Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AFR284W5.700ON1103110354740.0
SAKL0E14872g5.700ON1140113828730.0
Ecym_40205.700ON1125110228370.0
Kwal_55.197075.700ON1143112825890.0
ZYRO0G06644g5.700ON1166112325470.0
Kpol_2001.745.700ON1113112725060.0
CAGL0H06567g5.700ON1169115925010.0
Smik_9.225.700ON1230122024990.0
TDEL0B022105.700ON1095112924940.0
YIL147C (SLN1)5.700ON1220123324930.0
KNAG0L021105.700ON1200121224900.0
Skud_9.215.700ON1221121424820.0
Suva_9.415.700ON1219122524800.0
KAFR0D022405.700ON1187117024680.0
TPHA0D045905.700ON1127114022700.0
Kpol_1043.685.700ON1042110522440.0
KLLA0A00638g5.700ON115572716770.0
NCAS0G002505.700ON118372515730.0
TBLA0I016805.700ON121472715730.0
KLTH0E01100g5.700ON117774514590.0
TPHA0E002505.700ON106873113991e-175
NDAI0F003105.700ON125950212781e-155
TBLA0E021005.700ON114073011461e-137
CAGL0F09097g4.385ON6301421658e-11
NDAI0D034304.385ON5971781641e-10
ADL388W4.385ON4821591593e-10
KLLA0A10219g4.385ON4751221575e-10
Ecym_74744.385ON4961201576e-10
KNAG0M001804.385ON6151221541e-09
Smik_8.2964.385ON6251871532e-09
SAKL0B12408g4.385ON4651221503e-09
KAFR0B069904.385ON5451221504e-09
YHR206W (SKN7)4.385ON6221221488e-09
TDEL0D003204.385ON5472101479e-09
NCAS0A064504.385ON6091301471e-08
KLTH0D17182g4.385ON4641221461e-08
Suva_15.4124.385ON6171221471e-08
Skud_8.2734.385ON6231221461e-08
ZYRO0G00484g4.385ON6471221442e-08
TBLA0A107004.385ON5871221442e-08
Kwal_47.167704.385ON4611221433e-08
Kpol_265.24.385ON5491221406e-08
TPHA0C001504.385ON5101191353e-07
Suva_10.845.230ON6952581319e-07
KNAG0B051405.230ON6481761272e-06
Kwal_33.152885.230ON5871721273e-06
KAFR0J007005.230ON6201291263e-06
Ecym_50775.230ON7951401273e-06
Smik_12.685.230ON7121501254e-06
ZYRO0A11154g5.230ON7761691254e-06
YLR006C (SSK1)5.230ON7122521246e-06
KLTH0B02684g5.230ON5951711192e-05
TPHA0N008505.230ON6701521183e-05
Skud_12.725.230ON7021501174e-05
NCAS0D029005.230ON7621421175e-05
TDEL0E039805.230ON7301431165e-05
ADR343C5.230ON7491401148e-05
Kpol_1004.45.230ON7141731093e-04
CAGL0D02882g5.230ON6671651093e-04
NDAI0I020005.230ON8901461067e-04
KLLA0E09505g5.230ON635741000.004
TBLA0D031705.230ON765154940.019
TBLA0E049804.385ON79175840.35
Kwal_47.181517.222ON414105820.41
KLLA0E04533g7.222ON42199820.50
SAKL0G12100g5.230ON73875800.88
Kwal_14.11598.34ON1521127801.2
KLTH0G18612g8.34ON1524126772.2
KLLA0A03289gsingletonON35742752.7
TBLA0G034508.34ON197277753.9
ABL146C2.67ON42062736.3
Skud_6.19na 1ON85567736.7
TPHA0D003608.34ON1536172737.5
YFL033C (RIM15)8.34ON177077728.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR284W
         (1103 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR284W Chr6 (947118..950429) [3312 bp, 1103 aa] {ON} Syntenic h...  2113   0.0  
SAKL0E14872g Chr5 (1231857..1235279) [3423 bp, 1140 aa] {ON} sim...  1111   0.0  
Ecym_4020 Chr4 complement(49684..53061) [3378 bp, 1125 aa] {ON} ...  1097   0.0  
Kwal_55.19707 s55 complement(89757..93188) [3432 bp, 1143 aa] {O...  1001   0.0  
ZYRO0G06644g Chr7 complement(528671..532171) [3501 bp, 1166 aa] ...   985   0.0  
Kpol_2001.74 s2001 (202108..205449) [3342 bp, 1113 aa] {ON} (202...   969   0.0  
CAGL0H06567g Chr8 (645707..649216) [3510 bp, 1169 aa] {ON} simil...   967   0.0  
Smik_9.22 Chr9 complement(47449..51141) [3693 bp, 1230 aa] {ON} ...   967   0.0  
TDEL0B02210 Chr2 complement(396111..399398) [3288 bp, 1095 aa] {...   965   0.0  
YIL147C Chr9 complement(69791..73453) [3663 bp, 1220 aa] {ON}  S...   964   0.0  
KNAG0L02110 Chr12 (376096..379698) [3603 bp, 1200 aa] {ON} Anc_5...   963   0.0  
Skud_9.21 Chr9 complement(46872..50537) [3666 bp, 1221 aa] {ON} ...   960   0.0  
Suva_9.41 Chr9 complement(64510..68166) [3657 bp, 1219 aa] {ON} ...   959   0.0  
KAFR0D02240 Chr4 complement(450837..454400) [3564 bp, 1187 aa] {...   955   0.0  
TPHA0D04590 Chr4 (1001887..1005270) [3384 bp, 1127 aa] {ON} Anc_...   879   0.0  
Kpol_1043.68 s1043 (141962..145090) [3129 bp, 1042 aa] {ON} (141...   868   0.0  
KLLA0A00638g Chr1 complement(60378..63845) [3468 bp, 1155 aa] {O...   650   0.0  
NCAS0G00250 Chr7 complement(40367..43918) [3552 bp, 1183 aa] {ON...   610   0.0  
TBLA0I01680 Chr9 (372270..375914) [3645 bp, 1214 aa] {ON} Anc_5....   610   0.0  
KLTH0E01100g Chr5 complement(106377..109910) [3534 bp, 1177 aa] ...   566   0.0  
TPHA0E00250 Chr5 complement(34875..38081) [3207 bp, 1068 aa] {ON...   543   e-175
NDAI0F00310 Chr6 complement(66930..70709) [3780 bp, 1259 aa] {ON...   496   e-155
TBLA0E02100 Chr5 (513016..516438) [3423 bp, 1140 aa] {ON} Anc_5....   446   e-137
CAGL0F09097g Chr6 (898706..900598) [1893 bp, 630 aa] {ON} simila...    68   8e-11
NDAI0D03430 Chr4 (809977..811770) [1794 bp, 597 aa] {ON} Anc_4.385     68   1e-10
ADL388W Chr4 (30355..31803) [1449 bp, 482 aa] {ON} Syntenic homo...    66   3e-10
KLLA0A10219g Chr1 (896931..898358) [1428 bp, 475 aa] {ON} simila...    65   5e-10
Ecym_7474 Chr7 (967242..968732) [1491 bp, 496 aa] {ON} similar t...    65   6e-10
KNAG0M00180 Chr13 complement(22500..24347) [1848 bp, 615 aa] {ON...    64   1e-09
Smik_8.296 Chr8 (487452..489329) [1878 bp, 625 aa] {ON} YHR206W ...    64   2e-09
SAKL0B12408g Chr2 (1065161..1066558) [1398 bp, 465 aa] {ON} simi...    62   3e-09
KAFR0B06990 Chr2 (1455520..1457157) [1638 bp, 545 aa] {ON} Anc_4...    62   4e-09
YHR206W Chr8 (512732..514600) [1869 bp, 622 aa] {ON}  SKN7Nuclea...    62   8e-09
TDEL0D00320 Chr4 complement(53243..54886) [1644 bp, 547 aa] {ON}...    61   9e-09
NCAS0A06450 Chr1 (1273459..1275288) [1830 bp, 609 aa] {ON} Anc_4...    61   1e-08
KLTH0D17182g Chr4 complement(1424948..1426342) [1395 bp, 464 aa]...    61   1e-08
Suva_15.412 Chr15 (719438..721291) [1854 bp, 617 aa] {ON} YHR206...    61   1e-08
Skud_8.273 Chr8 (481627..483498) [1872 bp, 623 aa] {ON} YHR206W ...    61   1e-08
ZYRO0G00484g Chr7 complement(35793..37736) [1944 bp, 647 aa] {ON...    60   2e-08
TBLA0A10700 Chr1 (2646036..2647799) [1764 bp, 587 aa] {ON} Anc_4...    60   2e-08
Kwal_47.16770 s47 (103208..104593) [1386 bp, 461 aa] {ON} YHR206...    60   3e-08
Kpol_265.2 s265 (9842..11491) [1650 bp, 549 aa] {ON} (9842..1149...    59   6e-08
TPHA0C00150 Chr3 complement(15029..16561) [1533 bp, 510 aa] {ON}...    57   3e-07
Suva_10.84 Chr10 complement(167272..169359) [2088 bp, 695 aa] {O...    55   9e-07
KNAG0B05140 Chr2 (985361..987307) [1947 bp, 648 aa] {ON} Anc_5.2...    54   2e-06
Kwal_33.15288 s33 complement(1045147..1046910) [1764 bp, 587 aa]...    54   3e-06
KAFR0J00700 Chr10 (127858..129720) [1863 bp, 620 aa] {ON} Anc_5....    53   3e-06
Ecym_5077 Chr5 (166792..169179) [2388 bp, 795 aa] {ON} similar t...    54   3e-06
Smik_12.68 Chr12 complement(148821..150959) [2139 bp, 712 aa] {O...    53   4e-06
ZYRO0A11154g Chr1 (893793..896123) [2331 bp, 776 aa] {ON} simila...    53   4e-06
YLR006C Chr12 complement(161755..163893) [2139 bp, 712 aa] {ON} ...    52   6e-06
KLTH0B02684g Chr2 (207260..209047) [1788 bp, 595 aa] {ON} some s...    50   2e-05
TPHA0N00850 Chr14 complement(189011..191023) [2013 bp, 670 aa] {...    50   3e-05
Skud_12.72 Chr12 complement(153012..155120) [2109 bp, 702 aa] {O...    50   4e-05
NCAS0D02900 Chr4 complement(551013..553301) [2289 bp, 762 aa] {O...    50   5e-05
TDEL0E03980 Chr5 (741644..743836) [2193 bp, 730 aa] {ON} Anc_5.2...    49   5e-05
ADR343C Chr4 complement(1311984..1314233) [2250 bp, 749 aa] {ON}...    49   8e-05
Kpol_1004.4 s1004 complement(9754..11898) [2145 bp, 714 aa] {ON}...    47   3e-04
CAGL0D02882g Chr4 complement(300025..302028) [2004 bp, 667 aa] {...    47   3e-04
NDAI0I02000 Chr9 complement(464492..467164) [2673 bp, 890 aa] {O...    45   7e-04
KLLA0E09505g Chr5 (840647..842554) [1908 bp, 635 aa] {ON} weakly...    43   0.004
TBLA0D03170 Chr4 complement(771345..773642) [2298 bp, 765 aa] {O...    41   0.019
TBLA0E04980 Chr5 (1275927..1278302) [2376 bp, 791 aa] {ON} Anc_4...    37   0.35 
Kwal_47.18151 s47 (709368..710612) [1245 bp, 414 aa] {ON} YIL042...    36   0.41 
KLLA0E04533g Chr5 (408415..409680) [1266 bp, 421 aa] {ON} simila...    36   0.50 
SAKL0G12100g Chr7 (1029250..1031466) [2217 bp, 738 aa] {ON} weak...    35   0.88 
Kwal_14.1159 s14 complement(219896..224461) [4566 bp, 1521 aa] {...    35   1.2  
KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} sim...    34   2.2  
KLLA0A03289g Chr1 complement(294825..295898) [1074 bp, 357 aa] {...    33   2.7  
TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8....    33   3.9  
ABL146C Chr2 complement(123312..124574) [1263 bp, 420 aa] {ON} S...    33   6.3  
Skud_6.19 Chr6 complement(36582..39149) [2568 bp, 855 aa] {ON} Y...    33   6.7  
TPHA0D00360 Chr4 complement(55596..60206) [4611 bp, 1536 aa] {ON...    33   7.5  
YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}  R...    32   8.3  

>AFR284W Chr6 (947118..950429) [3312 bp, 1103 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YIL147C (SLN1)
          Length = 1103

 Score = 2113 bits (5474), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1028/1103 (93%), Positives = 1028/1103 (93%)

Query: 1    MRLGYLRKRLAVLKPPFKAGLRTQLTXXXXXXXXXXXXXXXXTTGVYFTSNYRTLRADRL 60
            MRLGYLRKRLAVLKPPFKAGLRTQLT                TTGVYFTSNYRTLRADRL
Sbjct: 1    MRLGYLRKRLAVLKPPFKAGLRTQLTILVCIIALSSLIILACTTGVYFTSNYRTLRADRL 60

Query: 61   HVAARLMSSQVDQSLTLLYYQCNMLSTKDTIQNALSDYRAGNRSAENWIEADKILGGFLE 120
            HVAARLMSSQVDQSLTLLYYQCNMLSTKDTIQNALSDYRAGNRSAENWIEADKILGGFLE
Sbjct: 61   HVAARLMSSQVDQSLTLLYYQCNMLSTKDTIQNALSDYRAGNRSAENWIEADKILGGFLE 120

Query: 121  RSKTFYIAYLYDEMYQEVLSRWNNDTEGSLAEESLVRLRPLEMDKYEYNEALDVQVETLP 180
            RSKTFYIAYLYDEMYQEVLSRWNNDTEGSLAEESLVRLRPLEMDKYEYNEALDVQVETLP
Sbjct: 121  RSKTFYIAYLYDEMYQEVLSRWNNDTEGSLAEESLVRLRPLEMDKYEYNEALDVQVETLP 180

Query: 181  YNKTLNLMSMTLPVEASTIIGRGNVVGFLTIVMSADPITAVNDTSVLGESMVSILTGIPN 240
            YNKTLNLMSMTLPVEASTIIGRGNVVGFLTIVMSADPITAVNDTSVLGESMVSILTGIPN
Sbjct: 181  YNKTLNLMSMTLPVEASTIIGRGNVVGFLTIVMSADPITAVNDTSVLGESMVSILTGIPN 240

Query: 241  DKGNLVKYRFVFPPGETDRSVTETEYPIKNASFLRDAFLNRSDNYVTSTSSFYHFGALGH 300
            DKGNLVKYRFVFPPGETDRSVTETEYPIKNASFLRDAFLNRSDNYVTSTSSFYHFGALGH
Sbjct: 241  DKGNLVKYRFVFPPGETDRSVTETEYPIKNASFLRDAFLNRSDNYVTSTSSFYHFGALGH 300

Query: 301  DFKKVAVGYSACKFRQLDWVAVVSQDESVFLSPAFKLTKIIIGTVLGVAVFMCIVTFILA 360
            DFKKVAVGYSACKFRQLDWVAVVSQDESVFLSPAFKLTKIIIGTVLGVAVFMCIVTFILA
Sbjct: 301  DFKKVAVGYSACKFRQLDWVAVVSQDESVFLSPAFKLTKIIIGTVLGVAVFMCIVTFILA 360

Query: 361  SWAVKPIVRLQKATEFIAAGRGLRTYNHSGRSSSQNTSIDRSNSRGSDHSLPRELFEKKH 420
            SWAVKPIVRLQKATEFIAAGRGLRTYNHSGRSSSQNTSIDRSNSRGSDHSLPRELFEKKH
Sbjct: 361  SWAVKPIVRLQKATEFIAAGRGLRTYNHSGRSSSQNTSIDRSNSRGSDHSLPRELFEKKH 420

Query: 421  HVSPFVTENHAANSGSCSSMSDHERYLHHIARYHDGETSTNILSDHEKGSTSATNWIDTR 480
            HVSPFVTENHAANSGSCSSMSDHERYLHHIARYHDGETSTNILSDHEKGSTSATNWIDTR
Sbjct: 421  HVSPFVTENHAANSGSCSSMSDHERYLHHIARYHDGETSTNILSDHEKGSTSATNWIDTR 480

Query: 481  VPVYRRLFTDELSELTDTFNTMTDELDRQYVVLEDRVRARTXXXXXXXXXXXXXXXXXTV 540
            VPVYRRLFTDELSELTDTFNTMTDELDRQYVVLEDRVRART                 TV
Sbjct: 481  VPVYRRLFTDELSELTDTFNTMTDELDRQYVVLEDRVRARTKQLEAAKIQAEAANEAKTV 540

Query: 541  FIANIFHELRTPLNGILGMTAIAMAEQDQEKIQNSLKLIFRSGXXXXXXXXXXXXFSKNV 600
            FIANIFHELRTPLNGILGMTAIAMAEQDQEKIQNSLKLIFRSG            FSKNV
Sbjct: 541  FIANIFHELRTPLNGILGMTAIAMAEQDQEKIQNSLKLIFRSGELLLHILTELLTFSKNV 600

Query: 601  LKRTKLEERHFSIIDIALQVKSIFGKLAKDQHVKLSIYLMPNAIRTMVLWGDSNRIIQIV 660
            LKRTKLEERHFSIIDIALQVKSIFGKLAKDQHVKLSIYLMPNAIRTMVLWGDSNRIIQIV
Sbjct: 601  LKRTKLEERHFSIIDIALQVKSIFGKLAKDQHVKLSIYLMPNAIRTMVLWGDSNRIIQIV 660

Query: 661  MNLVSNALKFTPVDGKVDVRIKLVGEYDSARSEACNFSEVYILPGTEVTNSSVNNIPTVV 720
            MNLVSNALKFTPVDGKVDVRIKLVGEYDSARSEACNFSEVYILPGTEVTNSSVNNIPTVV
Sbjct: 661  MNLVSNALKFTPVDGKVDVRIKLVGEYDSARSEACNFSEVYILPGTEVTNSSVNNIPTVV 720

Query: 721  XXXXXXXXXXPTADDTPERKKKDSEXXXXXXXXXXXXXXXXXXXXAVLHAQLKKIPTFID 780
                      PTADDTPERKKKDSE                    AVLHAQLKKIPTFID
Sbjct: 721  EEEEKACEEEPTADDTPERKKKDSETVDDADAISISSSVATSYDDAVLHAQLKKIPTFID 780

