 QALLLEQDTRRQSTIEEFVSAKSELFSISSQLTILQSERDFLR-------KVEADLKKEN 774
           +  +  +D    STI   V  K+ L S+++ +  L ++ D L+       ++  +LK E 
Sbjct: 630 KDTIRRKDETLNSTIANHVDCKASLLSVTNDMNSLMTKYDELKYLKDQQSRITNELKMER 689

Query: 775 ESLNKDNNDSQLLILQLKTAQKERDSLIEETRKRYETRIEELDGELSATKQQLERKQREY 834
           E L       ++ +L +KT Q + D    E +    ++I +L+   S   + L  K++E 
Sbjct: 690 EQL-------KMELLNIKTVQIQSDLESAEYKASVASKINDLEITNSNLSKDLRTKEQEL 742

Query: 835 DELSSSSSTQCKWFQSKLD 853
            +  S+ + +  W+Q K D
Sbjct: 743 QDFISTKNRELDWYQKKFD 761

>TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1183

 Score = 92.8 bits (229), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 64/212 (30%), Positives = 119/212 (56%), Gaps = 11/212 (5%)

Query: 389 GDLAALRKQLVQERRHKEELQLQVESFVVELEHKIPVL--NSFKKRIEELEKQLNGVTLL 446
            ++  ++ +L++E+  K  L+ +   F+ ++E K+P L  NS +          NG  + 
Sbjct: 281 NNIDDIKTELIKEKYEKSLLEKKFNDFLFDIESKLPYLQNNSVENETN------NGNKIE 334

Query: 447 LEATARERDEKVVQIKQYKNKVGDYETQVGHLVQQRSDLARQVQCLLIHIS-VRDDSSGP 505
            +    E D   ++ +  K K+ D+E+ V  L+QQRSDL  Q+  LLI  S + +D++  
Sbjct: 335 EQKIIHEHDSLKLENQSLKIKLNDFESTVKTLLQQRSDLGHQINYLLITQSYLNEDNNKI 394

Query: 506 LTAEEVEFVKKLQSCRDSATGSDTQAIISNRLVEFKSVVELQQKNAELLNAIRQLAQKLE 565
           LT  E+ F++ L +   +   ++TQ IIS RL++F +V +L  KN +L++ +R+L  K+E
Sbjct: 395 LTENELNFIRNLVAQPTNTWSTETQNIISERLLKFSNVSDLTAKNIKLISLVRELTNKME 454

Query: 566 QEEHKTQSKVKSLEQN--TVNEAKEAILSLQE 595
             E +   K   LE +  +++EAK+ ++ L+E
Sbjct: 455 SIEKQNSQKFGDLEMDFKSIDEAKQRMIVLKE 486

 Score = 40.0 bits (92), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 33/45 (73%)

Query: 1314 SEIEVLKAELERKSAESIDSQERFRKLRKQANERLDEFKAAKAKV 1358
            +EI+ LK ++E KS E  +S +RF +L+KQA ++L+EFK  + K+
Sbjct: 751  NEIDELKKQIETKSKELTESLDRFARLKKQAKDKLNEFKGTENKL 795

>NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1735

 Score = 90.5 bits (223), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 73/181 (40%), Positives = 112/181 (61%), Gaps = 31/181 (17%)

Query: 1531 NLEALKKKWEEEYEQQTLQRIREAEEALKKRIRLPSEERINQVIERKQKALEQEFTTKVN 1590
            ++E +K +WEE+ E+  +QRI +AEE LKKRIRLPSEE+IN+VIE+++K LE+E+  K+ 
Sbjct: 1468 DIEKMKSEWEEKQEEIIMQRIADAEENLKKRIRLPSEEKINRVIEKRRKELEEEYEKKLK 1527

Query: 1591 ATALALLKENPDSIASDKADLIKDHQKEIVQLKKDLADKFEGQLVQVKKKAFEEGRQQGI 1650
               L           + +  + ++ +KE+   +++L  KF+ +L +VKKKAF EG+QQ  
Sbjct: 1528 RQGL-----------TTETAIEEELRKEV---ERELRVKFDNELAEVKKKAFLEGKQQSQ 1573

Query: 1651 MKVKLLESKISKLESQAKAPLGTNVPTKIP-LENTQP----LAQQVPVKPS-----PFQL 1700
            MK  LLE K+SKLESQA        P++ P LE++Q      A +  + PS     PF +
Sbjct: 1574 MKTTLLERKLSKLESQAS-------PSRTPDLESSQKENTEGATKTTLGPSKINLLPFSM 1626

Query: 1701 A 1701
            +
Sbjct: 1627 S 1627

>Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON}
           (206286..209306) [3021 nt, 1007 aa]
          Length = 1006

 Score = 58.9 bits (141), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 160/707 (22%), Positives = 297/707 (42%), Gaps = 128/707 (18%)

Query: 187 EIQRLQQELALVRSNAEWTTGQL--NEKNQQLNS----YREKTNGEIQSTQVELNIVKNE 240
           EI+RL  +  L+ +N +W   +L  ++KN  +++    Y  K + ++ ++  +L  ++ E
Sbjct: 23  EIKRLSDKYNLLENNYKWLNERLVRDQKNYLIDTHDVKYSSKNDNKLYNSHNKLLELQKE 82

Query: 241 LEVEHANVAALRSKNGELSKQLQDALCETKRLTDSLHSEKQEFAREMALKQRLIELLNGQ 300
             + H     L  +  E S +  D       + D+L++EK      + L ++ + LLN +
Sbjct: 83  FLISHN--EKLSDRLNENSIEFNDKFNSV--VIDNLNNEKN-----LILFEKKLNLLNER 133

Query: 301 VATMKQDLEKAYDVAKNGGMSDSERERLLNDLFDTKKKLELSQANVSRLEDTIKELLETD 360
            + + +D +   D       +D    + L +     +K+    +N+  +E  I++L    
Sbjct: 134 YSIIIKDQKDVID-------NDINNSKYL-EFKSLNEKIIKQNSNMKSMESKIEKL---- 181