Query: 781  LEDSDNNVTMSKLEKPRSWVIVIEVQDTGPGIEPSLHESVFKPFVQGDQTLSRQYGGTGL 840
            LEDSDNNVTMSKLEKPRSWVIVIEVQDTGPGIEPSLHESVFKPFVQGDQTLSRQYGGTGL
Sbjct: 781  LEDSDNNVTMSKLEKPRSWVIVIEVQDTGPGIEPSLHESVFKPFVQGDQTLSRQYGGTGL 840

Query: 841  GLSICRQLATMMKGTMKLESKVGSGSKFTFTVPLQQTGTVKFNDGDTLFEDEFNIFSKKN 900
            GLSICRQLATMMKGTMKLESKVGSGSKFTFTVPLQQTGTVKFNDGDTLFEDEFNIFSKKN
Sbjct: 841  GLSICRQLATMMKGTMKLESKVGSGSKFTFTVPLQQTGTVKFNDGDTLFEDEFNIFSKKN 900

Query: 901  RKVKFQLNRSGKSRKGKMNNSNGAGSIAESAIESFGKSESEASFGSVRVDRPFLQSTGTA 960
            RKVKFQLNRSGKSRKGKMNNSNGAGSIAESAIESFGKSESEASFGSVRVDRPFLQSTGTA
Sbjct: 901  RKVKFQLNRSGKSRKGKMNNSNGAGSIAESAIESFGKSESEASFGSVRVDRPFLQSTGTA 960

Query: 961  TSTRSVPTLSSAESSLRILVAEDNNVNQEVIKRMLHLEGAHNIDLACDGEDAYQKVSALV 1020
            TSTRSVPTLSSAESSLRILVAEDNNVNQEVIKRMLHLEGAHNIDLACDGEDAYQKVSALV
Sbjct: 961  TSTRSVPTLSSAESSLRILVAEDNNVNQEVIKRMLHLEGAHNIDLACDGEDAYQKVSALV 1020

Query: 1021 EQGEHYDLIFMDVQMPRMDGLLTTKLLRQKLHYEYPIVALTAFADDSNIKECLESGMNSF 1080
            EQGEHYDLIFMDVQMPRMDGLLTTKLLRQKLHYEYPIVALTAFADDSNIKECLESGMNSF
Sbjct: 1021 EQGEHYDLIFMDVQMPRMDGLLTTKLLRQKLHYEYPIVALTAFADDSNIKECLESGMNSF 1080

Query: 1081 LAKPIKRPMLKKILLEHTSQLKT 1103
            LAKPIKRPMLKKILLEHTSQLKT
Sbjct: 1081 LAKPIKRPMLKKILLEHTSQLKT 1103

>SAKL0E14872g Chr5 (1231857..1235279) [3423 bp, 1140 aa] {ON} similar
            to uniprot|P39928 Saccharomyces cerevisiae YIL147C SLN1
            Histidine kinase osmosensor that regulates a MAP kinase
            cascade; transmembrane protein with an intracellular
            kinase domain that signals to Ypd1p and Ssk1p, thereby
            forming a phosphorelay system similar to bacterial
            two-component regulators
          Length = 1140

 Score = 1111 bits (2873), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 605/1138 (53%), Positives = 754/1138 (66%), Gaps = 60/1138 (5%)

Query: 3    LGYLRKRLAVLKPPFKAGLRTQLTXXXXXXXXXXXXXXXXTTGVYFTSNYRTLRADRLHV 62
            +G+LR +L   KPPFK G+RTQL                 TTGVYFT+NY++LRADRLHV
Sbjct: 4    IGHLRSKL---KPPFKVGIRTQLIALVCVVALLSLVILAVTTGVYFTANYKSLRADRLHV 60

Query: 63   AARLMSSQVDQSLTLLYYQCNMLSTKDTIQNALSDYRAGNRSAENWIEADKILGGFLERS 122
            AA+L SSQ+DQ+L  LYYQC  LST+DT+Q++L  YRAGN + ENW EA+ +L  FL  S
Sbjct: 61   AAQLKSSQIDQNLNYLYYQCYWLSTRDTLQDSLIRYRAGNTTKENWSEAEIVLEKFLGSS 120

Query: 123  KTFYIAYLYDEMYQEVLSRWNNDTEGSLAEESLVRLRPLEMDKYEYNEALDVQVETLP-Y 181
              F +A +YD  ++ VL+  NN +   + E  L  L PL  D    +      + T P  
Sbjct: 121  DLFSVARIYDSTFKTVLNATNNGSGNLVPEHVLTNLFPLSTDDPLASSLQTSGILTDPVL 180

Query: 182  NKTLNLMSMTLPVEASTIIGRGN--VVGFLTIVMSADPITAV-NDTSVLGESMVSILTGI 238
            N T+ +MSM+LP+ AS  I   N  + G++T+VMSA+ +  V NDT+ L +S V+IL+  
Sbjct: 181  NDTVYVMSMSLPIFASPSIMLTNSEISGYITVVMSAESLKIVFNDTTALDKSDVAILSAE 240

Query: 239  PNDKGNLVKYRFVFPPGETDRSVTETEYPIKNASFLRDAFLNRSDNYVTSTSSFYHFGAL 298
             +++   V Y FVFPP      + +  + I+N SF++ AF +R    V  TS FY     
Sbjct: 241  YSNQSLPVSYHFVFPPHGVGADIIDYSFTIENGSFIQSAFDDRKSGSVKRTSFFYG---- 296

Query: 299  GHDFKKVAVGYSACKFRQLDWVAVVSQDESVFLSPAFKLTKIIIGTVLGVAVFMCIVTFI 358
                K VAVGYS C F+Q+ WVAV+SQ E+VFLSP+ +LT IIIGT LG+AVFMC+VTF 
Sbjct: 297  ----KDVAVGYSPCLFKQVQWVAVISQPENVFLSPSTRLTNIIIGTALGIAVFMCLVTFP 352

Query: 359  LASWAVKPIVRLQKATEFIAAGRGLRTYNHSGRSSSQNTSIDRSNSRGSDHSLPRELFEK 418
            LA WAVKPIVRLQKATE I A RGLR+YN S  +S  N+   R ++  S  S+ R + ++
Sbjct: 353  LAHWAVKPIVRLQKATEIITARRGLRSYNQSAPASRTNSFRKRPSTSSSIGSVFRTITDR 412

Query: 419  KHHV----SPFVTENHAANSGSCSSMSDHERYLHHIARYHDGETSTNILSDHEKGST--- 471
             H      S F   +  +NS   S  +  E  +       +  T T+  +D     +   
Sbjct: 413  PHERDNGHSNFELHHRTSNSVD-SQEARMELEISGALPDTNPTTPTSYTNDQHSYKSDNF 471

Query: 472  -SATNWIDTRVPVYRRLFTDELSELTDTFNTMTDELDRQYVVLEDRVRARTXXXXXXXXX 530
             ++TN ID RVPVY RLF+DELSELTDTFNTMTDELDR Y +LEDRVRART         
Sbjct: 472  VNSTNLIDARVPVYGRLFSDELSELTDTFNTMTDELDRHYALLEDRVRARTKQLEAAKIE 531

Query: 531  XXXXXXXXTVFIANIFHELRTPLNGILGMTAIAMAEQDQEKIQNSLKLIFRSGXXXXXXX 590
                    TVFIANI HELRTPLNGILGMTAI+MAE+D +K+QNSLKLIFRSG       
Sbjct: 532  AEAANEAKTVFIANISHELRTPLNGILGMTAISMAEKDMQKVQNSLKLIFRSGELLLHIL 591

Query: 591  XXXXXFSKNVLKRTKLEERHFSIIDIALQVKSIFGKLAKDQHVKLSIYLMPNAIRTMVLW 650
                 FSKNVL+RTKLEER+F+I+D+ALQVKSIFGKLAKDQHV LSI L PN IRTM+LW
Sbjct: 592  TELLTFSKNVLQRTKLEERNFAIMDVALQVKSIFGKLAKDQHVNLSIILSPNVIRTMILW 651

Query: 651  GDSNRIIQIVMNLVSNALKFTPVDGKVDVRIKLVGEYDSARSEACNFSEVYI-----LPG 705
            GDSNRIIQIVMNLVSNALKF+PVDGKV VRIKL+GEYD  +S+  N+++V+I     +P 
Sbjct: 652  GDSNRIIQIVMNLVSNALKFSPVDGKVGVRIKLLGEYDGKKSKDSNYNDVFIKPGTEIPD 711

Query: 706  TEVTNSSVNNIPTVVXXXXXXXXXXPTAD---------------------------DTPE 738
               + SS++ +               ++D                           DT  
Sbjct: 712  ASASKSSLSTLEYTKVDAIQRRLASKSSDSQKLKEEPIASSDVSSSDGKDESEADTDTDT 771

Query: 739  RKKKDSEXXXXXXXXXXXXXXXXXXXXAVLHAQLKKIPTFIDLEDSDNNVTMSKLEKPRS 798
             K+ +SE                    A+LHAQL+K+P+  + EDS +++   KLE  ++
Sbjct: 772  DKRSNSEISDSLSLVSSNNSSYDD---AILHAQLRKVPSCGNGEDSGDSLG-RKLEISKT 827

Query: 799  WVIVIEVQDTGPGIEPSLHESVFKPFVQGDQTLSRQYGGTGLGLSICRQLATMMKGTMKL 858
            WVI IEV+DTGPGIEP+LHESVF+PFVQGDQTLSRQYGGTGLGLSICRQLA MMKGTMKL
Sbjct: 828  WVIAIEVEDTGPGIEPALHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAKMMKGTMKL 887

Query: 859  ESKVGSGSKFTFTVPLQQTGTVKFNDGDTLFEDEFNIFSKKNRKVKFQLNRSGKSRKGKM 918
            ESKVG GSKFTFTVPL QT  V F+D +  FEDEFN  SKKNRKVKF++N++    K + 
Sbjct: 888  ESKVGVGSKFTFTVPLTQTREVSFDDVENPFEDEFNAHSKKNRKVKFKMNKNSGGSKSRP 947

Query: 919  NNSNGAGSIAESAIESFGKSESEASFGSVRVDRPFLQSTGTATSTRSVPTLSSAESSLRI 978
            + +    S  +S  E    SESE S GSVRVDRPFLQSTGTATSTRS+ T+ S E   +I
Sbjct: 948  SVNTSLNSGTDSTAEKMALSESEVSVGSVRVDRPFLQSTGTATSTRSITTVKSLERPFKI 1007

Query: 979  LVAEDNNVNQEVIKRMLHLEGAHNIDLACDGEDAYQKVSALVEQGEHYDLIFMDVQMPRM 1038
            LVAEDNNVNQEV+KRML+LEG  +IDLACDG++A+ KV AL E  +HY +IFMDVQMPR+
Sbjct: 1008 LVAEDNNVNQEVVKRMLNLEGLSDIDLACDGQEAFDKVKALQEANDHYRIIFMDVQMPRV 1067

Query: 1039 DGLLTTKLLRQKLHYEYPIVALTAFADDSNIKECLESGMNSFLAKPIKRPMLKKILLE 1096
            DGLL+TK++RQ+L Y +PIVALTAFADDSNIK CL+SGMN FL+KPIKRP LK +L E
Sbjct: 1068 DGLLSTKMIRQELRYSHPIVALTAFADDSNIKVCLDSGMNGFLSKPIKRPKLKSVLSE 1125

>Ecym_4020 Chr4 complement(49684..53061) [3378 bp, 1125 aa] {ON}
            similar to Ashbya gossypii AFR284W
          Length = 1125

 Score = 1097 bits (2837), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 610/1102 (55%), Positives = 778/1102 (70%), Gaps = 22/1102 (1%)

Query: 7    RKRLAVLKPPFKAGLRTQLTXXXXXXXXXXXXXXXXTTGVYFTSNYRTLRADRLHVAARL 66
            R R  + +PP+KAGL TQLT                TTGVYFT+NY++LRADRL VAA+L
Sbjct: 17   RIRKHMFRPPYKAGLSTQLTILVCIIALCSLIILAVTTGVYFTTNYKSLRADRLTVAAQL 76

Query: 67   MSSQVDQSLTLLYYQCNMLSTKDTIQNALSDYRAGNRSAENWIEADKILGGFLERSKTFY 126
             S+Q++Q+L ++YYQC  LS++D+IQNAL  Y+ GN S+ N   A ++L  FL+ S + +
Sbjct: 77   TSAQINQTLNIIYYQCYWLSSRDSIQNALVSYKVGNTSSLNLDNAKEVLVKFLDSSNSIF 136

Query: 127  IAYLYDEMYQEVLSRWNNDTEGSLAEESLVRLRPLEMDKYEYNEALDVQVETLP-YNKTL 185
              +LYD  + EVLS   N T   + ++ L  L PL  +    +  +D  + + P +N + 
Sbjct: 137  RTHLYDSAFNEVLSVSTNSTGNIIGDDLLRDLLPLSSNSPLPSSIIDDGMLSNPVFNGSS 196

Query: 186  NLMSMTLPV--EASTIIGRGNVVGFLTIVMSADPITAV-NDTSVLGESMVSILTGIPNDK 242
              MSM+LPV  +AS +  + + VG++T+VMSAD +++V      L  S VS+L G+ ++ 
Sbjct: 197  FFMSMSLPVSAKASILYPKSDTVGYITMVMSADQVSSVCAGKPALNGSTVSVLAGVYDEN 256

Query: 243  GNLVKYRFVFPPG--ETDRSVTETEYPIKNASFLRDAFLNRSDNYVTSTSSFYHFGALGH 300
              L  Y+ +FPP   +  R + E  +PI N SFL +AF+NRS   V+ T++FY       
Sbjct: 257  NILNSYQVLFPPSIVQVPR-LLEIVFPIANNSFLYNAFVNRSSGSVSKTNAFYE------ 309

Query: 301  DFKKVAVGYSACKFRQLDWVAVVSQDESVFLSPAFKLTKIIIGTVLGVAVFMCIVTFILA 360
                VAVGY+AC F+ ++WVAVV+Q E+VFLSP+ KLTKIIIGTV+G+A F+CIVTFI+A
Sbjct: 310  --PNVAVGYAACSFKLVNWVAVVAQQEAVFLSPSTKLTKIIIGTVIGIAFFICIVTFIVA 367

Query: 361  SWAVKPIVRLQKATEFIAAGRGLRTYNHSGRSSSQNTSIDRSNSRGSDHSLPRELFE-KK 419
            +WAVKPIVRLQKATE IAAGRGLR+Y HS RSSS+ TSI+RSNS+GS     RE    +K
Sbjct: 368  NWAVKPIVRLQKATELIAAGRGLRSYRHSSRSSSRTTSINRSNSKGSPSPTLREGDGLRK 427

Query: 420  HHVSPFVTENHAANSGSCSSMSDHERYLHHIARYHDGETSTNILSDHEKGSTSATNWIDT 479
               SP+ T  H+    + S +     Y   IAR    E  ++  S+     T++ NWI+T
Sbjct: 428  TPPSPY-TPMHSHVEPNPSGIG--REYSVDIARAIGIEVPSSHPSERVDAFTTSANWIET 484

Query: 480  RVPVYRRLFTDELSELTDTFNTMTDELDRQYVVLEDRVRARTXXXXXXXXXXXXXXXXXT 539
            RVPVYRRLF+DELSELTDTFN+MTDELDR Y +LEDRVRART                 T
Sbjct: 485  RVPVYRRLFSDELSELTDTFNSMTDELDRHYALLEDRVRARTKQLEAAKIQAESANEAKT 544

Query: 540  VFIANIFHELRTPLNGILGMTAIAMAEQDQEKIQNSLKLIFRSGXXXXXXXXXXXXFSKN 599
            +FIANI HELRTPLNGILGMTAIAMAE D EK+QNSLKLIFRSG            FSKN
Sbjct: 545  MFIANISHELRTPLNGILGMTAIAMAENDMEKVQNSLKLIFRSGELLLHILTELLTFSKN 604

Query: 600  VLKRTKLEERHFSIIDIALQVKSIFGKLAKDQHVKLSIYLMPNAIRTMVLWGDSNRIIQI 659
            +LKR KLE+R+FS++D+ALQVKSIFGKLAKDQ+VK SI+LMPN IR MVLWGDSNRIIQI
Sbjct: 605  ILKRNKLEQRNFSMVDVALQVKSIFGKLAKDQNVKFSIFLMPNLIRKMVLWGDSNRIIQI 664

Query: 660  VMNLVSNALKFTPVDGKVDVRIKLVGEYDSARSEACNFSEVYILPGTEVTNSSVNNIPTV 719
            VMNLVSNALKFTPVDGKV +RIKL+GEYD   SE CN +EV+I  GTE+++ + N   T+
Sbjct: 665  VMNLVSNALKFTPVDGKVSLRIKLLGEYDEEESEKCNNAEVFIKQGTEISDETKNVFDTI 724

Query: 720  VXXXXXXXXXXPTADDTPERKKKDSEXXXXXXXXXXXXXXXXXXXXAVLHAQLKKIPTFI 779
                        T DDT E  ++ ++                    A+ H++ KKIP  +
Sbjct: 725  TEEKYVSCSGEST-DDTIETGQEGAQKPDKADNISVVSSGTSSYDDAIFHSRFKKIPAVL 783

Query: 780  DLEDSDNNVTMSKLEKPRSWVIVIEVQDTGPGIEPSLHESVFKPFVQGDQTLSRQYGGTG 839
            D+++ D + ++ K EK + WVI IEV+DTGPGI+PSL ESVFKPFVQGDQTLSRQYGGTG
Sbjct: 784  DVDEGDLS-SIGKSEKKKVWVISIEVEDTGPGIDPSLQESVFKPFVQGDQTLSRQYGGTG 842

Query: 840  LGLSICRQLATMMKGTMKLESKVGSGSKFTFTVPLQQTGTVKFNDGDTLFEDEFNIFSKK 899
            LGLSICRQL+TMMKGTMKL S+VG GSKF FTVPL+QTGTV+  D + LFEDEFN  SK 
Sbjct: 843  LGLSICRQLSTMMKGTMKLHSEVGVGSKFIFTVPLRQTGTVEDLDDEDLFEDEFNAQSKI 902