Query: 361 NVQSGGRNGIEHANVGSPSGGSTISTVY----GDLAALRKQLVQERRHKEELQLQVESFV 416
                  N I H  +      +  +  Y     D   L+K LV E+    +LQ ++ S +
Sbjct: 182 -------NAIIHNFIDINEFDNENTNKYSLDLNDNKVLKKLLVHEKNSNLKLQEELNSIL 234

Query: 417 VELEHKIPVLNSFKKRIEELEKQLNGVTLLLEATARERDEKVVQIKQYKNKVGDYETQVG 476
           +EL  K+P L S K++  EL+     +    E   ++      +I    NK+ DYE  + 
Sbjct: 235 LELNFKLPSLTSLKEKNHELQSVFENIISSNEELLQQFHSNTDKIASMNNKIVDYEQSLK 294

Query: 477 HLVQQRSDLARQVQCLLIHISVRDDSSGPLTAEEVEFVKKLQSCRDSATGSDTQAIISN- 535
            L+ QR++L   +  +L  ++V + +S  L   E E             G   Q + +N 
Sbjct: 295 QLLSQRTNL---ISYILNLLNVINLNSKYLNLSESE-------------GCLIQNLFNNE 338

Query: 536 RLVEFKSVVELQQKNAELLNAIRQLAQKLEQEEHKTQSKVKSLEQNTVNEAKEAILSLQE 595
           R+  F     LQ+KN  L      L        +  +S +K L   T + +KE I++ + 
Sbjct: 339 RIQRF-----LQEKNLTLTEIFDNLNTVDITFNNFNRSDIKVLPP-TESASKEEIINYKN 392

Query: 596 HVQMLEDQLETVTTERDSFKLLVSEGKNNSLPNPVGAAALQPQEVADGIAH-LEARLKA- 653
            + +LE+         D++K+++                       +GI   L+ +LK  
Sbjct: 393 EIILLENNC-------DAYKMIL---------------------YNNGITEDLDEKLKIE 424

Query: 654 ----MAEESEQHAKM---------LNEEIKALYKSNSQLAIXXXXXXXXXXXADEKLSLI 700
               M E +E+++++         LN  +  L + NS+                EK +L+
Sbjct: 425 SSSRMTELNEKNSRIQMLESKIDELNSIVTKLNEKNSRFMASINKNNSSESTILEKYNLL 484

Query: 701 QKS----LELVKGENAD-LQNRAGSLQALLLEQDTRRQSTIEEFVSA----KSELFSISS 751
            +S    LE  K   ++   N+   L + L   DT++   I EF S      S + S+S+
Sbjct: 485 NQSYKTLLEAYKSLKSNATDNKKAVLTSTL--DDTKK---IVEFKSTINYLNSTIKSLSA 539

Query: 752 QLTILQSERDFLRKVEADLKKENESLNKDNNDSQLLILQLKTAQKERDSLIEETRKRYET 811
           +L  +Q   D L      +K EN +L      S L    L     +++S+  E    +  
Sbjct: 540 KLVSIQESNDLLADENQKIKMENSNL------SSL----LNKINTDKNSISNELSDLHSK 589

Query: 812 RIEELDGELSATKQQLERKQREYDELSSSSSTQCKWFQSKLDSLKEE 858
            I EL+ E +   +QLE  +R+  E +   + Q KWFQ+K+D+  EE
Sbjct: 590 EILELETEKTKLLEQLEEGERKLKETNEKHNEQIKWFQNKIDNFNEE 636

 Score = 39.7 bits (91), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 66/262 (25%), Positives = 120/262 (45%), Gaps = 62/262 (23%)

Query: 1312 LASEIEVLKAELERKSAESIDSQERFRKLRKQANERLDEFKAAKAKVESELELALSGKSQ 1371
            L ++ E LK   E KS E  ++ ++F +L++QANERL+  K  +       EL+ + KS 
Sbjct: 646  LKNDYENLKKSFEEKSKEVEEANDKFSRLKRQANERLNASKTTQK------ELSDNVKS- 698

Query: 1372 LEAKLSEAREKITSLETQLTERPASEDDNPVSHELEETKTKLQDAENTINMLKSEWSISE 1431
            LE + +  +E I+ LE          D N +++ L E + KL           SE ++  
Sbjct: 699  LEDERTNFKEHISKLEV---------DINNLNNALVEAEKKL-----------SEENLKY 738

Query: 1432 ESFKKQLDELNKQLETIQKNXXXXXXXXXXXXYHEQPTAVLEDFKKQVEEERRTL----- 1486
            E+ ++    L  +++ +Q N                    L++  K +EE   TL     
Sbjct: 739  ETERQTGSTLRLKIDDLQLNEDN-----------------LKEKVKNLEENESTLKDKIK 781

Query: 1487 -IESHQQELTARLEASRKNFXXXXXXXXXXXRDSLTNVSVEAASQ----NLEALKKKWEE 1541
             IE ++ +L  ++   + N            +D L +++ ++++     ++E LKK WE+
Sbjct: 782  MIEGNEDDLMGKISVLQSN--------EILLKDKLNDLNSKSSNNSELVDVEGLKKDWEK 833

Query: 1542 EYEQQTLQRIREAEEALKKRIR 1563
            EY     +RI  AE  L+KR++
Sbjct: 834  EYSHIIEKRIEYAEMQLEKRLK 855

>NDAI0G05630 Chr7 complement(1393671..1397360) [3690 bp, 1229 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1229

 Score = 42.4 bits (98), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 70/253 (27%), Positives = 121/253 (47%), Gaps = 53/253 (20%)

Query: 778  NKDNNDSQLLILQLK-TAQKERDSLIEETRKRYETRIEELDGELSATKQQL----ERKQR 832
            NKD+  S +  +++K  A+K    L+EE+   +  + E L  +L+ TK+++    E   +
Sbjct: 730  NKDSIVSNIQSMRIKLNAKKSEKLLLEESLDAFAVKSERLTAQLTQTKEKITAYKEDMTK 789