Query: 900  NRKVKFQLNRSGKSRKGKMNNSNGAGSIAESAIESFGKSESEASFGSVRVDRPFLQSTGT 959
            NR+VKF+LN+ GKSR+  ++    +G + +S + S G+SESE S  SVRVDRPFLQSTGT
Sbjct: 903  NRRVKFKLNKGGKSRQSSLSVPEISG-VPDSPLNSMGRSESELSVSSVRVDRPFLQSTGT 961

Query: 960  ATSTRSVPTLSSAESSLRILVAEDNNVNQEVIKRMLHLEGAHNIDLACDGEDAYQKVSAL 1019
            ATSTRS+PT+ S ES+ ++LVAEDNNVNQEVIKRML LEG ++I+LACDGE+A +KV+ L
Sbjct: 962  ATSTRSIPTVGSLESNFKVLVAEDNNVNQEVIKRMLQLEGIYDIELACDGEEALEKVANL 1021

Query: 1020 VEQGEHYDLIFMDVQMPRMDGLLTTKLLRQKLHYEYPIVALTAFADDSNIKECLESGMNS 1079
              Q +HY+++FMDVQMP+MDGL+ T+ +R++L+Y YPIVALTAFADDSNIK CLESGM+ 
Sbjct: 1022 TNQYDHYNIVFMDVQMPKMDGLIATRNIRKELNYTYPIVALTAFADDSNIKVCLESGMDG 1081

Query: 1080 FLAKPIKRPMLKKILLEHTSQL 1101
            FL+KPIKR  L+KILLE+   L
Sbjct: 1082 FLSKPIKREKLRKILLEYCPVL 1103

>Kwal_55.19707 s55 complement(89757..93188) [3432 bp, 1143 aa] {ON}
            YIL147C (SLN1) - histidine kinase osmosensor that
            regulates an osmosensing MAP kinase cascade and is
            similar to bacterial two-component regulators [contig
            159] FULL
          Length = 1143

 Score = 1001 bits (2589), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 564/1128 (50%), Positives = 712/1128 (63%), Gaps = 62/1128 (5%)

Query: 13   LKPPFKAGLRTQLTXXXXXXXXXXXXXXXXTTGVYFTSNYRTLRADRLHVAARLMSSQVD 72
            L+ P    +RTQLT                 TGVYFTS++++LRA+RLHVAA+L SSQ+D
Sbjct: 17   LRRPLVVSIRTQLTALVCLVALLSLIILAVITGVYFTSSFKSLRAERLHVAAQLKSSQID 76

Query: 73   QSLTLLYYQCNMLSTKDTIQNALSDYRAGNRSAENWIEADKILGGFLERSKTFYIAYLYD 132
            Q+L  LYYQC  LST+D +QNAL+ Y AGN S ENW +A   L  FL  S  F +A +YD
Sbjct: 77   QNLNYLYYQCYWLSTRDILQNALTQYLAGNTSTENWSDASTTLDKFLGSSNLFSLARVYD 136

Query: 133  EMYQEVLSRWNNDTEGSLAEESLVRLRPLEMDKYEYNEALDVQVETLP-YNKTLNLMSMT 191
              +Q+VL+  NN +   + E  L +L PL  D    +      + T P  N ++ LMSM+
Sbjct: 137  SSFQDVLNVSNNGSGNLIPENLLTQLFPLSTDVALPSSLERTGMLTDPVLNGSVYLMSMS 196

Query: 192  LPVEA--STIIGRGNVVGFLTIVMSADPITAV-NDTSVLGESMVSILTGIPNDKGNLVKY 248
            LP+ A  S I+    V G++T+V+SA+ + +V NDT+ L +S V I++ + +D   L  Y
Sbjct: 197  LPIFANPSIILSTAKVYGYITVVISAEGLKSVYNDTTALDDSSVIIVSTVYDDH-ELAGY 255

Query: 249  RFVFPPGETDRSVTETEYPIKNASFLRDAFLNRSDNYVTSTSSFYHFGALGHDFKKVAVG 308
              VFPP      V    Y I+N SFL DA  +     + ST  F +        KK+AVG
Sbjct: 256  HLVFPPYNMYPDVINEHYQIENGSFLEDAIKDGKGGSIKSTRFFNN--------KKIAVG 307

Query: 309  YSACKFRQLDWVAVVSQDESVFLSPAFKLTKIIIGTVLGVAVFMCIVTFILASWAVKPIV 368
            YS C      WVA+++Q E++FLSP+ +L KII+GT + +AV  C+VTF L+ WAV+PIV
Sbjct: 308  YSPCNSTLAQWVAIITQPEAIFLSPSTRLAKIIVGTCIAIAVVTCVVTFPLSHWAVQPIV 367

Query: 369  RLQKATEFIAAGRGLRTYNHSGRSSSQNTSIDRS-NSRGSDHSLPRELFEKKHHVSPFVT 427
            RLQKATE I AGRGLR+ N S   S + TS   S +S     S+ R     +     ++ 
Sbjct: 368  RLQKATEIITAGRGLRSDNSSTLFSHKRTSTAESFSSIFGTGSVRRSGSVARAGRDKYIP 427

Query: 428  ENHAANSGSCSSMSDHERYLHHIARYH----DGETSTNILSDHEKGST----SATNWIDT 479
            ++        SS + HE    +I        +  T  +++++ +   +    ++TN I+ 
Sbjct: 428  DSSKEVPRGNSSDAIHEVNQENIEDIEMQKVNSPTPYSMMNESQAVKSERYITSTNLIEA 487

Query: 480  RVPVYRRLFTDELSELTDTFNTMTDELDRQYVVLEDRVRARTXXXXXXXXXXXXXXXXXT 539
            RVPVY+RLF+DELSELT+TFNTMTDELDR Y +LEDRVRART                 T
Sbjct: 488  RVPVYKRLFSDELSELTETFNTMTDELDRHYALLEDRVRARTRQLEAAKIEAEGANEAKT 547

Query: 540  VFIANIFHELRTPLNGILGMTAIAMAEQDQEKIQNSLKLIFRSGXXXXXXXXXXXXFSKN 599
            VFIANI HELRTPLNGILGMTAIAMAE+D  K+++SLKLIFRSG            FSKN
Sbjct: 548  VFIANISHELRTPLNGILGMTAIAMAEEDTAKVKSSLKLIFRSGELLLHIMTELLTFSKN 607

Query: 600  VLKRTKLEERHFSIIDIALQVKSIFGKLAKDQHVKLSIYLMPNAIRTMVLWGDSNRIIQI 659
            VLKRTKLEER F I+DIALQV+SIFGKLAKDQHV L+I ++PN +R+MVLWGDSNRI+QI
Sbjct: 608  VLKRTKLEERDFQIVDIALQVESIFGKLAKDQHVNLTISILPNLLRSMVLWGDSNRIVQI 667

Query: 660  VMNLVSNALKFTPVDGKVDVRIKLVGEYDSARSEACNFSEVYILPGTEVTNSSV-----N 714
            VMNLVSNALKFTPVDGKVDV+ +L+GEYD  +S+A  + EV++LP TE   SS       
Sbjct: 668  VMNLVSNALKFTPVDGKVDVKFRLLGEYDEEKSKASEYKEVFVLPPTESRTSSTEAKDEK 727

Query: 715  NIPTVVXXXXXXXXXXPTADDTPERKKK----------DSEXXXXX-------XXXXXXX 757
            N  + V           TA+ T E+  K          DSE                   
Sbjct: 728  NAESCVDSDTNVLSLPSTAESTDEKNVKIGQRSESEAIDSEAIESSDEDDENEDTKSIGS 787

Query: 758  XXXXXXXXAVLHAQLKKIPTFIDLEDSDN--NVTMSKLEKPRSWVIVIEVQDTGPGIEPS 815
                    A+   +L+K        DS N  N     LE P+ WVI +EV DTGPGI+P+
Sbjct: 788  GNTSSYDDAIFQTRLRK--------DSSNEENEEGRALESPKKWVISMEVHDTGPGIDPA 839

Query: 816  LHESVFKPFVQGDQTLSRQYGGTGLGLSICRQLATMMKGTMKLESKVGSGSKFTFTVPLQ 875
            LHESVF+PFVQGDQTLSRQYGGTGLGLSICRQLATMM GTMKL+S+VG GSKF+FTVPL 
Sbjct: 840  LHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMHGTMKLDSQVGVGSKFSFTVPLT 899

Query: 876  QTGTVKFNDGDTLFEDEFNIFSKKNRKVKFQLNRSG------KSRKGKMNNSNGAGSIAE 929
            QT  + F D +  FEDEFN  SKKNRKVKF++ +S           G   N   +  +  
Sbjct: 900  QTKELLFEDVENPFEDEFNPDSKKNRKVKFRMGKSNKRSKSRSESSGTEGNGGNSPGVEG 959

Query: 930  SAIESFGKSESEASFGSVRVDRPFLQSTGTATSTRSVPTLSSAESSLRILVAEDNNVNQE 989
            S   S G   SE S GSVRVDRPFLQSTGTA ST  V T S A+   +ILVAEDNNVNQE
Sbjct: 960  SGGNSPGTG-SEVSVGSVRVDRPFLQSTGTALSTTLVTTSSLADRR-KILVAEDNNVNQE 1017

Query: 990  VIKRMLHLEGAHNIDLACDGEDAYQKVSALVEQGEHYDLIFMDVQMPRMDGLLTTKLLRQ 1049
            VIKRML+LEG  +++LACDG+DA+ KV A    G+HYDLIFMDVQMPR+DGL  T+++R+
Sbjct: 1018 VIKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPRVDGLTATRMIRK 1077

Query: 1050 KLHYEYPIVALTAFADDSNIKECLESGMNSFLAKPIKRPMLKKILLEH 1097
            +L Y +PIVALTAFADDSNIKECL++GMN FL+KPIKRP +K IL E+
Sbjct: 1078 ELGYSHPIVALTAFADDSNIKECLDAGMNGFLSKPIKRPKIKAILKEY 1125

>ZYRO0G06644g Chr7 complement(528671..532171) [3501 bp, 1166 aa] {ON}
            similar to uniprot|P39928 Saccharomyces cerevisiae
            YIL147C SLN1 Histidine kinase osmosensor that regulates a
            MAP kinase cascade; transmembrane protein with an
            intracellular kinase domain that signals to Ypd1p and
            Ssk1p, thereby forming a phosphorelay system similar to
            bacterial two-component regulators
          Length = 1166

 Score =  985 bits (2547), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 557/1123 (49%), Positives = 709/1123 (63%), Gaps = 70/1123 (6%)

Query: 13   LKPPFKAGLRTQLTXXXXXXXXXXXXXXXXTTGVYFTSNYRTLRADRLHVAARLMSSQVD 72
             + P + G+R QLT                +TGVYFT NY+ LR++RL++AA+L S+Q+D
Sbjct: 11   FQSPIRLGIRAQLTALVSIVALVSLIILAVSTGVYFTDNYKNLRSERLYMAAQLKSTQID 70

Query: 73   QSLTLLYYQCNMLSTKDTIQNALSDYRAGNRSAENWIEADKILGGFLERSKTFYIAYLYD 132
            Q+L  +YYQC  LS++DT+Q AL++Y AGN++  NW+++  ++  FL  S  F +A +YD
Sbjct: 71   QNLNYMYYQCYWLSSRDTLQEALANYVAGNKTYANWVDSGNVIQKFLTSSGLFSVATIYD 130

Query: 133  EMYQEVLSRWNNDTEGSLAEESLVRLRPLEMDKYEYNEALDVQVETLPYNKTLN----LM 188
              +  VLS  NN T   + E +L RL PL  +K   +    +Q E +  N  LN    LM
Sbjct: 131  ATFTPVLSATNNGTGNHIPESTLDRLMPLSGNKPLPSS---LQSEGILTNPVLNGTSYLM 187

Query: 189  SMTLPVEA--STIIGRGNVVGFLTIVMSADPITAV-NDTSVLGESMVSILTGIPNDKGNL 245
            SM+LP+ A  S I+   +V G++TIVMSAD +  V +DT+ L +S V+IL+ + +    L
Sbjct: 188  SMSLPIFANPSIILTTSHVYGYITIVMSADSLKNVFDDTTALEKSNVAILSAVYDQNETL 247

Query: 246  VKYRFVFPPGETDRSVTETEYPIKNASFLRDAFLNRSDNYVTSTSSFYHFGALGHDFKKV 305
              Y FVF P     S+     PIKN +FL  A        +  T   Y         KKV
Sbjct: 248  SSYNFVFAPLGVPSSILAETIPIKNGTFLSSALRQGKGGALERTKFLYT--------KKV 299

Query: 306  AVGYSACKFRQLDWVAVVSQDESVFLSPAFKLTKIIIGTVLGVAVFMCIVTFILASWAVK 365
            AVGYS C    ++W+AVV Q E+VF+ PA KLTKII GTV+G+ VF+C+VTF LA WAVK
Sbjct: 300  AVGYSPCSVVFVNWIAVVLQSEAVFMEPATKLTKIISGTVVGIGVFVCLVTFPLAHWAVK 359

Query: 366  PIVRLQKATEFIAAGRGLRTYNHSGRSSS---QNTSIDRSNSRGSDHSLPRELFEKKHHV 422
            PIVRLQKATE I  GRGLR  +    SS+   +++   R ++ GS              +
Sbjct: 360  PIVRLQKATELITEGRGLRASSPGAGSSNVSRRSSFFHRPSNCGSS-------------I 406

Query: 423  SPFVTENHAANSGSCSSMSDHERY------LHHIARYHDGETSTNILSDHEKGSTSATNW 476
               VT+NH               +      ++H        +    LSD  KG T++ N 
Sbjct: 407  RSRVTDNHNEKGHDLHGEQIQHGFFAMNGSINHSLAASIASSGNEALSDKSKGLTTSANL 466

Query: 477  IDTRVPVYRRLFTDELSELTDTFNTMTDELDRQYVVLEDRVRARTXXXXXXXXXXXXXXX 536
            I+ RVPVYRR F+DELSELTDTFNTMTD LD+ Y +LEDRVRART               
Sbjct: 467  IEARVPVYRRFFSDELSELTDTFNTMTDALDQHYALLEDRVRARTRQLEAAKIDAEAANE 526

Query: 537  XXTVFIANIFHELRTPLNGILGMTAIAMAEQDQEKIQNSLKLIFRSGXXXXXXXXXXXXF 596
              TVFIANI HELRTPLNGILGMTAI+M E+D +KIQNSLKLIFRSG            F
Sbjct: 527  AKTVFIANISHELRTPLNGILGMTAISMEERDIDKIQNSLKLIFRSGELLLHILTELLTF 586

Query: 597  SKNVLKRTKLEERHFSIIDIALQVKSIFGKLAKDQHVKLSIYLMPNAIRTMVLWGDSNRI 656
            SKNVLKRTKLE+R+FS+ D+ALQ+KSIFGK+AKDQ V+LSI L PN IRTMVL+GDSNRI
Sbjct: 587  SKNVLKRTKLEKRNFSVTDVALQIKSIFGKVAKDQRVRLSITLYPNLIRTMVLFGDSNRI 646

Query: 657  IQIVMNLVSNALKFTPVDGKVDVRIKLVGEYDSARSEACNFSEVYILPGTEVTNS----- 711
            IQIVMNLVSNALKFTPVDGKV+V + L+GEYD+ RSE  N  +VY++PGTE   +     
Sbjct: 647  IQIVMNLVSNALKFTPVDGKVNVYMSLLGEYDAERSENENHKKVYVIPGTEPKGNDEKDK 706

Query: 712  ---------SVNNIPTVVXXXXXX----XXXXPTADDTPERKKKD-----SEXXXXXXXX 753
                     S+ N P                 P  +DT E++  D      E        
Sbjct: 707  GGIEEKERFSIENTPNDTSSNSSNKHSDTETTPGLNDTDEKQASDDMDGGEEDVEDADEV 766

Query: 754  XXXXXXXXXXXXAVLHAQLKKIPTFIDLEDSDNNVTMSKLEKPRSWVIVIEVQDTGPGIE 813
                         V H+Q KK P   D  DS   + +   +K + WVI I V+DTGPGI+
Sbjct: 767  SSFSTSTSSYNDTVFHSQFKKTPKVCD--DSSEELGVEVKDK-KKWVISIVVEDTGPGID 823

Query: 814  PSLHESVFKPFVQGDQTLSRQYGGTGLGLSICRQLATMMKGTMKLESKVGSGSKFTFTVP 873
             SLHESVF+PFVQGDQ LSRQYGGTGLGLSICRQLATMM GTM L+SK+G GS+FTFTVP
Sbjct: 824  SSLHESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTMDLKSKLGVGSRFTFTVP 883

Query: 874  LQQTGTVKFNDGDTLFEDEFNIFSKKNRKVKFQLNRSGKSRKGKMNNSNGAGSIAESAIE 933
            L QT  + F+D    FEDEFN  SKKNRKVKF++ +S KS++ K +     G  + S+ +
Sbjct: 884  LTQTREINFDDIPAAFEDEFNPDSKKNRKVKFKIAKSLKSKRSKSSLMT-VGPKSSSSDK 942

Query: 934  SFGKSESEASFGSVRVDRPFLQSTGTATSTRSVPTLSSAESSLRILVAEDNNVNQEVIKR 993
            S  + +   S  SVR+DRPFLQSTGTA+S  ++ T S+     +ILVAEDN+VNQEVIKR
Sbjct: 943  SLSQLKLTDSDRSVRLDRPFLQSTGTASSNTNLGTTSTIN---KILVAEDNDVNQEVIKR 999

Query: 994  MLHLEGAHNIDLACDGEDAYQKVSALVEQGEHYDLIFMDVQMPRMDGLLTTKLLRQKLHY 1053
            ML+LEG HNI+L CDG++A  KV  LVE GEHY+LIFMDVQMP+MDGLL+TK++R+ L+Y
Sbjct: 1000 MLNLEGVHNIELVCDGQEALDKVKQLVENGEHYNLIFMDVQMPKMDGLLSTKMIRRDLNY 1059

Query: 1054 EYPIVALTAFADDSNIKECLESGMNSFLAKPIKRPMLKKILLE 1096
             +PIVALTAFADDSNI+ECL++GM+ FLAKPIKR  L+KI+ E
Sbjct: 1060 THPIVALTAFADDSNIRECLDAGMDGFLAKPIKRAQLRKIIEE 1102

>Kpol_2001.74 s2001 (202108..205449) [3342 bp, 1113 aa] {ON}
            (202108..205449) [3342 nt, 1114 aa]
          Length = 1113

 Score =  969 bits (2506), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 545/1127 (48%), Positives = 710/1127 (62%), Gaps = 72/1127 (6%)

Query: 13   LKPPFKAGLRTQLTXXXXXXXXXXXXXXXXTTGVYFTSNYRTLRADRLHVAARLMSSQVD 72
             KPP++  +R QLT                TTGVYFT NY+ LR+ RL++AA+L SSQ+D
Sbjct: 9    FKPPYRITIRAQLTALVSLVAIISLIILAVTTGVYFTENYKELRSGRLNIAAKLKSSQID 68

Query: 73   QSLTLLYYQCNMLSTKDTIQNALSDYRAGNRSAENWIEADKILGGFLERSKTFYIAYLYD 132
            Q+L  L+YQC  L+++DT+QNAL +Y AGN++ ENWIE++ ++  FL  S  FY+A LYD
Sbjct: 69   QTLNYLFYQCRYLTSRDTLQNALINYEAGNKTYENWIESENVVQKFLSSSDLFYVARLYD 128

Query: 133  EMYQEVLSRWNNDTEGSLAEESLVRLRPLEMDKYEYNEALDVQVETLP-YNKTLNLMSMT 191
              +++V++  NN T   +  E L  L PL  ++   +   +  + T P  N ++ LMSM+
Sbjct: 129  LNFKQVVNATNNGTGDLIPNEVLSELFPLSTNQSLPSSLNNDGILTDPVLNGSIYLMSMS 188

Query: 192  LPV--EASTIIGRGNVVGFLTIVMSADPITAV--NDTSVLGESMVSILTGIPNDKGNLVK 247
            LP+    S I+    V G++TIVMSAD +  V  N+T+ L  S V++++ I ND+G +  
Sbjct: 189  LPILTNPSIILSSSRVYGYITIVMSADGLKNVYLNNTA-LENSNVTVISAIYNDQGKVDG 247

Query: 248  YRFVFPPGETDRSVTETEYPIKNASFLRDAFLNRSDNYVTSTSSFYHFGALGHDFKKVAV 307
            + FVF   E D   T  EYPI+N ++L  A +      +  T   Y F       +++A+
Sbjct: 248  FHFVFEV-ENDDFSTLIEYPIQNGTYLSSALVEGKSGSIKKTK--YPFN------RELAI 298

Query: 308  GYSACKFRQLDWVAVVSQDESVFLSPAFKLTKIIIGTVLGVAVFMCIVTFILASWAVKPI 367
            GYS C F   +WVA+V+Q E+VFLSP+ KL KII GTV+ +AVF+C++TF L+ WAVKPI
Sbjct: 299  GYSPCSFSLSNWVALVTQPEAVFLSPSTKLEKIISGTVVAIAVFVCLITFPLSHWAVKPI 358

Query: 368  VRLQKATEFIAAGRGLRTYNHSGRSSSQNTSIDRSNSRGSDHSLPRELFEKKHHVSPFVT 427
            VRLQKATE I+ GRGL+  ++     S +TS    N R S  S         H  +    
Sbjct: 359  VRLQKATELISQGRGLKPTSNFSNGDSSSTS---DNWRESVES---------HVRASLGI 406

Query: 428  ENHAANSGSCSSMSDHERYLHHIARYHDGETSTNILSDHEKGST-----SATNWIDTRVP 482
                 N+GS    S+ +    +     +  T  NI S     S+     + +N +  RVP
Sbjct: 407  FKSLRNNGSNELQSNDDMNEINERSSKNNSTGDNIKSSDNDSSSSFQRYTTSNLVQARVP 466

Query: 483  VYRRLFTDELSELTDTFNTMTDELDRQYVVLEDRVRARTXXXXXXXXXXXXXXXXXTVFI 542
            VY R   DELSELTDTFN MT+ LD+ Y +LEDRVRART                 TVFI
Sbjct: 467  VYGRFLQDELSELTDTFNAMTNALDQHYTLLEDRVRARTKQLEAAKIEAEAANEAKTVFI 526

Query: 543  ANIFHELRTPLNGILGMTAIAMAEQDQEKIQNSLKLIFRSGXXXXXXXXXXXXFSKNVLK 602
            ANI HELRTPLNGILGMTAI+M E D +KI+ +LKLIFRSG            FSKNVLK
Sbjct: 527  ANISHELRTPLNGILGMTAISMEEDDSDKIKENLKLIFRSGELLLHILTELLTFSKNVLK 586

Query: 603  RTKLEERHFSIIDIALQVKSIFGKLAKDQHVKLSIYLMPNAIRTMVLWGDSNRIIQIVMN 662
            RT LE+R F I +IALQ+KSIFGK+A+DQHVKL I LMPN IR+MVLWGDSNRIIQIVMN
Sbjct: 587  RTNLEKRDFCITEIALQIKSIFGKVARDQHVKLLIILMPNRIRSMVLWGDSNRIIQIVMN 646

Query: 663  LVSNALKFTPVDGKVDVRIKLVGEYDSARSEACNFSEVYILPGTEVTNSSVNNIPTVVXX 722
            LVSNALKFTP+DGKVDVRIKL+GEYD  RS   ++ EVYI  GTE+   +      V   
Sbjct: 647  LVSNALKFTPIDGKVDVRIKLLGEYDEERSMNDDYKEVYIKSGTELPIGNGKKTDMVRKK 706

Query: 723  XXXXXXXXPTADDTP----------------ERKKKDS-----EXXXXXXXXXXXXXXXX 761
                        DT                 E ++K+S     +                
Sbjct: 707  IQELSEKDCIEGDTASSGSHMSGSSKIDKLIEDEEKNSFSDNEDTNNDIEILSMTTSSTR 766

Query: 762  XXXXAVLHAQLKKIPTFIDLEDSDNNVTMSKLEKPRSWVIVIEVQDTGPGIEPSLHESVF 821
                A L  Q KK P   DL+D +  + + +L +P++WVI +EV+DTGPGIEP L E+VF
Sbjct: 767  SYDDAALQRQFKKTP---DLDDKEETLGV-ELSEPKTWVISVEVEDTGPGIEPKLQEAVF 822

Query: 822  KPFVQGDQTLSRQYGGTGLGLSICRQLATMMKGTMKLESKVGSGSKFTFTVPLQQTGTVK 881
            +PFVQGDQ LSRQYGGTGLGLSICRQLATMM GTMKLES VG GSKF FTVPL+QT  + 
Sbjct: 823  EPFVQGDQALSRQYGGTGLGLSICRQLATMMHGTMKLESTVGVGSKFIFTVPLKQTREIH 882

Query: 882  FNDGDTLFEDEFNIFSKKNRKVKFQLNRSGKSRKGKMNNSNGAGSIAESAIESFGKSESE 941
            F+D    FEDEFN  SKKNR++KF++  S KS     N+ +  G  +   I+S      +
Sbjct: 883  FDDEK--FEDEFNAESKKNRRIKFKIYDSSKSHDS--NDEDEEGIKSSRDIDSSNNEHKD 938

Query: 942  ASFGS------VRVDRPFLQSTGTATSTRSVPTL-----SSAESSLRILVAEDNNVNQEV 990
             +  S      VR+DRPFLQSTGTATS++ +PTL     ++ E S+RILVAEDN+VNQEV
Sbjct: 939  ENGTSPDNHSKVRLDRPFLQSTGTATSSQKIPTLINKEDTNIEKSIRILVAEDNHVNQEV 998

Query: 991  IKRMLHLEGAHNIDLACDGEDAYQKVSALVEQGEHYDLIFMDVQMPRMDGLLTTKLLRQK 1050
            IKRML+LE   NIDLACDG+DA+ KV +L +  E+YD+IFMDVQMP++DGL++TK++R+ 
Sbjct: 999  IKRMLNLEKIDNIDLACDGQDAFDKVKSLADNEEYYDIIFMDVQMPKVDGLVSTKMIRKD 1058

Query: 1051 LHYEYPIVALTAFADDSNIKECLESGMNSFLAKPIKRPMLKKILLEH 1097
            L+Y++PIVALTAFA+D NIKECL++GM+ FL KPIKRP LK+IL E+
Sbjct: 1059 LNYKHPIVALTAFANDDNIKECLDAGMDGFLGKPIKRPKLKQILQEY 1105

>CAGL0H06567g Chr8 (645707..649216) [3510 bp, 1169 aa] {ON} similar to
            uniprot|P39928 Saccharomyces cerevisiae YIL147c SLN1
          Length = 1169

 Score =  967 bits (2501), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 564/1159 (48%), Positives = 727/1159 (62%), Gaps = 95/1159 (8%)

Query: 8    KRLAVLKPPFKAGLRTQLTXXXXXXXXXXXXXXXXTTGVYFTSNYRTLRADRLHVAARLM 67
            +R   LKPPF+ G+R QLT                TTGVYFTSNY+ LR+DRL++AA+L 
Sbjct: 9    RRRRFLKPPFRIGIRAQLTALVSIVACLSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLK 68

Query: 68   SSQVDQSLTLLYYQCNMLSTKDTIQNALSDYRAGNRSAENWIEADKILGGFLERSKTFYI 127
            SSQ+DQ+L  LYYQC  L+++DT+QNAL+ Y AGN++ ENW E+  ++  FL  S  F++
Sbjct: 69   SSQLDQNLNYLYYQCYWLASRDTLQNALASYVAGNKTEENWEESTNVIQKFLSSSNLFFL 128

Query: 128  AYLYDEMYQEVLSRWNNDTEGSLAEESLVRLRPLEMDKYEYNEALDVQVETLP-YNKTLN 186
            + +YD  ++ VL+  NN T   + E    +L PL  D    +  +   + T P  N T  
Sbjct: 129  SRVYDYDFKPVLNTTNNGTGDEVPESIQNQLFPLSTDVPLPSSLMTNGMLTDPVLNGTDY 188

Query: 187  LMSMTLPVEA--STIIGRGNVVGFLTIVMSADPITAV-NDTSVLGESMVSILTGIPNDKG 243
            LMSM+LP+ A  S I     V G++T+VMSA+ + +V NDT+ L +S V+I++   ++  
Sbjct: 189  LMSMSLPIFANPSIIFSDLKVYGYITVVMSAEGLRSVFNDTTALEKSNVAIVSARYSNYT 248

Query: 244  NLVKYRFVFPPGETDRSVTETEYPIKNASFLRDAFLNRSDNYVTSTSSFYHFGALGHDFK 303
             +  YRFVFPP     S+    + + ++SFL  AF       +  T  FY         K
Sbjct: 249  KIDSYRFVFPPYGVSPSILNRTFELDDSSFLNGAFKQAKGGSIKKTKFFYT--------K 300

Query: 304  KVAVGYSACKFRQLDWVAVVSQDESVFLSPAFKLTKIIIGTVLGVAVFMCIVTFILASWA 363
             VA+GY  C F  ++WVAVVSQ ESVFLSP+ KLTKII GTV+G+AVF+ ++TF LASWA
Sbjct: 301  DVAIGYYPCSFNFVNWVAVVSQAESVFLSPSTKLTKIISGTVVGIAVFVSLLTFPLASWA 360

Query: 364  VKPIVRLQKATEFIAAGRGLRTYNHSGRSSSQNTSIDRSNSRGSDHSLPRELFEKKHHVS 423
            VKPIVRLQKATE IA GRGLR       S S + +          + + R    +K+H  
Sbjct: 361  VKPIVRLQKATELIAEGRGLRPAGAGSGSRSGSRTSSMKKDINDLNFISRLSLSEKNHRP 420

Query: 424  PF--VTENHAANSGSCSSMSDHERYLHHIARYHDGETS--TNILSDHEKGS------TSA 473
             +   ++++ A  GS S               HD +TS  +N  SD+++ S      T++
Sbjct: 421  AYDSASDSNYATDGSLS---------------HDLQTSQASNRPSDNDRSSSRSRFLTTS 465

Query: 474  TNWIDTRVPVYRRLFTDELSELTDTFNTMTDELDRQYVVLEDRVRARTXXXXXXXXXXXX 533
            TN  + R+P YRRLF+DELS+LT+TFN MTD LD+ Y +LEDRVRART            
Sbjct: 466  TNLNEARLPDYRRLFSDELSDLTNTFNAMTDALDQHYALLEDRVRARTKQLEAAKIQAEA 525

Query: 534  XXXXXTVFIANIFHELRTPLNGILGMTAIAMAEQDQEKIQNSLKLIFRSGXXXXXXXXXX 593
                 TVFIANI HELRTPLNGILGMTAI+M E D  KI+NSLKLIFRSG          
Sbjct: 526  ANEAKTVFIANISHELRTPLNGILGMTAISMEETDIAKIRNSLKLIFRSGELLLHILTEL 585

Query: 594  XXFSKNVLKRTKLEERHFSIIDIALQVKSIFGKLAKDQHVKLSIYLMPNAIRTMVLWGDS 653
              FSKNVLKRT LE+R+F I D+ALQ+KSIFGK+AKDQHV+LSI L PN IRTMVLWGDS
Sbjct: 586  LTFSKNVLKRTALEKRNFCITDVALQIKSIFGKVAKDQHVRLSISLTPNVIRTMVLWGDS 645

Query: 654  NRIIQIVMNLVSNALKFTPVDGKVDVRIKLVGEYDSARSEACNFSEVYILPGTEV----- 708
            NRIIQIVMNLVSNALKFTPVDGKV+VRIKL+GEYD   ++A NF +++ +  ++      
Sbjct: 646  NRIIQIVMNLVSNALKFTPVDGKVNVRIKLLGEYDEEATKADNFKQIHTIADSDAHQQHP 705

Query: 709  TNSSVNNI---------PTVVXXXXXXXXXXPTADDTPERKKKDSEXXXXXXXXXXXXXX 759
             +SS N +          +             T D+  +     +               
Sbjct: 706  VSSSPNGVLVKHLSTSSDSNSNLSDSDKYNEKTYDEDDDEHSITNISDHSDDLSSLVSSS 765

Query: 760  XXXXXXAVLHAQLKKIPTFIDLEDSDNNVTMSKLEKPRSWVIVIEVQDTGPGIEPSLHES 819
                  A+ + Q KK P   DL +  N+   ++L   ++WV  IEV+DTGPGI+P LHES
Sbjct: 766  TSSYDNALFNTQFKKTP---DLYEDSNDGLGTELADQKTWVFAIEVEDTGPGIDPKLHES 822

Query: 820  VFKPFVQGDQTLSRQYGGTGLGLSICRQLATMMKGTMKLESKVGSGSKFTFTVPLQQTGT 879
            VF+PFVQGDQTLSRQYGGTGLGLSICRQLATMM GTMKLESKVG GSKFTFTVPL+QT  
Sbjct: 823  VFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMHGTMKLESKVGVGSKFTFTVPLKQTRV 882

Query: 880  VKFNDGDTLFEDEFNIFSKKNRKVKFQ-LNRSGKSRKG-----KMNNSNGAGSIAESAIE 933
            +KF++ + LFEDEFN  SKKNR+VKF+   RS  SR+      ++ N +G    +E    
Sbjct: 883  IKFDEEEDLFEDEFNPESKKNRRVKFKDSTRSLHSRRSRTSVDRITNHSGDKQSSEGHST 942

Query: 934  SFGKSESE-------------ASFGS----------------------VRVDRPFLQSTG 958
            SF  SE +                G                       V +DRPFLQSTG
Sbjct: 943  SFKISEVKDEDIEQSPEPDNLPKVGDENDSKASSSSSKSDNIKEKEEKVHLDRPFLQSTG 1002

Query: 959  TATSTRSVPTLSSAESSLRILVAEDNNVNQEVIKRMLHLEGAHNIDLACDGEDAYQKVSA 1018
            TATS+R+VPT++      +ILVAEDN+VNQEVIKRML+LEG +NIDLACDG+DA+ KV +
Sbjct: 1003 TATSSRNVPTMADVTMRFKILVAEDNHVNQEVIKRMLNLEGINNIDLACDGQDAFDKVQS 1062

Query: 1019 LVEQGEHYDLIFMDVQMPRMDGLLTTKLLRQKLHYEYPIVALTAFADDSNIKECLESGMN 1078
            LVEQ + YD+IFMD+QMP++DGLL+TK++R+ L+Y+  IVALTAFADDSNIKEC+E+GMN
Sbjct: 1063 LVEQNDSYDMIFMDIQMPKVDGLLSTKMIRRDLNYKGSIVALTAFADDSNIKECIEAGMN 1122

Query: 1079 SFLAKPIKRPMLKKILLEH 1097
             FL+KPIKRP LK IL E+
Sbjct: 1123 GFLSKPIKRPKLKMILEEY 1141

>Smik_9.22 Chr9 complement(47449..51141) [3693 bp, 1230 aa] {ON}
            YIL147C (REAL)
          Length = 1230

 Score =  967 bits (2499), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 566/1220 (46%), Positives = 726/1220 (59%), Gaps = 161/1220 (13%)

Query: 15   PPFKAGLRTQLTXXXXXXXXXXXXXXXXTTGVYFTSNYRTLRADRLHVAARLMSSQVDQS 74
            PPF+ G+R QLT                TTGVYFTSNY+ LR+DRL++AA+L SSQ+DQ+
Sbjct: 13   PPFRIGIRAQLTALVSIVALVSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQIDQT 72

Query: 75   LTLLYYQCNMLSTKDTIQNALSDYRAGNRSAENWIEADKILGGFLERSKTFYIAYLYDEM 134
            L  LYYQ   L+++D +Q++L+ + AGN+SA+NW+++  ++  FL  S  FY+A +YD  
Sbjct: 73   LNYLYYQAYYLASRDALQSSLTSFVAGNKSADNWVDSLSVVQKFLSSSNLFYVAKVYDSS 132