Query: 833  EYD-ELSSSSSTQCKWFQSKLDSLKEELGSSKLALKAKTSELDALKARLNSSTSKLEPAS 891
            E+D ELS S  T+       + +++++L  +  AL++ T E+D L A LN   SKL P  
Sbjct: 790  EFDSELSQSEKTELLTLNDDIHTIQKKLTLTTEALESITGEMDILNAELN---SKLLP-Q 845

Query: 892  MDHQQSSLVLESDHASRVQSLSKDLDEANRKLSSAYSEIERYKAASNATERPSLSYNAVQ 951
             +  QS +   +D+ +   +L  DLD                KA S+        YN+V+
Sbjct: 846  QEELQSRIGQSNDNFTL--NLKDDLD----------------KAMSD--------YNSVE 879

Query: 952  DNKDGSKQAAISLEAELTKLNSD-------IAMANDRIKVLEDELNR----------REA 994
             + + SKQ    ++ E+  +NS+       +  AN + K+L  +L            ++ 
Sbjct: 880  KDYELSKQQTEIIQKEIDDMNSEKRNDEKTLEKANSQQKLLLKKLENFQKDAEKTMIKKT 939

Query: 995  TYSTERSELQEKI 1007
            T ST R ELQ+KI
Sbjct: 940  TLSTRRDELQQKI 952

>KNAG0G00910 Chr7 (172759..176439) [3681 bp, 1226 aa] {ON} Anc_8.68
           YFL008W
          Length = 1226

 Score = 41.6 bits (96), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 63/250 (25%), Positives = 105/250 (42%), Gaps = 67/250 (26%)

Query: 294 IELLNGQVATMKQDLEKAYDVAKNGGMSDSERERLLN---------DLFDTKKKLELSQA 344
           ++ ++  VAT+     + Y +AKN    +S+ ER +N         D  D  KKL+    
Sbjct: 587 LDTVDSAVATLPSVNIQGYLLAKNAMEYESQYERAINYVCGDAIICDTLDLAKKLKWDHG 646

Query: 345 NVSRLEDTIKELLETDNVQSGG--RNG----------------------IEHANVGSPSG 380
             ++L      L+    + +GG  ++G                      IE       S 
Sbjct: 647 FKNKLIALDGSLIHRAGLMTGGISKDGNNRWDKEEYQSLMTLKDKILQQIEDTAAYGRSA 706

Query: 381 G-------STISTVYGDLAALRKQLVQERRHKEELQLQVESFVVELEHKI--------PV 425
                   S IS +  ++A++R QL Q  R  EE +       VE+ H+I        P+
Sbjct: 707 SIQARELESNISLLNAEIASIRTQLTQINRSIEENK-------VEINHQIHLVDKEYSPM 759

Query: 426 LNSFKKRIEELEKQLNGVTLLLEATARERDE-KVVQIKQYKNKVG----DYETQVGHLVQ 480
           + S KK+ E + KQ N +T        E+D  +VV  K + +KVG    DYE+  G +++
Sbjct: 760 ILSLKKKKESILKQSNELT-------EEKDRVQVVIFKAFTDKVGFSVRDYESHSGEVMR 812

Query: 481 QRSDLARQVQ 490
           Q +   +Q+Q
Sbjct: 813 QNAKELQQLQ 822

>KNAG0B01310 Chr2 (247976..249046) [1071 bp, 356 aa] {ON} Anc_3.393
           YBR130C
          Length = 356

 Score = 38.5 bits (88), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 42/151 (27%), Positives = 77/151 (50%), Gaps = 13/151 (8%)

Query: 770 LKKENESLNKDNNDSQLLILQLKTAQKERDSLIEETRKRYETRIEELD---GELSATKQQ 826
           LK+ +++L+++ + S + + QL++   E  + +EE RKR  T +E      G+++A  +Q
Sbjct: 98  LKQASDALHEELDGSTVELRQLESRAAELRAAVEEQRKRAATAVESSPLQQGDVAAWSEQ 157

Query: 827 LERKQREYDELSSSSSTQCKWFQSKLDSLKEELGSSKLALKAKTSELDALKARLNSSTSK 886
            ER Q +Y  L +S       + +++  L+EEL  S +A  A T  LD         TS 
Sbjct: 158 AERAQAQYTALITSQQLYKDHYLARIKQLREEL-DSAVAAAAATDSLD---------TSS 207

Query: 887 LEPASMDHQQSSLVLESDHASRVQSLSKDLD 917
           L+ +  +  Q    L++ H +  ++L  D D
Sbjct: 208 LQLSLREFTQDRESLDALHTALTETLGADFD 238

>Ecym_8374 Chr8 complement(751652..754396) [2745 bp, 914 aa] {ON}
            similar to Ashbya gossypii ADL037W
          Length = 914

 Score = 38.9 bits (89), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 82/374 (21%), Positives = 164/374 (43%), Gaps = 57/374 (15%)

Query: 810  ETRIEELDGELSATKQQLERKQREYDELSSSSSTQCKWFQSKLDSLKEELGSSKLALKAK 869
            E RI  L  ELS TK  L+ +  E + +     T         D LKE+ G+S   LK  
Sbjct: 353  ELRISSLQSELSDTKVALKTRNEELEMVKDMLKTVGNELVDAKDKLKEQGGTSDEELKRL 412

Query: 870  TSELDALKARLNSSTSKLEP--ASMDHQQSSLVLESDHASRVQSLSKDLDEANRKLSSAY 927
             +E++AL    + S S  E     +  + ++L+   D  +R++S+   L ++N +L+ A 
Sbjct: 413  KAEVEALHDAKSQSASSYEEQLGKLTKEVATLL---DDKNRLESV---LVQSNDQLTRAQ 466

Query: 928  SEIERYKAASNATERPSLSYNAVQDNKDGSKQAAISLEAELTKLNSDIAMANDRIKVLED 987
             ++++++  +N        +N ++ ++  SK A       L +    IA    ++K    
Sbjct: 467  EQVQKFRIQNNEMNDKMREFNTLKKSESNSKLA-------LAQREKTIAYLEQQVK---- 515