Query: 135  YQEVLSRWNNDTEGSLAEESLVRLRPLEMDKYEYNEALDVQVETLPY-NKTLNLMSMTLP 193
            +  VL+  NN T   + E+ L  L PL  D    +      + T P  N T  LMSM+LP
Sbjct: 133  FTTVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETTGILTDPVVNNTDYLMSMSLP 192

Query: 194  VEA--STIIGRGNVVGFLTIVMSADPITAV-NDTSVLGESMVSILTGIPNDKGNLVKYRF 250
            + A  S I+    V G++TI+MSA+ + +V NDT+ L +S V+I++ + N++G    Y F
Sbjct: 193  IFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISALYNNQGKASGYHF 252

Query: 251  VFPPGETDRSVTETEYPIKNASFLRDAFLNRSDNYVTSTSSFYHFGALGHDFKKVAVGYS 310
            +FPP  T  ++T++ + IKN +F+  AF N     +  T+SF          K +A+GYS
Sbjct: 253  IFPPYGTASTLTQSVFSIKNNTFISSAFRNGKGGSLKQTNSF--------GIKNLALGYS 304

Query: 311  ACKFRQLDWVAVVSQDESVFLSPAFKLTKIIIGTVLGVAVFMCIVTFILASWAVKPIVRL 370
             C F+ ++WVAVVSQ ESVFLSPA KL KII GTV+ + VF+ ++T  LA WAV+PIVRL
Sbjct: 305  PCSFQLVNWVAVVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIVRL 364

Query: 371  QKATEFIAAGRGLRTYNHSGRSSSQNTSIDRSNSRGSDHSLPRELFE------------- 417
            QKATE I  GRGLR    + R+ S+ +S  R    GS  ++P  L +             
Sbjct: 365  QKATELITEGRGLRP--STPRTVSRASSFKRG--FGSGFTVPSSLLQFNTGESGSTISAS 420

Query: 418  -------------------------KKHHVSPFVTENHAANSGSCSSMS-----DHERYL 447
                                         + P   E    N+ + + +S     +H+   
Sbjct: 421  GHGGSGHGSGAAFSTESSMKSAINLGNEKLLPSEDEKKIPNNNTDAKVSMDGSLNHDLLA 480

Query: 448  HHIARYHDGETSTN---ILSDHEKGSTSATNWIDTRVPVYRRLFTDELSELTDTFNTMTD 504
             +  R +D + S+N   IL       T++ N  + R+P YRRLF+DELS+LT+TFNTMTD
Sbjct: 481  PNSLRNNDTDRSSNRSHIL-------TTSANLTEARLPDYRRLFSDELSDLTETFNTMTD 533

Query: 505  ELDRQYVVLEDRVRARTXXXXXXXXXXXXXXXXXTVFIANIFHELRTPLNGILGMTAIAM 564
             LD+ Y +LEDRVRART                 TVFIANI HELRTPLNGILGMTAI+M
Sbjct: 534  ALDQHYALLEDRVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISM 593

Query: 565  AEQDQEKIQNSLKLIFRSGXXXXXXXXXXXXFSKNVLKRTKLEERHFSIIDIALQVKSIF 624
             E D  KI+NSLKLIFRSG            FSKNVL+RTKLE+R F I D+ALQ+KSIF
Sbjct: 594  EETDVNKIRNSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFCITDVALQIKSIF 653

Query: 625  GKLAKDQHVKLSIYLMPNAIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGKVDVRIKLV 684
            GK+AKDQ V+LSI L PN IRTMVLWGDSNRIIQIVMNLVSNALKFTPVDG VDVR+KL+
Sbjct: 654  GKVAKDQRVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLL 713

Query: 685  GEYDSARSEACNFSEVYILPGTEVTNSSVN----NIPTVVXXXXXXXXXXPTADDTPER- 739
            GEYD   SE   F EV++  GTE+T  S      +IP              T   T  R 
Sbjct: 714  GEYDKDLSEKKQFKEVHVKRGTEITEYSEETNKCDIPISSNHRKHVDLESTTTSITSNRD 773

Query: 740  ---------------------KKKDSEXXXXXXXXXXXXXXXXXXXXAVLHAQLKKIPTF 778
                                 +  D+E                    A+ ++Q  K P  
Sbjct: 774  TSIIQEEITKRNTAANENIYKRMNDAEKLSSDDVSSIVSTTTSSYDDAIFNSQFNKAPG- 832

Query: 779  IDLEDSDNNVTMSK-LEKPRSWVIVIEVQDTGPGIEPSLHESVFKPFVQGDQTLSRQYGG 837
                D D    + K +E P++WVI IEV+DTGPGI+PSL ESVF PFVQGDQTLSRQYGG
Sbjct: 833  ---SDEDEGGNLGKPIENPKTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGG 889

Query: 838  TGLGLSICRQLATMMKGTMKLESKVGSGSKFTFTVPLQQTGTVKFNDGDTLFEDEFNIFS 897
            TGLGLSICRQLA MM GTM+LESKVG GSKFTFT+PL QT  + F + D  FEDEFN  S
Sbjct: 890  TGLGLSICRQLANMMNGTMRLESKVGVGSKFTFTLPLPQTKEISFANMDFPFEDEFNPES 949

Query: 898  KKNRKVKFQLNRSGKSRKG-------------------------------KMNNS----- 921
            +KNR+VKF + +S KSR+                                +  NS     
Sbjct: 950  RKNRRVKFNVAKSIKSRQSTSSIATPATNRSSLINDVLPEIGSKNENQIKRFENSNMKRE 1009

Query: 922  --NGAGSIAESAIE-------SFGKSES-------------EASFGSVRVDRPFLQSTGT 959
              NG G I +   E        F  +ES             E S GSV +DRPFLQSTGT
Sbjct: 1010 GVNGIGRIEQKLQEKNVKPFICFSSAESSEKKTVPPKHRSREESLGSVNLDRPFLQSTGT 1069

Query: 960  ATSTRSVPTLS---SAESSLRILVAEDNNVNQEVIKRMLHLEGAHNIDLACDGEDAYQKV 1016
            ATS+R+VPT+      ++S++ILV EDN+VNQEVIKRML+LEG  NI+LACDG++A+ KV
Sbjct: 1070 ATSSRNVPTIQDNDKNDTSIKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKV 1129

Query: 1017 SALVEQGEHYDLIFMDVQMPRMDGLLTTKLLRQKLHYEYPIVALTAFADDSNIKECLESG 1076
              L  +G +Y++IFMDVQMP++DGLL+TK++R+ L Y+ PIVALTAFADDSNIKECLESG
Sbjct: 1130 KELTSKGGNYNMIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESG 1189

Query: 1077 MNSFLAKPIKRPMLKKILLE 1096
            MN FL+KPIKRP LK IL E
Sbjct: 1190 MNGFLSKPIKRPKLKTILTE 1209

>TDEL0B02210 Chr2 complement(396111..399398) [3288 bp, 1095 aa] {ON}
            Anc_5.700 YIL147C
          Length = 1095

 Score =  965 bits (2494), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 557/1129 (49%), Positives = 714/1129 (63%), Gaps = 77/1129 (6%)

Query: 1    MRLGYLRKRLAVLKPPFKAGLRTQLTXXXXXXXXXXXXXXXXTTGVYFTSNYRTLRADRL 60
            MRLG + K      PPF+  +RTQLT                TTGVYFTSNY++LR++RL
Sbjct: 1    MRLGTIAKE--KFSPPFRISIRTQLTALVSLVALVSLIILAVTTGVYFTSNYKSLRSERL 58

Query: 61   HVAARLMSSQVDQSLTLLYYQCNMLSTKDTIQNALSDYRAGNRSAENWIEADKILGGFLE 120
            +VAA+L SSQ+DQ+L  LYYQC  LS++ T+Q +L++Y +GN++  NW+++  +L  FL 
Sbjct: 59   YVAAQLKSSQIDQNLNYLYYQCYWLSSQSTLQTSLANYVSGNKTDANWVDSSSVLQKFLS 118

Query: 121  RSKTFYIAYLYDEMYQEVLSRWNNDTEGSLAEESLVRLRPLEMDKYEYNEALDVQVE--- 177
             S  F +A +YD  +Q VL+  NN T   L ++ L +L PL       N AL   +E   
Sbjct: 119  SSALFSVARVYDADFQTVLNATNNGTGDVLGDDVLAKLMPLSS-----NMALPASLESEG 173

Query: 178  --TLP-YNKTLNLMSMTLPVEA--STIIGRGNVVGFLTIVMSADPITAV-NDTSVLGESM 231
              T P  N T  LMSM+LP+ A  S I+    V G++TI+MSAD + +V +D + L +S 
Sbjct: 174  MLTDPVLNGTSYLMSMSLPIYANPSIILTESRVYGYVTIIMSADSLKSVYDDRTALEKSS 233

Query: 232  VSILTGIPNDKGNLVKYRFVFPPGETDRSVTETEYPIKNASFLRDAFLNRSDNYVTSTSS 291
            V+I++ I      L  YRFVF P  T   + +  +PI N SFL  A           T  
Sbjct: 234  VTIVSAIYKKDQGLGSYRFVFAPYGTTPGILDETWPINNNSFLSAALRQGKAGSEQRTDL 293

Query: 292  FYHFGALGHDFKKVAVGYSACKFRQLDWVAVVSQDESVFLSPAFKLTKIIIGTVLGVAVF 351
            FY+        +  AVGYS C F+ ++WVA++SQ E+VF+ P+ +LTKIIIG V+G+  F
Sbjct: 294  FYN--------RPSAVGYSPCSFKFVNWVAIISQSEAVFMEPSTRLTKIIIGVVVGIGAF 345

Query: 352  MCIVTFILASWAVKPIVRLQKATEFIAAGRGLRTYNHSGRSSSQNTSIDRSNSRGSDHSL 411
            +CI TF LA WAV+PIVRLQKATE I  GRGLR+      S S+N+S  R    GS    
Sbjct: 346  VCIATFPLAHWAVQPIVRLQKATEIITEGRGLRSGTPGSSSVSRNSSFIRRRFSGSSSVR 405

Query: 412  PRELFEKKHHVSPFVTENHAANSGSCSSMSDHERYLHHIARYHDGETSTNILSDHEKGST 471
               L ++K  V    TE       +  S++                ++  I SD  +   
Sbjct: 406  SPSLADEKGAVGRASTEGSFNYDQAVPSLN----------------SNAEISSDRTRKYM 449

Query: 472  SATNWIDTRVPVYRRLFTDELSELTDTFNTMTDELDRQYVVLEDRVRARTXXXXXXXXXX 531
            +++N ++ RVPVYR  F+DE SELTDTFNTMT+ LD+ Y +LEDRVRART          
Sbjct: 450  TSSNLVEARVPVYRIFFSDEFSELTDTFNTMTNALDQHYALLEDRVRARTKQLEAAKVEA 509

Query: 532  XXXXXXXTVFIANIFHELRTPLNGILGMTAIAMAEQDQEKIQNSLKLIFRSGXXXXXXXX 591
                   TVFIANI HELRTPLNGILGMTAI+M E+D +KIQ+SLKLIFRSG        
Sbjct: 510  EAANEAKTVFIANISHELRTPLNGILGMTAISMEERDIDKIQSSLKLIFRSGELLLHILT 569

Query: 592  XXXXFSKNVLKRTKLEERHFSIIDIALQVKSIFGKLAKDQHVKLSIYLMPNAIRTMVLWG 651
                FSKNVL+RTKLE+R FSI D+A+Q+KSIFGK+AKDQ VK SI L PN IR MVL+G
Sbjct: 570  ELLTFSKNVLQRTKLEKRDFSITDVAVQIKSIFGKVAKDQRVKFSITLFPNQIRKMVLYG 629

Query: 652  DSNRIIQIVMNLVSNALKFTPVDGKVDVRIKLVGEYDSARSEACNFSEVYILPGTEVTNS 711
            DSNRIIQIVMNLVSNALKFTPVDGKV VR++L+GEYD  RSE  +F  VY++ GTE    
Sbjct: 630  DSNRIIQIVMNLVSNALKFTPVDGKVSVRMRLLGEYDKQRSENEDFKAVYVIDGTEPRED 689

Query: 712  SVNNIPTVVX---------------------XXXXXXXXXPTADDTPERKKKDSEXXXXX 750
             +  IP  V                                  D TP+ K+ D++     
Sbjct: 690  GL--IPPPVKQFEKQEDLEKEKISEKHNEEEASTSDSEKTNLDDKTPDSKRSDAD----- 742

Query: 751  XXXXXXXXXXXXXXXAVLHAQLKKIPTFIDLEDSDNNVTMSKLEKPRSWVIVIEVQDTGP 810
                            + H Q KK  +       D N  +  LE P++W I +EV+DTGP
Sbjct: 743  DQVSLISISTSSYDDTIFHTQFKKHTS----SSGDENGHL--LEHPKNWAISVEVEDTGP 796

Query: 811  GIEPSLHESVFKPFVQGDQTLSRQYGGTGLGLSICRQLATMMKGTMKLESKVGSGSKFTF 870
            GI+PSLHESVF+PFVQGDQ LSRQYGGTGLGLSICRQLATMM GTMKL+SK+G GSKFTF
Sbjct: 797  GIDPSLHESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTMKLDSKLGVGSKFTF 856

Query: 871  TVPLQQTGTVKFNDGDTLFEDEFNIFSKKNRKVKFQL--NRSGKSRKGKMNNSNGAGSIA 928
            T+PL QT  ++F D +  FEDEFN  SKKNRKVKF++  +   +  K  ++NS+G G  +
Sbjct: 857  TLPLTQTREIEFED-ENAFEDEFNPLSKKNRKVKFKVAKSIKSRKSKSSLSNSSGKGGSS 915

Query: 929  ESAIESFGKSESEASFGSVRVDRPFLQSTGTATSTRSVPTLSSAESSLRILVAEDNNVNQ 988
            + + +    SESE S G+V +DRPFLQSTGTA+S+++V  +S+   S RILVAEDN+VNQ
Sbjct: 916  DKSSKQLKGSESEFSVGNVSLDRPFLQSTGTASSSKNVTVVSNVNKSYRILVAEDNHVNQ 975

Query: 989  EVIKRMLHLEGAHNIDLACDGEDAYQKVSALVEQGEHYDLIFMDVQMPRMDGLLTTKLLR 1048
            EVIKRML LEG   IDLA DG+DA+ KV AL E+GEHY+LIFMDVQMP++DGLL TK++R
Sbjct: 976  EVIKRMLTLEGIDRIDLAADGQDAFDKVKALQEKGEHYELIFMDVQMPKVDGLLATKMIR 1035

Query: 1049 QKLHYEYPIVALTAFADDSNIKECLESGMNSFLAKPIKRPMLKKILLEH 1097
            + L Y+YPIVALTAFADDSNI+ CLE+GMN FL+KPIKRP LK I+ ++
Sbjct: 1036 KDLDYQYPIVALTAFADDSNIRVCLEAGMNGFLSKPIKRPKLKTIIAQY 1084

>YIL147C Chr9 complement(69791..73453) [3663 bp, 1220 aa] {ON}
            SLN1Histidine kinase osmosensor that regulates a MAP
            kinase cascade; transmembrane protein with an
            intracellular kinase domain that signals to Ypd1p and
            Ssk1p, thereby forming a phosphorelay system similar to
            bacterial two-component regulators
          Length = 1220

 Score =  964 bits (2493), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 569/1233 (46%), Positives = 730/1233 (59%), Gaps = 162/1233 (13%)

Query: 1    MRLGYLRKRLAVLKPPFKAGLRTQLTXXXXXXXXXXXXXXXXTTGVYFTSNYRTLRADRL 60
            MR G L  +L  L PPF+ G+RTQLT                TTGVYFTSNY+ LR+DRL
Sbjct: 1    MRFG-LPSKLE-LTPPFRIGIRTQLTALVSIVALGSLIILAVTTGVYFTSNYKNLRSDRL 58

Query: 61   HVAARLMSSQVDQSLTLLYYQCNMLSTKDTIQNALSDYRAGNRSAENWIEADKILGGFLE 120
            ++AA+L SSQ+DQ+L  LYYQ   L+++D +Q++L+ Y AGN+SA+NW+++  ++  FL 
Sbjct: 59   YIAAQLKSSQIDQTLNYLYYQAYYLASRDALQSSLTSYVAGNKSADNWVDSLSVIQKFLS 118

Query: 121  RSKTFYIAYLYDEMYQEVLSRWNNDTEGSLAEESLVRLRPLEMDKYEYNEALDVQVETLP 180
             S  FY+A +YD  +  VL+  NN T   + E+ L  L PL  D    +    + + T P
Sbjct: 119  SSNLFYVAKVYDSSFNAVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETIGILTDP 178

Query: 181  -YNKTLNLMSMTLPVEA--STIIGRGNVVGFLTIVMSADPITAV-NDTSVLGESMVSILT 236
              N T  LMSM+LP+ A  S I+    V G++TI+MSA+ + +V NDT+ L  S ++I++
Sbjct: 179  VLNSTDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEHSTIAIIS 238

Query: 237  GIPNDKGNLVKYRFVFPPGETDRSVTETEYPIKNASFLRDAFLNRSDNYVTSTSSFYHFG 296
             + N +G    Y FVFPP  +   + +  + IKN +F+  AF N     +  T+      
Sbjct: 239  AVYNSQGKASGYHFVFPPYGSRSDLPQKVFSIKNDTFISSAFRNGKGGSLKQTNIL---- 294

Query: 297  ALGHDFKKVAVGYSACKFRQLDWVAVVSQDESVFLSPAFKLTKIIIGTVLGVAVFMCIVT 356
                  +  A+GYS C F  ++WVA+VSQ ESVFLSPA KL KII GTV+ + VF+ ++T
Sbjct: 295  ----STRNTALGYSPCSFNLVNWVAIVSQPESVFLSPATKLAKIITGTVIAIGVFVILLT 350

Query: 357  FILASWAVKPIVRLQKATEFIAAGRGLRTYNHSGRSSSQNTSIDRSNSRGSDHSLPRELF 416
              LA WAV+PIVRLQKATE I  GRGLR    + R+ S+ +S  R  S G   ++P  L 
Sbjct: 351  LPLAHWAVQPIVRLQKATELITEGRGLRP--STPRTISRASSFKRGFSSG--FAVPSSLL 406

Query: 417  E--------------------------------------KKHHVSPFVTENHAANSGSCS 438
            +                                          +SP   EN   N+ + +
Sbjct: 407  QFNTAEAGSTTSVSGHGGSGHGSGAAFSANSSMKSAINLGNEKMSPPEEENKIPNNHTDA 466

Query: 439  SMS-----DHERYLHHIARYHDGETSTN---ILSDHEKGSTSATNWIDTRVPVYRRLFTD 490
             +S     +H+    H  R++D + S+N   IL       T++ N  + R+P YRRLF+D
Sbjct: 467  KISMDGSLNHDLLGPHSLRHNDTDRSSNRSHIL-------TTSANLTEARLPDYRRLFSD 519

Query: 491  ELSELTDTFNTMTDELDRQYVVLEDRVRARTXXXXXXXXXXXXXXXXXTVFIANIFHELR 550
            ELS+LT+TFNTMTD LD+ Y +LE+RVRART                 TVFIANI HELR
Sbjct: 520  ELSDLTETFNTMTDALDQHYALLEERVRARTKQLEAAKIEAEAANEAKTVFIANISHELR 579

Query: 551  TPLNGILGMTAIAMAEQDQEKIQNSLKLIFRSGXXXXXXXXXXXXFSKNVLKRTKLEERH 610
            TPLNGILGMTAI+M E D  KI+NSLKLIFRSG            FSKNVL+RTKLE+R 
Sbjct: 580  TPLNGILGMTAISMEETDVNKIRNSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRD 639

Query: 611  FSIIDIALQVKSIFGKLAKDQHVKLSIYLMPNAIRTMVLWGDSNRIIQIVMNLVSNALKF 670
            F I D+ALQ+KSIFGK+AKDQ V+LSI L PN IRTMVLWGDSNRIIQIVMNLVSNALKF
Sbjct: 640  FCITDVALQIKSIFGKVAKDQRVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKF 699

Query: 671  TPVDGKVDVRIKLVGEYDSARSEACNFSEVYILPGTEVT----NSSVNNIPTV------- 719
            TPVDG VDVR+KL+GEYD   SE   + EVYI  GTEVT     +   ++PT+       
Sbjct: 700  TPVDGTVDVRMKLLGEYDKELSEKKQYKEVYIKKGTEVTENLETTDKYDLPTLSNHRKSV 759

Query: 720  ---------------VXXXXXXXXXXPTADDTPERKKKDSEXXXXXXXXXXXXXXXXXXX 764
                                        A+++  +K  D E                   
Sbjct: 760  DLESSATSLGSNRDTSTIQEEITKRNTVANESIYKKVNDREKASNDDVSSIVSTTTSSYD 819

Query: 765  XAVLHAQLKKIPTFIDLEDSDNNVTMSKLEKPRSWVIVIEVQDTGPGIEPSLHESVFKPF 824
             A+ ++Q  K P   D E  +       +E P++WVI IEV+DTGPGI+PSL ESVF PF
Sbjct: 820  NAIFNSQFNKAPGSDDEEGGN---LGRPIENPKTWVISIEVEDTGPGIDPSLQESVFHPF 876

Query: 825  VQGDQTLSRQYGGTGLGLSICRQLATMMKGTMKLESKVGSGSKFTFTVPLQQTGTVKFND 884
            VQGDQTLSRQYGGTGLGLSICRQLA MM GTMKLESKVG GSKFTFT+PL QT  + F D
Sbjct: 877  VQGDQTLSRQYGGTGLGLSICRQLANMMHGTMKLESKVGVGSKFTFTLPLNQTKEISFAD 936

Query: 885  GDTLFEDEFNIFSKKNRKVKFQLNRSGKSR--------------------------KGK- 917
             +  FEDEFN  S+KNR+VKF + +S KSR                          KGK 
Sbjct: 937  MEFPFEDEFNPESRKNRRVKFSVAKSIKSRQSTSSVATPATNRSSLTNDVLPEVRSKGKH 996

Query: 918  --------------MNNSNGAGSIAESAIE-----------------SFGKSESEASFGS 946
                           N++ G   + E  I+                 S  +S  E   GS
Sbjct: 997  ETKDVGNPNMGREEKNDNGGLEQLQEKNIKPSICLTGAEVNEQNSLSSKHRSRHEG-LGS 1055

Query: 947  VRVDRPFLQSTGTATSTRSVPTL---SSAESSLRILVAEDNNVNQEVIKRMLHLEGAHNI 1003
            V +DRPFLQSTGTATS+R++PT+      E+S++ILV EDN+VNQEVIKRML+LEG  NI
Sbjct: 1056 VNLDRPFLQSTGTATSSRNIPTVKDDDKNETSVKILVVEDNHVNQEVIKRMLNLEGIENI 1115

Query: 1004 DLACDGEDAYQKVSALVEQGEHYDLIFMDVQMPRMDGLLTTKLLRQKLHYEYPIVALTAF 1063
            +LACDG++A+ KV  L  +GE+Y++IFMDVQMP++DGLL+TK++R+ L Y  PIVALTAF
Sbjct: 1116 ELACDGQEAFDKVKELTSKGENYNMIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTAF 1175

Query: 1064 ADDSNIKECLESGMNSFLAKPIKRPMLKKILLE 1096
            ADDSNIKECLESGMN FL+KPIKRP LK IL E
Sbjct: 1176 ADDSNIKECLESGMNGFLSKPIKRPKLKTILTE 1208

>KNAG0L02110 Chr12 (376096..379698) [3603 bp, 1200 aa] {ON} Anc_5.700
            YIL147C
          Length = 1200

 Score =  963 bits (2490), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 570/1212 (47%), Positives = 727/1212 (59%), Gaps = 142/1212 (11%)

Query: 5    YLRKRLAVLKPPFKAGLRTQLTXXXXXXXXXXXXXXXXTTGVYFTSNYRTLRADRLHVAA 64
            + R R    KPP++ G+R QLT                TTGVYFTSNY+ LR+DRL++AA
Sbjct: 2    WFRLRSFTPKPPYRVGIRAQLTMLVSIVAIISLVILAVTTGVYFTSNYKNLRSDRLYIAA 61

Query: 65   RLMSSQVDQSLTLLYYQCNMLSTKDTIQNALSDYRAGNRSAENWIEADKILGGFLERSKT 124
            +L SSQ+DQ+L  LYYQC  ++++DT+Q  L++Y AGN+S  NW+++  +L  FL  S  
Sbjct: 62   QLKSSQIDQNLNYLYYQCYWVASRDTLQTGLANYVAGNKSDANWMDSQSVLEKFLGSSNL 121

Query: 125  FYIAYLYDEMYQEVLSRWNNDTEGSLAEESLVRLRPLEMDKYEYNEALDVQVET--LPYN 182
            F +A +YD  +  VL+  NN T   + E+ L +L PL       N  L   +ET  +  N
Sbjct: 122  FSVARVYDSSFTTVLNTTNNSTGDLIPEDVLTQLLPLST-----NVPLPSSLETNGIVTN 176

Query: 183  KTLN----LMSMTLPVEA--STIIGRGNVVGFLTIVMSADPITAV-NDTSVLGESMVSIL 235
               N    LMSM+LP+ A  S I+    V G++T+VMSA+ + +V NDT+ L  S V+I+
Sbjct: 177  PVKNGSSYLMSMSLPIFANPSIILTDSRVYGYVTVVMSAEGLLSVFNDTTALERSYVAIV 236

Query: 236  TGIPNDKGNLVKYRFVFPPGETDRSVTETEYPIKNASFLRDAFLNRSDNYVTSTSSFYHF 295
            + +  +   L  YRFVFPP  +  S+    +P+ N +FL  A        + ST  FY  
Sbjct: 237  SAVYTNATKLDAYRFVFPPFGSTSSILNETFPLNNNTFLSSALRQGKGGALKSTRLFYRL 296

Query: 296  GALGHDFKKVAVGYSACKFRQLDWVAVVSQDESVFLSPAFKLTKIIIGTVLGVAVFMCIV 355
                    K+AVGYS       +WVA+V+Q ESVF+SPA KL KII GTV+G+ VF  ++
Sbjct: 297  --------KLAVGYSPSTSNLANWVAIVAQAESVFISPATKLAKIIAGTVVGIGVFAMLI 348

Query: 356  TFILASWAVKPIVRLQKATEFIAAGRGLRTYNHSGRSSSQNTSIDRSNSRGSDHSLPREL 415
            TF LA WAVKPIVRLQKATE I   RGLR    +  S S+  SI R  S  S  S P   
Sbjct: 349  TFPLAHWAVKPIVRLQKATELITESRGLRPTTPT--SGSRANSILRDKS--SLISFPL-- 402

Query: 416  FEKKHHVS---------------PFVTENHAANSGSCSSMSD-HERYLHHIARYHDGETS 459
                H VS               P   + +  NS S  ++S+  E +  H      G + 
Sbjct: 403  ----HPVSTNNINNNNSNEKAQPPSDQDTNTNNSSSSIAVSNIREEHSPHADGVFSGISL 458

Query: 460  TNI------LSDHEKGSTSATNWIDTRVPVYRRLFTDELSELTDTFNTMTDELDRQYVVL 513
            +N+      LS+  K  T+A N I  RVP YR LF DELS+LT+TFNTMTD LD+ Y +L
Sbjct: 459  SNVSDRLERLSNTSKHYTTAVNLIQARVPSYRALFKDELSDLTETFNTMTDALDQHYALL 518

Query: 514  EDRVRARTXXXXXXXXXXXXXXXXXTVFIANIFHELRTPLNGILGMTAIAMAEQDQEKIQ 573
            E+RVRART                 TVFIANI HELRTPLNGILGMTAI+M E D +KI+
Sbjct: 519  EERVRARTKQLEAAKIEAETANEAKTVFIANISHELRTPLNGILGMTAISMEETDIDKIR 578

Query: 574  NSLKLIFRSGXXXXXXXXXXXXFSKNVLKRTKLEERHFSIIDIALQVKSIFGKLAKDQHV 633
            NSLKLIFRSG            FSKNVLKRTKLE+R+F I D+ALQ+KSIFGK+AKDQHV
Sbjct: 579  NSLKLIFRSGELLLHILTELLTFSKNVLKRTKLEKRNFCITDVALQIKSIFGKVAKDQHV 638

Query: 634  KLSIYLMPNAIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGKVDVRIKLVGEYDSARSE 693
            +LSI L PN IR+MVL+GDSNRIIQIVMNLVSNALKFTPVDGKVDVR+K++G YD A SE
Sbjct: 639  RLSIILSPNMIRSMVLYGDSNRIIQIVMNLVSNALKFTPVDGKVDVRMKVLGLYDEALSE 698

Query: 694  ACNFSEVYILPGTEVTNSSVN-NIP---------TVVXXXXXXXXXXPTADDTP--ERKK 741
              N ++VY+ PGTE+T+S+ + N+          T               D TP  +R  
Sbjct: 699  KYNHNKVYVKPGTEITDSTPSLNVKSEGQGKDKFTSDTASKNNTSSDTAYDATPTTDRVA 758

Query: 742  KDS-EXXXXXXXXXXXXXXXXXXXXAVLHAQLKKIPTFIDLEDSDNNVTMSKLEKPRSWV 800
            ++S E                    A+ ++Q KK     D ED ++ + + +LE P++WV
Sbjct: 759  QESDEDNMYEDNESMISSTTSSYDDAIFNSQFKKTTNLYD-EDDESEMGV-ELETPKTWV 816

Query: 801  IVIEVQDTGPGIEPSLHESVFKPFVQGDQTLSRQYGGTGLGLSICRQLATMMKGTMKLES 860
            I  EV+D+GPGI+  L ESVF+PFVQGDQTLSRQYGGTGLGLSICRQLA MMKG M LES
Sbjct: 817  ISFEVEDSGPGIDKGLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAGMMKGKMLLES 876

Query: 861  KVGSGSKFTFTVPLQQTGTVKFNDGDTLFEDEFNIFSKKNRKVKFQLNRSGKSRKGKMN- 919
            KVG GSKFTFT+PL QT  + F + +  FEDEFN  SKKNRKVKF++ RS  SRK + + 
Sbjct: 877  KVGVGSKFTFTLPLTQTREINFANVEDPFEDEFNAKSKKNRKVKFRMARSLNSRKSRSSI 936

Query: 920  NSNGAGS------------------------IAESAIESFG-----KSESE--------- 941
             + GA S                        +  ++ E  G     +SES+         
Sbjct: 937  VTAGASSHHSVHTRTPTKSPRLKCDRSVSDRVVINSPERTGENITFRSESDDHLSHMHRN 996

Query: 942  ---------ASFGSVRVDRPFLQSTGTATSTRSVPTLSS--------------------- 971
                     AS  ++ +DRPFLQSTGTATSTRS+P LSS                     
Sbjct: 997  RDKDHERLSASNSTMSLDRPFLQSTGTATSTRSIPHLSSFKEEKPNDPLLNVSSSAEQTK 1056

Query: 972  ----AESSLRILVAEDNNVNQEVIKRMLHLEGAHNIDLACDGEDAYQKVSALVEQGEHYD 1027
                   + +ILVAEDN+VNQEVIKRML LEG  +IDLACDG+DA+ KV  L ++G  Y+
Sbjct: 1057 KTSEGNGAYKILVAEDNHVNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYN 1116

Query: 1028 LIFMDVQMPRMDGLLTTKLLRQKLHYEYPIVALTAFADDSNIKECLESGMNSFLAKPIKR 1087
            LIFMDVQMP++DGL +TK++R  LH ++PIVALTAFADDSNIKECL++GM+ FL+KPIKR
Sbjct: 1117 LIFMDVQMPKVDGLTSTKMIRHDLHCDFPIVALTAFADDSNIKECLDAGMDGFLSKPIKR 1176

Query: 1088 PMLKKILLEHTS 1099
              LK IL E  S
Sbjct: 1177 TKLKTILKEFCS 1188

>Skud_9.21 Chr9 complement(46872..50537) [3666 bp, 1221 aa] {ON}
            YIL147C (REAL)
          Length = 1221

 Score =  960 bits (2482), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 565/1214 (46%), Positives = 726/1214 (59%), Gaps = 149/1214 (12%)

Query: 15   PPFKAGLRTQLTXXXXXXXXXXXXXXXXTTGVYFTSNYRTLRADRLHVAARLMSSQVDQS 74
            PPF+ G+R QLT                TTGVYFTSNY+ LR+DRL++AA+L SSQVDQ+
Sbjct: 13   PPFRIGIRAQLTALVSIVALVSLTILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQVDQT 72

Query: 75   LTLLYYQCNMLSTKDTIQNALSDYRAGNRSAENWIEADKILGGFLERSKTFYIAYLYDEM 134
            L  LYYQ   L+++D +Q++L+ Y AGN+S +NW+++  ++  FL  S  FY+A +YD  
Sbjct: 73   LNYLYYQAYYLASRDALQSSLTSYVAGNKSEDNWVDSLSVVQKFLSSSNLFYVARVYDSS 132

Query: 135  YQEVLSRWNNDTEGSLAEESLVRLRPLEMDKYEYNEALDVQVETLP-YNKTLNLMSMTLP 193
            +  VL+  NN T   + E+ L  L PL  D    +      + T P  N T  LMSM+LP
Sbjct: 133  FTTVLNATNNGTGDLIPEDVLDNLFPLSTDIPLPSSLETTGILTDPIVNNTDYLMSMSLP 192

Query: 194  VEA--STIIGRGNVVGFLTIVMSADPITAV-NDTSVLGESMVSILTGIPNDKGNLVKYRF 250
            + A  S I+    V G++TIVMSA+ + +V NDT+ L +S V+I++   N +G    Y F
Sbjct: 193  IFANPSIILTDSRVYGYITIVMSAEGLKSVFNDTTALEKSNVAIISATYNAQGRASGYHF 252

Query: 251  VFPPGETDRSVTETEYPIKNASFLRDAFLNRSDNYVTSTSSFYHFGALGHDFKKVAVGYS 310
            VFPP  T  S+T+  +PI+N +F+   F N     +  T+   +FG      K +A+GYS
Sbjct: 253  VFPPYGTLLSITQRIFPIENNTFISSTFRNGKGGSLKKTN---NFGT-----KNLALGYS 304

Query: 311  ACKFRQLDWVAVVSQDESVFLSPAFKLTKIIIGTVLGVAVFMCIVTFILASWAVKPIVRL 370
             C F+ ++WVAVVSQ ESVFLSPA KLTKII GTV+ + VF+ ++T  L  WAVKPIVRL
Sbjct: 305  PCSFQLVNWVAVVSQPESVFLSPATKLTKIIAGTVIAIGVFVILLTLPLTHWAVKPIVRL 364

Query: 371  QKATEFIAAGRGLRTYNHSGRSSSQNTSIDRSNSRG------------------------ 406
            QKATE I  GRGLR    + R+ S+ +S  R  S G                        
Sbjct: 365  QKATELITEGRGLRP--STPRTVSRASSFRRGFSSGFTAPSSLLQFNTGEACSTTSANGH 422

Query: 407  ------------SDHSLPRELFEKKHHVSPFVTENHAANSGSCSSMS-----DHERYLHH 449
                        ++ S+   +      +SP   EN   N+ +   +S     +H+    +
Sbjct: 423  GSSGHGSGVALSTESSMKSAINLGHEKLSPSEEENKIPNNHNDVKISMDGSLNHDLLAPN 482

Query: 450  IARYHDGETSTNILSDHEKGSTSATNWIDTRVPVYRRLFTDELSELTDTFNTMTDELDRQ 509
              R +D + S    S      T++ N  + R+P Y+RLF+DELS+LT+TFNTMTD LD+ 
Sbjct: 483  SLRNNDTDRS----SSRSHILTTSANLTEARLPDYKRLFSDELSDLTETFNTMTDALDQH 538

Query: 510  YVVLEDRVRARTXXXXXXXXXXXXXXXXXTVFIANIFHELRTPLNGILGMTAIAMAEQDQ 569
            Y +LEDRVRART                 TVFIANI HELRTPLNGILGMTAI+M E D 
Sbjct: 539  YALLEDRVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDV 598