Query: 988  ELNRREATYSTERSELQEKINALVTDKQRIEEAKADYQQKITQLQTDLEKQISSTNEAET 1047
                    YS + S  Q+ +  L  +++R+        ++I  L  DLE+  S + ++  
Sbjct: 516  -------DYSLQGSNAQKALRDLEIERERL-------NKRIEYLVKDLERTKSESKKSSG 561

Query: 1048 KYQTALQKQAEISENIESLRKSSESYKS-------EIAKFKSAAEEARKVLERNEQTWDQ 1100
              +  +++  ++SE +E L++  ++ KS       ++   K   EE    L+   +    
Sbjct: 562  SLENYIKENGKLSERLEVLQEKYDTVKSLKSNSNNQVDSIKRQCEELNVKLKEANKKIIA 621

Query: 1101 QKADIEANLDLAHQRIEELSTQNRLLYDQIXXXXXXXXXXXXXDTKISSDAREL---IVT 1157
             + ++  N ++  +R  E +   RLL D                T  ++  REL   +  
Sbjct: 622  LEEELNENANILQERTRETNAMRRLLNDD--------------HTDTNAKFRELEEKLAI 667

Query: 1158 LRRERDILETKIDV 1171
            +R ERD L++++D+
Sbjct: 668  IRDERDKLKSELDI 681

>TBLA0E02190 Chr5 complement(534078..537347) [3270 bp, 1089 aa] {ON}
            Anc_7.101 YOL034W
          Length = 1089

 Score = 35.8 bits (81), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 46/165 (27%), Positives = 79/165 (47%), Gaps = 21/165 (12%)

Query: 904  DHASRVQSLSKDLDEANRKLSSAYSEIERYKAASNATERPSLSYNAVQDNKDGSKQAAIS 963
            DH S+VQS  +D  EA +KL S   + + +  A N+ E+    Y A++ + +       S
Sbjct: 273  DHKSKVQSYIRDFREAKQKLKSFLQDKKPFIKAKNSLEKKQAKYQALKQDTNS------S 326

Query: 964  LEAELTKLNSDIAMANDRIKVLEDELNRREAT--YSTERSELQEKINALVTDKQRIEEAK 1021
            L  E  KLNS   + ND  K  E+ + R++    Y     +LQE I +  T+K++     
Sbjct: 327  LINERKKLNS---ILNDLGKGKEEIIKRKKQIEYYENRTKKLQESIRS--TEKEK----- 376

Query: 1022 ADYQQKITQLQTDLEKQISSTNEAETKYQTALQKQAEISENIESL 1066
               + KI  L+T       + +E   +  T ++K++ I+  I S+
Sbjct: 377  ---EDKIASLETLQLPDQQTLDEITNERNTLIEKESNITTKIRSI 418

>Kpol_483.11 s483 complement(25219..32859) [7641 bp, 2546 aa] {ON}
            complement(25219..32859) [7641 nt, 2547 aa]
          Length = 2546

 Score = 35.8 bits (81), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 125/557 (22%), Positives = 252/557 (45%), Gaps = 114/557 (20%)

Query: 158  GVNKELRRHEMELEFTVQSQRSQSLREQAEIQRLQQELALVRSNAEWTTGQLNEKNQ--- 214
            G NK+L   + EL  T+Q   S +   + EIQ+L  +++ +++N+E T   L EK +   
Sbjct: 1975 GENKKLISEKDELIQTLQLDISNN---KDEIQKLSDKISTLQNNSENTELTLEEKEKMVD 2031

Query: 215  QLNSYREKTNGEIQSTQVELNIVK----------NELEVEHANVAALRSKN-------GE 257
            +LNS  ++   ++++ +++LN +K          +EL++ H N   LR +N        E
Sbjct: 2032 ELNSKLQEKEAQVETLELDLNKLKETLDKELESSSELQIAHDN---LRDENIIQKQKITE 2088

Query: 258  LSKQLQDALCETKRLTDSLHSEKQ---EFAREMALKQRLIELLNGQVATMKQDLEKA--- 311
            L  ++ D+  +++ + D++   ++   +   +++ K   IE +N  +++   ++E+    
Sbjct: 2089 LKVKIDDSEKDSQVIIDNMKEMEENIMDLRNDLSSKTIQIEKVNEDLSSKNSEIEQLNKK 2148

Query: 312  -------YDVAK-----NGGMSDSER---ERLLNDLFDTKKKLELSQANVSRLEDTIKEL 356
                   YD  K     +  +S+SE+   ++L +++ + K++LEL   N+ ++       
Sbjct: 2149 LAEKCAEYDSIKSELVASSKLSESEKNDMKQLSDEINELKEQLELKNENLKKV------- 2201

Query: 357  LETDNVQSGGRNGIEHANVGSPSGGSTISTVYGDLAALRKQL-VQERRH------KEELQ 409
              T ++Q    N  +  N       +TI  +   +  L+KQL ++E  +      K++L 
Sbjct: 2202 --TSDLQIAN-NTSDKYNDELKVANNTIREIESKIPNLQKQLDLKEIEYNDTLSSKKDLD 2258

Query: 410  LQVESFVVELEHKIPVLNSFKKRIEELEKQLNGVTLLLEA----------TARERD---- 455
             ++++F  E E     + S KK   +LEK+ N + + L+           T +E +    
Sbjct: 2259 KKLDNFSKESEILSKEVKSLKKEKLDLEKEKNDLIVELDKYKNDIIDLNNTLKENEKNGS 2318

Query: 456  EKVVQIKQYKNKVGDYETQVGHLVQQRSDLARQVQCLLIHISVRDDSSGPLTAEEVEFVK 515
            E   +I   K+K+  Y+  V  L +++  L   ++ L   +  RDD      +E +E   
Sbjct: 2319 EVETEIIGLKDKIEFYKLNVSQLNEEKGKLESDIKTL---VGERDDKLKSSQSEIIELTN 2375