Query: 570  EKIQNSLKLIFRSGXXXXXXXXXXXXFSKNVLKRTKLEERHFSIIDIALQVKSIFGKLAK 629
             KI+N+LKLIFRSG            FSKNVL+RTKLE R F I D+ALQ+KSIFGK+AK
Sbjct: 599  NKIRNNLKLIFRSGELLLHILTELLTFSKNVLQRTKLERRDFCITDVALQIKSIFGKVAK 658

Query: 630  DQHVKLSIYLMPNAIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGKVDVRIKLVGEYDS 689
            DQ V+LSI L PN IRTMVLWGDSNRIIQIVMNLVSNALKFTPVDG VDVR+KL+GEYD 
Sbjct: 659  DQRVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDK 718

Query: 690  ARSEACNFSEVYILPGTEVTN--SSVN--NIPTVVXXXXXXXXXXPTADDTPER------ 739
              SE   F EV++  GTE+T+   S++  ++PT +           TA  T  R      
Sbjct: 719  DSSEKRQFKEVHVKKGTEITDVVESIDKRDLPTSLGRRKYVNLESTTASITSCRDNSAIQ 778

Query: 740  ----------------KKKDSEXXXXXXXXXXXXXXXXXXXXAVLHAQLKKIPTFIDLED 783
                            K  D E                    A+ ++Q  K    +D + 
Sbjct: 779  EEITKRNTAANENIYKKANDREKSSNDDVSSIVSTTTSSYDDAIFNSQFNKA---LDSDS 835

Query: 784  SDNNVTMSKLEKPRSWVIVIEVQDTGPGIEPSLHESVFKPFVQGDQTLSRQYGGTGLGLS 843
             ++      +E P++WVI IEV+DTGPGIEPSL ESVF+PFVQGDQTLSRQYGGTGLGLS
Sbjct: 836  DESGNVGRPIENPKTWVISIEVEDTGPGIEPSLQESVFQPFVQGDQTLSRQYGGTGLGLS 895

Query: 844  ICRQLATMMKGTMKLESKVGSGSKFTFTVPLQQTGTVKFNDGDTLFEDEFNIFSKKNRKV 903
            ICRQLA MM GTMKLES+VG GSKFTFT+PL QT  + F + +  FEDEFN  SKKNR+V
Sbjct: 896  ICRQLANMMHGTMKLESQVGVGSKFTFTLPLHQTKEISFANIEFPFEDEFNPESKKNRRV 955

Query: 904  KFQLNRSGKSRKG------KMNNSNG--------AGSIAESAIE---------------- 933
            KF + +S KSR+        + NSN         A S  E  +E                
Sbjct: 956  KFSVAKSIKSRQSTSSLTTPVTNSNTLANDVLIEARSSDEEEVEKTKNFIKRKEGENENG 1015

Query: 934  ---------------SFGKSE-------------SEASFGSVRVDRPFLQSTGTATSTRS 965
                           SF  +E              E + GSV +DRPFLQSTGTATS+R+
Sbjct: 1016 KAQQQPQEKNTKHSVSFSSAERSSQKTVSSKRRSQEENLGSVNIDRPFLQSTGTATSSRN 1075

Query: 966  VPTLSSAE---SSLRILVAEDNNVNQEVIKRMLHLEGAHNIDLACDGEDAYQKVSALVEQ 1022
            VPT+   +   +S++ILV EDN+VNQEVI+RML+LEG  NI+LACDG++A+ KV  L  +
Sbjct: 1076 VPTVQGGDKDGTSIKILVVEDNHVNQEVIRRMLNLEGIDNIELACDGQEAFDKVKELTSK 1135

Query: 1023 GEHYDLIFMDVQMPRMDGLLTTKLLRQKLHYEYPIVALTAFADDSNIKECLESGMNSFLA 1082
            GE+Y++IFMDVQMP++DGLL+TK++R+ L Y+ PIVALTAFADDSNIKECLESGMN FL+
Sbjct: 1136 GENYNMIFMDVQMPKVDGLLSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLS 1195

Query: 1083 KPIKRPMLKKILLE 1096
            KPIKRP L  IL E
Sbjct: 1196 KPIKRPKLNTILSE 1209

>Suva_9.41 Chr9 complement(64510..68166) [3657 bp, 1219 aa] {ON}
            YIL147C (REAL)
          Length = 1219

 Score =  959 bits (2480), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 565/1225 (46%), Positives = 729/1225 (59%), Gaps = 150/1225 (12%)

Query: 6    LRKRL---AVLKPPFKAGLRTQLTXXXXXXXXXXXXXXXXTTGVYFTSNYRTLRADRLHV 62
            +R RL   +V  PPF+  +R QLT                TTGVYFTSNY+ LR+DRL++
Sbjct: 1    MRFRLPSRSVFTPPFRISIRAQLTALVSIVALISLVILAVTTGVYFTSNYKNLRSDRLYI 60

Query: 63   AARLMSSQVDQSLTLLYYQCNMLSTKDTIQNALSDYRAGNRSAENWIEADKILGGFLERS 122
            AA+L SSQ+DQ+L  LYYQ   L+++D +QN+L+ Y AGN+S++NW+++  I+  FL  S
Sbjct: 61   AAQLKSSQIDQTLNYLYYQAYYLASRDALQNSLTGYVAGNKSSDNWVDSVSIVQKFLSSS 120

Query: 123  KTFYIAYLYDEMYQEVLSRWNNDTEGSLAEESLVRLRPLEMDKYEYNEALDVQVETLP-Y 181
              F++A +YD  +  VL+  NN T   + ++    L PL  D    +      + T P  
Sbjct: 121  NLFFVAKVYDSSFTTVLNATNNGTGDLIPKDISDELFPLSTDMALPSSLETTGILTDPIL 180

Query: 182  NKTLNLMSMTLPVEA--STIIGRGNVVGFLTIVMSADPITAV-NDTSVLGESMVSILTGI 238
            N T  LMSM+LP+ A  S I+    V G++TI+MSA+ + +V NDT+ L +S V+I++ +
Sbjct: 181  NSTDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISAV 240

Query: 239  PNDKGNLVKYRFVFPPGETDRSVTETEYPIKNASFLRDAFLNRSDNYVTSTSSFYHFGAL 298
             N++     Y FVFPP  T  S+T+T +PIKN +F+  AF N     +  T+SF      
Sbjct: 241  YNNQSKAYAYHFVFPPYGTSSSITKTIFPIKNNTFISSAFKNGKGGSLKKTNSF------ 294

Query: 299  GHDFKKVAVGYSACKFRQLDWVAVVSQDESVFLSPAFKLTKIIIGTVLGVAVFMCIVTFI 358
                K +A+GYS C F+ ++WVAVVSQ ESVFLSP+ KL KII GTV+ + VF+ ++T  
Sbjct: 295  --GIKNLALGYSPCSFQLVNWVAVVSQPESVFLSPSTKLAKIITGTVIAIGVFVILLTLP 352

Query: 359  LASWAVKPIVRLQKATEFIAAGRGLRTYNHSGRSSSQNTSIDRSNSRGSDHSLPREL--F 416
            LA WAV+PIVRLQKATE I  GRGLR    + R+ S+ +S  R  S G   ++P  L  F
Sbjct: 353  LAHWAVQPIVRLQKATELITEGRGLRP--STPRTVSRTSSFKRGFSSG--FAVPSSLLQF 408

Query: 417  EKKHHVSPFVTENHAANS-GSCSSMS-------------------DHERYL---HHIARY 453
                  S      H  +  GS + MS                   + E+     H+ A+ 
Sbjct: 409  NSGEAGSTTSASGHGCSGRGSAAVMSTDSSMKSAMNIGNEKLSPLEEEKRTPNDHNNAKI 468

Query: 454  H-DGETSTNILSD----HEKGS---------TSATNWIDTRVPVYRRLFTDELSELTDTF 499
              DG  + ++L+     H             T++ N  + R+P YRRLF+DELS+LT+TF
Sbjct: 469  SMDGSLNHDLLAPNALRHSDNDRSSSRSHILTTSANLTEARLPDYRRLFSDELSDLTETF 528

Query: 500  NTMTDELDRQYVVLEDRVRARTXXXXXXXXXXXXXXXXXTVFIANIFHELRTPLNGILGM 559
            NTMTD LD+ Y +LEDRVRART                 TVFIANI HELRTPLNGILGM
Sbjct: 529  NTMTDALDQHYALLEDRVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGM 588

Query: 560  TAIAMAEQDQEKIQNSLKLIFRSGXXXXXXXXXXXXFSKNVLKRTKLEERHFSIIDIALQ 619
            TAI+M E D  KI+NSLKLIFRSG            FSKNVL+RTKLE+R F I D+ALQ
Sbjct: 589  TAISMEETDVNKIRNSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFCITDVALQ 648

Query: 620  VKSIFGKLAKDQHVKLSIYLMPNAIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGKVDV 679
            +KSIFGK+AKDQ V+LSI L PN IRTMVLWGDSNRIIQIVMNLVSNALKFTPVDG V+V
Sbjct: 649  IKSIFGKVAKDQRVRLSISLFPNFIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVEV 708

Query: 680  RIKLVGEYDSARSEACNFSEVYILPGTEVTNSSVNNIPT--------------------- 718
            R+KL+GEYD   SE   F EV++  GTE+    + NI                       
Sbjct: 709  RMKLLGEYDKELSEKKQFKEVHVRKGTEII-EDIGNINKHDAKKSENFKKSMDSESTTTS 767

Query: 719  ------VVXXXXXXXXXXPTADDTPERKKKDSEXXXXXXXXXXXXXXXXXXXXAVLHAQL 772
                                A++   +K +D E                    A+ ++Q 
Sbjct: 768  MTSNRDTSTIQEEITKRNTAANENIYKKTRDREKSSNDDISSIVSTSTSSYDDAIFNSQF 827

Query: 773  KKIPTFIDLEDSDNNVTMSKLEKPRSWVIVIEVQDTGPGIEPSLHESVFKPFVQGDQTLS 832
             K    +  +D +       +E P++W I IEV+DTGPGI+PSL ESVF PFVQGDQTLS
Sbjct: 828  NKA---LGSDDDEGGDLGKPIENPKTWAISIEVEDTGPGIDPSLQESVFHPFVQGDQTLS 884

Query: 833  RQYGGTGLGLSICRQLATMMKGTMKLESKVGSGSKFTFTVPLQQTGTVKFNDGDTLFEDE 892
            RQYGGTGLGLSICRQLA MM GTMKLESKVG GSKFTFT+PL QT  + F + +  FEDE
Sbjct: 885  RQYGGTGLGLSICRQLANMMHGTMKLESKVGVGSKFTFTLPLHQTKEISFANMNFPFEDE 944

Query: 893  FNIFSKKNRKVKFQLNRSGKS----------------------RKGKMN----------- 919
            FN  S++NR+VKF + RS KS                      RK + N           
Sbjct: 945  FNPESRQNRRVKFNVARSIKSRQSASSIATPTANRCGLTNEMLRKSRSNEEEEGRKIINI 1004

Query: 920  --NSNGAGSIAESAIE----------SFGKSES-------------EASFGSVRVDRPFL 954
                 G   + E+  +          SF  ++S             E S GSV +DRPFL
Sbjct: 1005 EEGKEGGNELDEAHQQLQEKNVKNSISFSSADSNEQKSAPSTRHSREESVGSVNLDRPFL 1064

Query: 955  QSTGTATSTRSVPTLSSAE---SSLRILVAEDNNVNQEVIKRMLHLEGAHNIDLACDGED 1011
            QSTGTATS R++PT+S+++   SS++ILV EDN+VNQEVIKRML+LEG  NI+LACDG+D
Sbjct: 1065 QSTGTATSNRNIPTVSNSDKSDSSIKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQD 1124

Query: 1012 AYQKVSALVEQGEHYDLIFMDVQMPRMDGLLTTKLLRQKLHYEYPIVALTAFADDSNIKE 1071
            A+ KV  L  +GE Y++IFMDVQMP++DGLL+TK++R+ L Y  PIVALTAFADDSNIKE
Sbjct: 1125 AFDKVKELTSRGESYNMIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKE 1184

Query: 1072 CLESGMNSFLAKPIKRPMLKKILLE 1096
            CLESGMN FL+KPIKRP LK IL+E
Sbjct: 1185 CLESGMNGFLSKPIKRPKLKTILIE 1209

>KAFR0D02240 Chr4 complement(450837..454400) [3564 bp, 1187 aa] {ON}
            Anc_5.700 YIL147C
          Length = 1187

 Score =  955 bits (2468), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 552/1170 (47%), Positives = 715/1170 (61%), Gaps = 81/1170 (6%)

Query: 2    RLGYLRKRLAVL--KPPFKAGLRTQLTXXXXXXXXXXXXXXXXTTGVYFTSNYRTLRADR 59
            R+    KRLA L  KPP++  +RTQL                 TTGVYFTS+Y+ LRA+R
Sbjct: 10   RISQRLKRLAHLNTKPPYRISIRTQLIAVVSLVAILSLLILAVTTGVYFTSSYKNLRANR 69

Query: 60   LHVAARLMSSQVDQSLTLLYYQCNMLSTKDTIQNALSDYRAGNRSAENWIEADKILGGFL 119
            L++AA+L SSQ+DQ+LT LYYQ   +ST+DT+Q++L+++ AGN+S+ NW   + +L  FL
Sbjct: 70   LYIAAQLKSSQIDQTLTYLYYQSYWISTRDTLQDSLANFVAGNKSSSNWESTESVLEKFL 129

Query: 120  ERSKTFYIAYLYDEMYQEVLSRWNNDTEGSLAEESLVRLRPLEMDKYEYNEALDVQVETL 179
              S  F    +YDE +  VLS  NN T   +A + L +L PL  +    +      + T 
Sbjct: 130  SSSDYFSAVKVYDENFDTVLSVTNNGTGNQIAADVLEKLFPLSTNIPLSSSLETTGILTD 189

Query: 180  P-YNKTLNLMSMTLPVEA--STIIGRGNVVGFLTIVMSADPITAV-NDTSVLGESMVSIL 235
            P  N T  LMSM+LPV A  S I+    V G++TI+M+AD + +V NDT+ + +S V+I+
Sbjct: 190  PVLNGTSYLMSMSLPVFANPSIILSTSRVYGYITIIMTADGLLSVFNDTTAIEKSNVAIV 249

Query: 236  TGIPNDKGNLVKYRFVFPPGETDRSVTETEYPIKNASFLRDAFLNRSDNYVTSTSSFYHF 295
            + + N++  L  Y    PP     SVT+  + +KN+SFL  A        +  T   Y+ 
Sbjct: 250  SAVYNNQSELDAYHLALPPYGFTASVTDINFQLKNSSFLNGALKQGKGGSIKKTHFLYN- 308

Query: 296  GALGHDFKKVAVGYSACKFRQLDWVAVVSQDESVFLSPAFKLTKIIIGTVLGVAVFMCIV 355
                   K VAVGYS C F   +WV+VVSQ ESVF  P+ KLTKII G V+G++VF+ +V
Sbjct: 309  -------KAVAVGYSPCSFELANWVSVVSQAESVFSGPSTKLTKIIAGVVVGISVFVMLV 361

Query: 356  TFILASWAVKPIVRLQKATEFIAAGRGLRTYNHSGRSSSQNTSIDR-------------S 402
            T  LA +AVKPIVRL+KATE I  GRGLR       S S+ +S+ R             S
Sbjct: 362  TLPLAYFAVKPIVRLKKATEIITEGRGLRPTTPGSGSVSRTSSMRREKSPRTSIVSSRKS 421

Query: 403  NSRGSDHSLPRELFEKKHHVSPFVTENHAA--NSGSCSSMSDHERYLHHIARYHDGET-- 458
             + G+ +SL         H     +EN     +SG      +  + L   A      T  
Sbjct: 422  TATGNSNSLNENSASLSSHPMVLTSENVLVTNHSGLSRIPVNMNQELLDRASASTVNTLT 481

Query: 459  --STNILSDHEKGSTSATNWIDTRVPVYRRLFTDELSELTDTFNTMTDELDRQYVVLEDR 516
              S + LS+  K   + TN  + RVP+ R+LF DELS+LT+TFNTMTD LD  Y +LEDR
Sbjct: 482  IDSNDRLSERSKHLITFTNLTEARVPIARKLFFDELSDLTETFNTMTDALDEHYTLLEDR 541

Query: 517  VRARTXXXXXXXXXXXXXXXXXTVFIANIFHELRTPLNGILGMTAIAMAEQDQEKIQNSL 576
            VRART                 TVFIANI HELRTPLNGILGMTAI+M E+D  KI++SL
Sbjct: 542  VRARTKQLEAAKIQAEAANEAKTVFIANISHELRTPLNGILGMTAISMEEEDITKIRSSL 601

Query: 577  KLIFRSGXXXXXXXXXXXXFSKNVLKRTKLEERHFSIIDIALQVKSIFGKLAKDQHVKLS 636
            KLIFRSG            FSKNVL+RTKLE+R+F I D+ALQ+KSIFGK+AKDQHV+LS
Sbjct: 602  KLIFRSGELLLHILTELLTFSKNVLQRTKLEKRNFCITDVALQMKSIFGKVAKDQHVRLS 661

Query: 637  IYLMPNAIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGKVDVRIKLVGEYDSARSEACN 696
            I L PN +RTMVL+GDSNRIIQ+VMNLVSNALKFTPVDGKV V+IKL+GEYD   S+   
Sbjct: 662  IILSPNIMRTMVLYGDSNRIIQVVMNLVSNALKFTPVDGKVQVKIKLLGEYDEESSKNSK 721

Query: 697  FSEVYILPGTEVTN---------------------------SSVNNIPTVVXXXXXXXXX 729
            F +VY+  GTE T+                             ++ IP  V         
Sbjct: 722  FEKVYVKGGTEFTSIPAELAALSKRESTAGSHFSGSSSHIKEKLDGIPANVFASDSDSDD 781

Query: 730  XPTADDTPERKKKDSEXXXXXXXXXXXXXXXXXXXXAVLHAQLKKIPTFIDLEDSDNNVT 789
                      +++ S                     A+ ++Q KK P     ED D N+ 
Sbjct: 782  PSEGTTINTSQQRTSSNEDYVDNISIASTSTSSYDDAIFNSQFKKTPDL--YEDEDGNLG 839