Query: 516  KLQSCRDSATGSDTQAI----ISNRLVEFKSVVE----------------------LQQK 549
            KL+S +D +   +   +    + N+L E +  +E                      LQ  
Sbjct: 2376 KLESFKDISVAYEESKVESDGLKNKLSEIEKSLEESNENVDSANKEISDLKVMNDKLQSH 2435

Query: 550  NAELLNAIRQLAQKLEQEEHKTQSKVKSLEQNTVNEAKEAILSLQEHVQMLEDQLE---- 605
            N EL +  +QL     +   K Q  +  L++   ++A+E I SL E ++ L++  +    
Sbjct: 2436 NLELEDKFQQLKNDTTETNRKIQD-INKLKEEESSKAEEKIRSLTEEIEKLKNDFKKNES 2494

Query: 606  --TVTTERDSFKLLVSE 620
                T+E D   LLVS+
Sbjct: 2495 KAPDTSEIDDLMLLVSD 2511

>ZYRO0D11902g Chr4 complement(1008230..1009561) [1332 bp, 443 aa] {ON}
            highly similar to uniprot|Q99312 Saccharomyces cerevisia
            YOR155C ISN1 Inosine 5'-monophosphate (IMP)- specific 5'-
            nucleotidase
          Length = 443

 Score = 35.0 bits (79), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 33/62 (53%), Gaps = 6/62 (9%)

Query: 1522 NVSVEAASQN--LEALKKKWEEEYEQQTLQRIREAEEALKKRIRLPSEERINQVIERKQK 1579
            N    A  Q+  L    K WE++Y +QTL    +    LK+R++LPSE  I     RK++
Sbjct: 258  NFGFRAVPQDEWLLTHMKSWEDKYMEQTLDFAEKILHTLKQRLKLPSEAPII----RKKR 313

Query: 1580 AL 1581
            A+
Sbjct: 314  AV 315

>Suva_2.528 Chr2 (942956..945790) [2835 bp, 944 aa] {ON} YDR356W
            (REAL)
          Length = 944

 Score = 35.4 bits (80), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 97/398 (24%), Positives = 177/398 (44%), Gaps = 88/398 (22%)

Query: 696  KLSLIQKSLELVKGENADLQNRAGSLQALL--------------LEQDTRRQSTIEEFVS 741
            KL+  +  L+ +KG+  +L+N A    +LL               E + +  +T  +  S
Sbjct: 235  KLNDSESKLKTMKGQVHELENSANRKSSLLESKENELRKVKDQLKELENKADATCSQLDS 294

Query: 742  AKSELFSISSQLTILQS---ERDF-LRKVEADLKKENESLNKDNNDSQLLILQLKTAQKE 797
             K+EL  ++ QL  L++   E+D  L+  E++LKK    LN+         L+ K  Q  
Sbjct: 295  KKNELRKLTDQLNELENQANEKDSQLKSKESELKKLTNQLNE---------LENKVNQNG 345

Query: 798  RDSLIEETR-KRYETRIEELDGELSATKQQLERKQREYDELSSSSSTQCKWFQSKLDSLK 856
              S  +E+  K+ + +I EL+ +++    QL  K+ E   L +    Q    + K++   
Sbjct: 346  SQSSAKESELKKSKIQITELEEKINEKNSQLTAKENELKTLVA----QLNQLEIKMNQKD 401

Query: 857  EELGSSKLALKAKTSELDALKARLNSST--SKLEPASMDHQQSSLVLESDHASRVQSLSK 914
             +LGS       K  EL A+  +LN+    ++ + AS D + S L       ++VQ L  
Sbjct: 402  SQLGS-------KEEELKAINEKLNADIKIARQQTASRDQRISDL------QTKVQDLEN 448

Query: 915  DLDEANRKLSSAYSEIERYKAASNATERPSLSYNAVQDNKDGSKQAAISLEAELTKLNS- 973
            DL           S +E+             ++N      D    A I LE ++  + + 
Sbjct: 449  DL-----------SRMEK-------------THN------DTKSVANIELETKVKMIKTL 478

Query: 974  --DIAMANDRIKVLEDELNRREATYSTERS-------ELQEKINALVTDKQRIEEAKADY 1024
              D+ +A ++   +E ELN +E  Y   +S       +L EKI+ L T+  +++    D 
Sbjct: 479  EIDLKLAKEKCSNIERELNEKEDKYRFSKSSLGDENIKLNEKISILTTENSQLKSKLNDE 538

Query: 1025 QQKITQLQTDLEKQISSTNEAETKYQTALQK-QAEISE 1061
               I+ L+ + E ++SS      +Y+T+ +K ++E+ E
Sbjct: 539  STAISHLKENYETRLSSMRNEVEEYKTSAEKSESEVEE 576

>YGL086W Chr7 (347119..349368) [2250 bp, 749 aa] {ON}
           MAD1Coiled-coil protein involved in the spindle-assembly
           checkpoint; phosphorylated by Mps1p upon checkpoint
           activation which leads to inhibition of the activity of
           the anaphase promoting complex; forms a complex with
           Mad2p
          Length = 749

 Score = 35.0 bits (79), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 44/91 (48%), Gaps = 10/91 (10%)

Query: 364 SGGRNGIEHANVGSPSGGSTISTVYGDLAALRKQL--VQERRHKEELQLQVESFVVELEH 421
           SGG +    +  GSP  GST       + AL+ +L  +Q     E+LQLQ ++ ++E   
Sbjct: 37  SGGSSPFLESPGGSPDVGSTNGQSNRQIQALQFKLNTLQNEYEIEKLQLQKQTNILE--- 93

Query: 422 KIPVLNSFKKRIEELEKQLNGVTLLLEATAR 452
                  +K  I+ELEK LN    L E+  +
Sbjct: 94  -----KKYKATIDELEKALNDTKYLYESNDK 119

>AGL023W Chr7 (670877..674545) [3669 bp, 1222 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFL008W (SMC1)
          Length = 1222

 Score = 35.0 bits (79), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 73/324 (22%), Positives = 148/324 (45%), Gaps = 62/324 (19%)

Query: 369 GIEHANVGSPSGGSTISTVYGDLAALRKQLVQ-ERRHKEEL-QLQVESFVVELEHKIPVL 426
           GI   ++ S    + +S +  ++++LR QL Q  R  KE L +L     ++E E+  P +
Sbjct: 698 GIRTGSIKSRDYENEVSLLSTEISSLRSQLNQLNRSMKEALTELNYHDDLIEKEYS-PKV 756

Query: 427 NSFKKRIEELEKQLNGVTLLLEATARERDEKVVQIKQYKN-------KVGDYETQVGHLV 479
           +S  K +EE++ Q+  +          +D+  +Q   YK+        +G+YE   G  +
Sbjct: 757 DSLHKMVEEVDGQMADIA---------KDKANLQASVYKDFSKKIGFDIGEYEQHTGGRL 807

Query: 480 QQRSDLARQVQCLLIHI-------SVRDDSSGPLTAEEVEFVKKLQSCRDSATGSDTQAI 532
           ++ S   +Q+Q  +++I       + R +S+     +  E +KK+Q   DS T  +T   
Sbjct: 808 RKHSRELQQLQKEVMNIENKLEFETERLESTIKRQQKAREDLKKVQGELDSLTSQET--- 864

Query: 533 ISNRLVEFKSVVELQQKNAELLNAIRQLAQKLEQEEHKTQSKVKSLE--QNTVNEAKEAI 590
                       ++Q    ++ N I +  + LE+ + K + K  +++  ++T+N+  ++I
Sbjct: 865 ------------DIQSNLEQVTNQIAEETKVLEEAQEKLKKKGNNIKIIEDTINDLHDSI 912

Query: 591 LSLQEHVQMLEDQLETVTTERDSFKLLVSEGKNNSLPN---PVGAAAL----------QP 637
            + +  +   ++ +E V  ER      V+  KN  + N   P+ ++AL          + 
Sbjct: 913 QTCKREITEWKEDIEKVGIER------VNILKNCKMTNIELPLDSSALEDLAIERIDAET 966

Query: 638 QEVADGIAHLEARLKAMAEESEQH 661
            E  + I+   +RL A  +ES  H
Sbjct: 967 IEAGNNISVDYSRLSARYKESSSH 990

>YFL008W Chr6 (119429..123106) [3678 bp, 1225 aa] {ON}  SMC1Subunit
           of the multiprotein cohesin complex, essential protein
           involved in chromosome segregation and in double-strand
           DNA break repair; SMC chromosomal ATPase family member,
           binds DNA with a preference for DNA with secondary
           structure
          Length = 1225

 Score = 34.7 bits (78), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 77/143 (53%), Gaps = 17/143 (11%)

Query: 354 KELLETDNVQSGGR-NGIEHANVGSPSGGSTISTVYGDLAALRKQLVQERRHKEELQLQV 412
           K L++ D + +G R N I    V +     ++S +  D+A LR Q+ Q++R  +E +L++
Sbjct: 691 KLLIQIDELSNGQRSNSIRAREVEN-----SVSLLNSDIANLRTQVTQQKRSLDENRLEI 745

Query: 413 ESFVVELEHKI-PVLNSFKKRIEELEKQLNGVTLLLEATARERDEKVVQIKQYKNKVG-- 469
           +     +E +I P +   KK++++LE   +   L+ E  A + +      K++ +K+G  
Sbjct: 746 KYHNDLIEKEIQPKITELKKKLDDLENTKD--NLVKEKEALQNN----IFKEFTSKIGFT 799

Query: 470 --DYETQVGHLVQQRSDLARQVQ 490
             +YE   G L++Q+S   +Q+Q
Sbjct: 800 IKEYENHSGELMRQQSKELQQLQ 822

>KAFR0B04840 Chr2 complement(1005497..1007839) [2343 bp, 780 aa]
           {ON} Anc_2.341 YMR167W
          Length = 780

 Score = 34.3 bits (77), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 60/118 (50%), Gaps = 14/118 (11%)

Query: 568 EHKTQSKVKSLEQ----NTVNEAKEAILSLQEHVQMLEDQLETVT---TERDSFKLLVSE 620
           E  T SK+++ +     NT     EA+ S+  H+     +L  VT   TE+ ++K+  S+
Sbjct: 77  ERFTTSKLETFDDLQKLNTYGFRGEALASIS-HIA----RLTIVTKTETEKCAWKVAYSQ 131

Query: 621 GKNNSLPNPVGAAALQPQEVADGIAHLEARLKAMAEESEQHAKMLNEEIKALYKSNSQ 678
           GK  + P+PV         + D   ++ +RL+++   SE++ K+L  ++   Y  +SQ
Sbjct: 132 GKMLNEPSPVAGKTGTSILIEDLFYNIPSRLRSLKSPSEEYNKIL--DVIGRYAIHSQ 187

>SAKL0G02024g Chr7 (169807..172356) [2550 bp, 849 aa] {ON} weakly
           similar to uniprot|P32380 Saccharomyces cerevisiae
           YDR356W SPC110 Inner plaque spindle pole body (SPB)
           component ortholog of human kendrin involved in
           connecting nuclear microtubules to SPB interacts with
           Tub4p-complex and calmodulin phosphorylated by Mps1p in
           cell cycle-dependent manner
          Length = 849

 Score = 33.9 bits (76), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 29/48 (60%), Gaps = 7/48 (14%)

Query: 309 EKAYDVAKNGGMSDSERERLLNDLFDTKKKLELSQANVSRLEDTIKEL 356
           EK  D+  + G SDSER+ L  +LF TK+KL       S+L+D +K L
Sbjct: 196 EKMQDIEADNGKSDSERQLLEEELFQTKEKL-------SKLKDVVKAL 236

>KLTH0D17688g Chr4 (1470627..1472669) [2043 bp, 680 aa] {ON} weakly
            similar to uniprot|P47166 Saccharomyces cerevisiae
            YJR134C SGM1 Protein of unknown function required for
            wild-type growth rate on galactose and mannose localizes
            to COPI coated vesicles and the Golgi apparatus
          Length = 680

 Score = 33.5 bits (75), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 42/132 (31%), Positives = 66/132 (50%), Gaps = 7/132 (5%)

Query: 1319 LKAELERKSAESIDSQERFRKLRKQANERLDEFKAAKAKVESELELALSGKSQLEAKLSE 1378
            LK  LE   ++S  SQ + R+LR Q NE +   KA+  K ++  E + S  ++LE KL E
Sbjct: 261  LKKSLEDAESQSAQSQLQVRRLRDQ-NEEIS-IKAS-LKYQTLDETSRSEITRLETKLEE 317

Query: 1379 AREKITSLETQLTERPASEDDNPVSHELEETKTKLQDAENTINMLKSEWSISEESFKKQL 1438
             R K+    +   +  A E+    S  L    +K    EN +   +  WS  E SF+++ 
Sbjct: 318  MRIKLYQFSSTQPKGGAVENSASGSKLL----SKYNALENQLKASRGNWSSIESSFRQRT 373

Query: 1439 DELNKQLETIQK 1450
             EL  +LE+ Q+
Sbjct: 374  YELEAKLESTQR 385

>KLLA0C12573g Chr3 (1068765..1071257) [2493 bp, 830 aa] {ON} similar
            to uniprot|Q05050 Saccharomyces cerevisiae YMR031C
            Protein of unknown function green fluorescent protein
            (GFP)-fusion protein localizes to the cytoplasm in a
            punctate pattern
          Length = 830

 Score = 33.5 bits (75), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 55/113 (48%), Gaps = 25/113 (22%)

Query: 966  AELTKLNSDIAMANDRIKVLEDELNRREATYSTERSELQEKINALVTDKQRIEEAKADYQ 1025
            AEL KL  D           E+EL R +   +TE ++LQ+      +++  +E+AK D +
Sbjct: 443  AELAKLKEDN----------EEELKREDEMITTECADLQK------SNENELEQAKKDQE 486

Query: 1026 QKITQLQTDLEKQISSTNEAETKYQTALQKQ-AEISENIESLRKSSESYKSEI 1077
            + +   + DL         A   + T LQ Q  +I ENI+ LR S E +KS +
Sbjct: 487  ELLVPFKNDLA--------AAEDHHTELQDQKGKIEENIQELRDSIEKHKSHV 531

>ABL071W Chr2 (267074..269065) [1992 bp, 663 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YJR134C (SGM1)
          Length = 663

 Score = 33.1 bits (74), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 42/93 (45%), Gaps = 19/93 (20%)

Query: 1397 EDDNPVSHELEETKT--KLQDAENTINMLKSEWSISEESFKKQLDELNKQLETIQKNXXX 1454
            +DDNPV  E E      +L+D +    + +  WS  E S  ++++EL  QLE IQ +   
Sbjct: 308  QDDNPVHAESEYQSLLRQLEDQQRQAVISRENWSSIEYSMNQKIEELQTQLEEIQSS--- 364

Query: 1455 XXXXXXXXXYHEQPTAVLEDFKKQVEEERRTLI 1487
                           AVLE      +EERR L+
Sbjct: 365  --------------CAVLETRLGAADEERRRLV 383

>NDAI0G00520 Chr7 complement(112068..113795) [1728 bp, 575 aa] {ON}
           Anc_1.450 YEL020C
          Length = 575

 Score = 33.1 bits (74), Expect = 8.0,   Method: Composition-based stats.
 Identities = 16/48 (33%), Positives = 27/48 (56%)

Query: 134 DLARLLEEKISDLDASQQELERVLGVNKELRRHEMELEFTVQSQRSQS 181
           D+  ++ E   +LD  + E  R  GV KELR   ++ +F +Q + S+S
Sbjct: 322 DIGLIINELTEELDRVENEWGRKYGVTKELRSEILKNQFKLQEKESRS 369

>KAFR0F03020 Chr6 (595158..597632) [2475 bp, 824 aa] {ON} Anc_4.46
            YLR309C
          Length = 824

 Score = 33.1 bits (74), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 72/319 (22%), Positives = 134/319 (42%), Gaps = 90/319 (28%)

Query: 1155 IVTLRRERDILETKIDVSKREEKMLRQRLELTKSELDNLRAQLSESKGLVTEGTDSSQNQ 1214
            I  ++ E D ++ +I  +++E + L+  +   K++ DNL   +   K           N+
Sbjct: 347  ITRIKEENDNVKNEISAARQENENLKTEISTLKTDTDNLNGHIQSIKN--------DNNK 398

Query: 1215 EELFEKLNQLNLLREHNMSL-------RNESEKVSEHNEFLQNEILSLQEKVQPMEEQIK 1267
             E     N++ L+++ N  L       +NE++K+S     ++N+++  ++ V  +E+QIK
Sbjct: 399  LE-----NEIQLVKKENSKLETEVKTSKNETDKLSSQLNQVKNKLIQKEKTVIYLEKQIK 453

Query: 1268 SLTATXXXXXXXXXXXXXXSDRWKQRSQDILHKYERIDPEEYRKLASEIEVLKAELER-- 1325
                                    +++ D+L +       E ++L++ I++LK E E   
Sbjct: 454  EYAENQEPV---------------KQAMDLLKR-------ENKQLSNRIDLLKNENESLN 491

Query: 1326 ------------------KSAESIDS-QERFRKLRKQANERLDEFKAAKAKVESELELAL 1366
                              K  E ID  QE++  L+   N   D   + K + E       
Sbjct: 492  NDLKKNSSTYEDYLKENGKLTERIDILQEKYDTLQNLKNNSSDHMDSIKKQCE------- 544

Query: 1367 SGKSQLEAKLSEAREKITSLETQLTE----------------RPASEDDNPVSHELEETK 1410
                +L  KL EA +KI SLE +L++                R  SE +N   ++L+E +
Sbjct: 545  ----ELNVKLREANKKIISLEDELSDYTSIIQDKAREADTMRRLLSESNNDEKNKLDEME 600

Query: 1411 TKLQDAENTINMLKSEWSI 1429
            TKL    +  N LKSE ++
Sbjct: 601  TKLNSMIDENNNLKSELNL 619

>TBLA0I03290 Chr9 complement(799772..800995) [1224 bp, 407 aa] {ON} 
          Length = 407

 Score = 32.7 bits (73), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 38/151 (25%), Positives = 60/151 (39%), Gaps = 28/151 (18%)

Query: 1601 PDSIASDKADLIKDHQKEIVQLKKDLADKFEGQLVQVKKKAFEEGRQQGIMKVK------ 1654
            PDS  +    LI+    + + L   L D ++    Q+KK  +E+G+   ++  +      
Sbjct: 31   PDSKGT--LHLIRRRYNDFLNLDTQLNDHYDNYTKQLKKNWWEDGKNVNVITQRKLLLNV 88

Query: 1655 LLESKISKLESQAKAPLGTNVPTKIPLENTQPLAQQVPVKPSPFQLA--YAQATFGNVPF 1712
             LE  I K   Q     GT   +++PLE  Q      P+   P  +    ++   G  P 
Sbjct: 89   FLEDLIIKYSIQD----GTTPTSRLPLE-LQEFLNLKPMNNQPIDIISDNSRGNLGVAPV 143

Query: 1713 LFNKNSEQKKVEHQDDSDSHQNTGNGNKRQS 1743
                    KK+E       H NT NG+ R S
Sbjct: 144  ------STKKLE-------HDNTQNGSVRNS 161

>CAGL0G09867g Chr7 complement(942215..944149) [1935 bp, 644 aa] {ON}
            similar to uniprot|Q06623 Saccharomyces cerevisiae
            YPR179c PLO1
          Length = 644

 Score = 33.1 bits (74), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 29/117 (24%), Positives = 57/117 (48%), Gaps = 1/117 (0%)

Query: 980  DRIKVLEDELNRREATYSTERSELQEKINALVTDKQRIEEAKADYQQKITQLQTDLEKQI 1039
            +RIK  ++EL + +  Y T +S++Q  ++  V D+  I++   +  +K+      + K+I
Sbjct: 444  NRIKFFDEELIKVKDMYDTSKSKIQMNLSQ-VNDQDHIQKELYEKLEKLNAEIDSISKKI 502

Query: 1040 SSTNEAETKYQTALQKQAEISENIESLRKSSESYKSEIAKFKSAAEEARKVLERNEQ 1096
            +S    + +    L    E+ EN+    K+ ESY +E    +   E A    + NE+
Sbjct: 503  NSEGGKKAEILVLLNTHKELMENVRYEEKNIESYNTERQYMEQELERANNAYDENEK 559

>TBLA0F02750 Chr6 (661437..665681) [4245 bp, 1414 aa] {ON} Anc_7.488
            YBL047C
          Length = 1414

 Score = 33.1 bits (74), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 72/127 (56%), Gaps = 13/127 (10%)

Query: 995  TYSTERSELQEKINALVTDKQRIEEAKADYQQKITQLQTDLEKQISSTNEAETKYQTALQ 1054
            T +TE S+LQEKI+  +  ++ +++ K   +Q+  QL++  ++  + TNE         +
Sbjct: 734  TLNTELSDLQEKIDIYLKKQKELDDYKTQVEQQHAQLESTYQQLATKTNELN-------E 786

Query: 1055 KQAEISENIESLRKSSESYKSEIAKFKSAAEEARKVLERNEQTWDQQKADI-EANLDLAH 1113
            +Q E+    +++ +    YK  + +  S  +E    L++ ++++DQ  A++ + ++D A 
Sbjct: 787  RQNELDLQNKNIVEQENVYKQNVERLDSMFDE----LKKRKESFDQSNAELHQQHIDYA- 841

Query: 1114 QRIEELS 1120
            QR+++LS
Sbjct: 842  QRVQDLS 848

>TBLA0E04410 Chr5 (1122005..1126273) [4269 bp, 1422 aa] {ON} Anc_8.259
            YLR086W
          Length = 1422

 Score = 33.1 bits (74), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 70/157 (44%), Gaps = 29/157 (18%)

Query: 187  EIQRLQQELALVRSNAEWTTGQLNEKNQQLNSYREKTNGEIQSTQVELNIVKNELEVEHA 246
            E+Q+L++EL ++  N +     L E NQ++   +E      Q    ELNI K  +E+E+ 
Sbjct: 863  EVQKLERELEILEKNFKVAYNSLKEMNQEILHMKE------QIPATELNISKTTIEIEYC 916

Query: 247  N------VAALRSKNGELSKQLQDALCETKRLTDSLHSEKQEFAREMALKQRLIELLNGQ 300
                   ++ L+ K  E+  Q  +   E K   D L + K+E+             LN Q
Sbjct: 917  ENEIKQLISQLKEKQ-EIHDQESNNNDEIKVADDKLQALKKEYYS-----------LNDQ 964

Query: 301  VATMKQDLEKAY-DVAKNGG----MSDSERERLLNDL 332
                KQ++EK    +   GG    M +S+   L+N L
Sbjct: 965  TKVTKQEIEKLRQQIMDAGGIELKMQNSKVTSLVNQL 1001

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.306    0.123    0.311 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 155,425,753
Number of extensions: 6558187
Number of successful extensions: 68720
Number of sequences better than 10.0: 2591
Number of HSP's gapped: 60205
Number of HSP's successfully gapped: 6780
Length of query: 1758
Length of database: 53,481,399
Length adjustment: 124
Effective length of query: 1634
Effective length of database: 39,262,815
Effective search space: 64155439710
Effective search space used: 64155439710
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 73 (32.7 bits)