Query: 790  MSKLEKPRSWVIVIEVQDTGPGIEPSLHESVFKPFVQGDQTLSRQYGGTGLGLSICRQLA 849
              +L + ++WV  IEV DTGPGI+ SL ESVF+PFVQGDQTLSRQYGGTGLGLSICRQLA
Sbjct: 840  -EELSQQKTWVFRIEVIDTGPGIDSSLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLA 898

Query: 850  TMMKGTMKLESKVGSGSKFTFTVPLQQTGTVKFNDGDTLFEDEFNIFSKKNRKVKFQLNR 909
            TMM GTM LES VGSGSKF FTVPL QT  +K ++ +  +EDEFN  SK NRKVKF + R
Sbjct: 899  TMMNGTMTLESTVGSGSKFIFTVPLTQTRVIKLDESEHPYEDEFNPKSKMNRKVKFNVAR 958

Query: 910  SGKSRKGKM----NNSNGAGSIAE----------SAIESFGKSESEA----SFGSVRVDR 951
            S  SR+ +     +NS+   ++ E          S + +  K+ES +    S  ++ +DR
Sbjct: 959  SINSRRSRSSLITSNSSRIATVREESRLETRSNHSDVSTSNKNESASPQPESGSNLNLDR 1018

Query: 952  PFLQSTGTATSTRSVPTLSSAESSLRILVAEDNNVNQEVIKRMLHLEGAHNIDLACDGED 1011
            PFLQSTGTA S+ +VPT+++   +L +LVAEDN+VNQEVIKRML LEG  NIDLACDG+D
Sbjct: 1019 PFLQSTGTAISSANVPTVATLGKTLNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQD 1078

Query: 1012 AYQKVSALVEQGEHYDLIFMDVQMPRMDGLLTTKLLRQKLHYEYPIVALTAFADDSNIKE 1071
            A+  V +L E+GE YD+IFMDVQMP++DGL  TK++R  L YE+PIVALTAFADDSNIKE
Sbjct: 1079 AFDNVKSLKERGEFYDMIFMDVQMPKVDGLSATKMIRNDLKYEHPIVALTAFADDSNIKE 1138

Query: 1072 CLESGMNSFLAKPIKRPMLKKILLEHTSQL 1101
            CL++GM+ FL+KPIKRP LK ILLE+  ++
Sbjct: 1139 CLDAGMDGFLSKPIKRPQLKTILLEYCPKV 1168

>TPHA0D04590 Chr4 (1001887..1005270) [3384 bp, 1127 aa] {ON} Anc_5.700
            YIL147C
          Length = 1127

 Score =  879 bits (2270), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 516/1140 (45%), Positives = 690/1140 (60%), Gaps = 83/1140 (7%)

Query: 14   KPPFKAGLRTQLTXXXXXXXXXXXXXXXXTTGVYFTSNYRTLRADRLHVAARLMSSQVDQ 73
            KPP++  +R QLT                T GVYFT+NY+ L+  RL++AA+L +SQ+DQ
Sbjct: 10   KPPYRISIRAQLTALVSLVAIISLIILAVTAGVYFTANYKNLKTGRLYIAAQLKASQIDQ 69

Query: 74   SLTLLYYQCNMLSTKDTIQNALSDYRAGNRSAENWIEADKILGGFLERSKTFYIAYLYDE 133
            +L  LYYQC  LS+ +T+QN+L  Y AGN S+ NW E+  +L  FL  S  F +A LYD 
Sbjct: 70   TLNYLYYQCYYLSSGETLQNSLVSYSAGNISSTNWYESSLVLEKFLTSSDLFSVARLYDT 129

Query: 134  MYQEVLSRWNNDTEGSLAEESLVRLRPLEMDKYEYNEALDVQVETLPY--NKTLN----L 187
             +  +++  NN +   + E  + +L  L +     N +L   +ET+    +  LN    L
Sbjct: 130  NFNIMINATNNASGNYVPESVIDKLFTLSL-----NISLPSSLETIGICTDPVLNGSNFL 184

Query: 188  MSMTLPVEA--STIIGRGNVVGFLTIVMSADPITAV-NDTSVLGESMVSILTGIPNDKGN 244
            MSM+LP+ A  S I+    + G+L+++MSA+ + +V NDT+ L  S V +++   +   N
Sbjct: 185  MSMSLPIFANPSIILSDSRIYGYLSVIMSAEGLKSVFNDTTALENSEVFVISADYSITTN 244

Query: 245  LVKYRFVFPPG--ETDRSVTETEYPIKNASFLRDAFLNRSDNYVTSTSSFYHFGALGHDF 302
            L  + F+F       D+   +  Y I N +F+ +  +N     V  T+ F    A     
Sbjct: 245  LEYFNFLFASAYDNADKDY-DLHYRIDNDTFVYNGLVNGKGGAVKKTNGFLGTAA----- 298

Query: 303  KKVAVGYSACKFRQLDWVAVVSQDESVFLSPAFKLTKIIIGTVLGVAVFMCIVTFILASW 362
               AVGYS+C F  ++W+A+V+Q E+ F   A KL +II G V+ VAVF+C++TF L+ W
Sbjct: 299  ---AVGYSSCSFSLVNWLAIVAQPEAAFSESATKLERIISGVVVAVAVFVCLLTFPLSHW 355

Query: 363  AVKPIVRLQKATEFIAAGRGLRTYNHS-GRSSSQNTSIDRSNSRGSDHSLPRELFEKKHH 421
            AV+P++RLQKATE IA GRGLR    + G S S+N+SI   NS            E    
Sbjct: 356  AVQPLIRLQKATERIAEGRGLRPPQPTVGSSVSRNSSIKWRNS-----------LENHVR 404

Query: 422  VSPFVTENHAANSGSCSSMSDHERYL--------HHIARYHDGETSTNILSDHEKGSTS- 472
             S     N  ++SGS ++ +              H     +   +S  I  D +  S+S 
Sbjct: 405  SSLGFNANKLSDSGSITANNFKNNTSSSNSITSSHIYGNNNSSHSSMGINPDDDLSSSSQ 464

Query: 473  ----ATNWIDTRVPVYRRLFTDELSELTDTFNTMTDELDRQYVVLEDRVRARTXXXXXXX 528
                + N I+ RVPVY RL  DELSELTDTFNTMTD LD+ Y +LE+RVRART       
Sbjct: 465  KYKTSANLIEARVPVYWRLLQDELSELTDTFNTMTDALDQHYCLLEERVRARTKQLEAAK 524

Query: 529  XXXXXXXXXXTVFIANIFHELRTPLNGILGMTAIAMAEQDQEKIQNSLKLIFRSGXXXXX 588
                      TVFIANI HELRTPLNGILGMTAI+M E D +KI+ +LKLIFRSG     
Sbjct: 525  IQAESANEAKTVFIANISHELRTPLNGILGMTAISMEEDDVDKIRGNLKLIFRSGELLLH 584

Query: 589  XXXXXXXFSKNVLKRTKLEERHFSIIDIALQVKSIFGKLAKDQHVKLSIYLMPNAIRTMV 648
                   FSKNVL+RTKLE+R F I ++ALQ+KSIFGKLAKDQHVKLSI LMPN +R+ V
Sbjct: 585  ILTELLTFSKNVLQRTKLEKRDFCITEVALQIKSIFGKLAKDQHVKLSIILMPNILRSYV 644

Query: 649  LWGDSNRIIQIVMNLVSNALKFTPVDGKVDVRIKLVGEYDSARSEACNFSEVYILPGTEV 708
            LWGDSNRIIQ+VMNLVSNALKFTPVDG VDVRI L+GEYD  RS+A ++ +VY+  GTE+
Sbjct: 645  LWGDSNRIIQVVMNLVSNALKFTPVDGNVDVRINLLGEYDEERSKAEDYKKVYVKQGTEL 704

Query: 709  ----------TNSSVNNIPTVVXXXXXXXXXXPTADDTPERKKKDSEXXXXXXXXXXXXX 758
                       N+ ++                 + DDT +   K                
Sbjct: 705  PLNISHLKTEENNDISRKSETELNNDENETHTISKDDTADSSIKIGNEDVEISEVDKMGM 764

Query: 759  XXXXXXXAVLH---AQLKKIPTFIDLEDSDNNVTMSKLEKPRSWVIVIEVQDTGPGIEPS 815
                   +  +   A +K++    DL+D +N + + +L++ ++WVI +EV+DTG GI+P 
Sbjct: 765  ASLVTTSSKSYDDTALMKQLIKSTDLDDDENKLGV-ELKEQKTWVISVEVKDTGSGIDPK 823

Query: 816  LHESVFKPFVQGDQTLSRQYGGTGLGLSICRQLATMMKGTMKLESKVGSGSKFTFTVPLQ 875
            L ESVF+PFVQGDQ LSRQYGGTGLGLSIC+QL+TMM GTM+LES+VG GSKF FT+PL+
Sbjct: 824  LQESVFEPFVQGDQALSRQYGGTGLGLSICKQLSTMMNGTMELESEVGVGSKFIFTLPLK 883

Query: 876  QTGTVKFNDGDTLFEDEFNIFSKKNRKVKFQLNRSGKSRKGKMNNSNGAG------SIAE 929
            QT  +   D D LF DEFN  SKKNRKVKF+ + S  ++  K  NS G+       + + 
Sbjct: 884  QTREISIPD-DELFNDEFNAVSKKNRKVKFKFSGSSSAKSIKTRNSIGSSLNNRHSTTSI 942

Query: 930  SAIESFGKSESEASFGSVRVDRPFLQSTGTATSTRSVPTLSSAESS------------LR 977
             +  S    E      SVR++RPFLQSTGTATST++VPTL++                + 
Sbjct: 943  DSSSSDSDEEDNVRPSSVRLNRPFLQSTGTATSTQNVPTLNAHTDDKSKNKVLNKMDLIY 1002

Query: 978  ILVAEDNNVNQEVIKRMLHLEGAHNIDLACDGEDAYQKVSALVEQGEHYDLIFMDVQMPR 1037
            ILVAEDN+VNQEVIKRML LEG +NIDLA DG+DA+ K   L E   +YD+IFMDVQMPR
Sbjct: 1003 ILVAEDNHVNQEVIKRMLKLEGINNIDLARDGQDAFDKTKMLSENNGNYDIIFMDVQMPR 1062

Query: 1038 MDGLLTTKLLRQKLHYEYPIVALTAFADDSNIKECLESGMNSFLAKPIKRPMLKKILLEH 1097
            +DGL  TK++R++L+Y  PIVAL+AF  + N+KECL+ GMN FL+KPIKRP LK IL ++
Sbjct: 1063 LDGLAATKMIREELNYTQPIVALSAFPKEENVKECLDVGMNDFLSKPIKRPDLKIILKKY 1122

>Kpol_1043.68 s1043 (141962..145090) [3129 bp, 1042 aa] {ON}
            (141962..145090) [3129 nt, 1043 aa]
          Length = 1042

 Score =  868 bits (2244), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 492/1105 (44%), Positives = 657/1105 (59%), Gaps = 92/1105 (8%)

Query: 10   LAVLKPPFKAGLRTQLTXXXXXXXXXXXXXXXXTTGVYFTSNYRTLRADRLHVAARLMSS 69
            +++ K P+K  LRTQLT                +TGVYFT NYR LR  +L++AARL SS
Sbjct: 7    VSIWKAPYKVKLRTQLTTLVCFVAIISLLILAISTGVYFTKNYRDLRLQQLYIAARLKSS 66

Query: 70   QVDQSLTLLYYQCNMLSTKDTIQNALSDYRAGNRSAENWIEADKILGGFLERSKTFYIAY 129
            Q+DQ++ LLYYQC  L+ +D I++AL+DY AGNRSAENW     +L  FLE S  F    
Sbjct: 67   QIDQTINLLYYQCVWLTRRDEIESALTDYTAGNRSAENWASTSDVLSTFLESSVVFLTTT 126

Query: 130  LYDEMYQEVLSRWNNDTEGSLAEESLVRLRPLEMDKYEYNEALDVQVETLP-YNKTLNLM 188
            LYD  +  +L+  NN+T   + ++ L  L PL       +      + T P  N +  LM
Sbjct: 127  LYDSQFNLILNETNNETNDYIPDDVLSHLLPLSGTDSLPSYLGTTGLLTDPVLNDSTYLM 186

Query: 189  SMTLPVEA--STIIGRGNVVGFLTIVMSADPITAV-NDTSVLGESMVSILTGIPNDKGNL 245
            SM+LP+ A  S  +    V G+LT+VMSA+ I AV NDT+ L +S+V++++    +  + 
Sbjct: 187  SMSLPIIANPSVTLSDSRVFGYLTVVMSAETIRAVVNDTTALEKSIVAVISSTNTNGTSG 246

Query: 246  VKYRFVFPPGETDRSVTETEYPIKNASFLRDAFLNRSDNYVTSTSSFYHFGALGHDFKKV 305
             +Y FVFPP      +  T YP++N++FL DAF +     +  + S Y         K V
Sbjct: 247  QEYHFVFPPHGASDDIVNTAYPVENSTFLSDAFSSPEGGSINKSKSLYS--------KAV 298

Query: 306  AVGYSACKFRQLDWVAVVSQDESVFLSPAFKLTKIIIGTVLGVAVFMCIVTFILASWAVK 365
            A+GY  C F   +WV  VSQ E VF+S + KLTKII GTV+ + VF+C++TF L+ W+V+
Sbjct: 299  AIGYWPCSFGLANWVGTVSQPEHVFMSSSIKLTKIIAGTVIAITVFVCVITFPLSRWSVQ 358

Query: 366  PIVRLQKATEFIAAGRGLRTYNHSGRSSSQNTSIDRSNSRGSDHSLPRELFEKKHHVSPF 425
            PIVRLQKATE I+   G   +  +  SSS++T      S+   H                
Sbjct: 359  PIVRLQKATEVISKRDGNEVHRSNSSSSSRSTFSSNRRSKDGRH---------------- 402

Query: 426  VTENHAANSGSCSSMSDHERYLHHIARYHDGET-STNILSDHEKGSTSAT----NWIDTR 480
                   NS S +   D E+Y          E+ S   ++D+   ++SA     N  D +
Sbjct: 403  -------NSSSYNLYEDVEKYTEIGKANKSTESLSKENITDYSSSNSSAIVMRKNLADFQ 455

Query: 481  VPVYRRLFTDELSELTDTFNTMTDELDRQYVVLEDRVRARTXXXXXXXXXXXXXXXXXTV 540
            VP  RR   DELSELT+T+  MTD LD    +LE RV+ RT                 TV
Sbjct: 456  VPASRRFVKDELSELTETYKLMTDALDEHSQLLEYRVKERTKQLEAAKIEAESANEAKTV 515

Query: 541  FIANIFHELRTPLNGILGMTAIAMAEQDQEKIQNSLKLIFRSGXXXXXXXXXXXXFSKNV 600
            FIAN+ HELRTPLNGILGMTAIAM E D E+IQ+SLKLI+RSG            FSKNV
Sbjct: 516  FIANVTHELRTPLNGILGMTAIAMEETDMERIQSSLKLIYRSGELLLHILTELLTFSKNV 575

Query: 601  LKRTKLEERHFSIIDIALQVKSIFGKLAKDQHVKLSIYLMPNAIRTMVLWGDSNRIIQIV 660
            LK+TKLE+ HF +ID+ALQ++SIFGK++KDQHVKLSI+++PN +R+MVLWGD NRI+Q++
Sbjct: 576  LKQTKLEKTHFCVIDLALQIESIFGKISKDQHVKLSIFILPNKLRSMVLWGDQNRILQVI 635

Query: 661  MNLVSNALKFTPVDGKVDVRIKLVGEYDSARSEACNFSEVYILPGTEVTNSSVNNIPTVV 720
            MNLVSNALKFTPVDGK+ V IKL+GEYD  RS A N+ +VY+    E+ NS+ + I  ++
Sbjct: 636  MNLVSNALKFTPVDGKITVNIKLLGEYDKDRSAAENYKDVYM---KEIRNSNGDKIKPLM 692

Query: 721  XXXXXXXXXXPTADDTPERKKKDSEXXXXXXXXXXXXXXXXXXXXAVLHAQLKKIPTFID 780
                         + + +    D+E                     +   + K    F  
Sbjct: 693  TLISSKDTMSVADNISNKSVASDTE---------------RSTNNTIYSNKFKNGSNF-- 735

Query: 781  LEDSDNNVTMSKLEKPRSWVIVIEVQDTGPGIEPSLHESVFKPFVQGDQTLSRQYGGTGL 840
             +D+D+ + +  L+K R WVI +EV+DTGPGIEPSL +SVF+PFVQGDQTLSRQYGGTGL
Sbjct: 736  -QDTDDAIGVP-LDKKRKWVISVEVEDTGPGIEPSLQKSVFEPFVQGDQTLSRQYGGTGL 793

Query: 841  GLSICRQLATMMKGTMKLESKVGSGSKFTFTVPLQQTGTVKFNDGDTLFEDEFNIFSKKN 900
            GLSICRQLA +M GTMKLES+VG GSKF FTVPL QT  ++FN  + +FEDEFNI SKKN
Sbjct: 794  GLSICRQLANLMHGTMKLESEVGVGSKFIFTVPLLQTREIEFNGNELVFEDEFNINSKKN 853

Query: 901  RKVKFQLNRSGKSRKGKMNNSNGAGSIAESAIESFGKSESEASFGSVRVDRPFLQSTGTA 960
            R+VKFQ                    + +  IE  G S  E   G     +   +S   A
Sbjct: 854  REVKFQ---------------EITDEVDQVNIE--GNSGVEVEPGKCTEPKKSTESESQA 896

Query: 961  TSTRSVPTLSSAE---------SSLRILVAEDNNVNQEVIKRMLHLEGAHNIDLACDGED 1011
                 VP+ SS E          + ++L+ EDN VNQ V+ RML LEG  N  +ACDG++
Sbjct: 897  V----VPSKSSQEMGNSIKYDVKNFKLLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQE 952

Query: 1012 AYQKVSALVEQGEHYDLIFMDVQMPRMDGLLTTKLLRQKLHYEYPIVALTAFADDSNIKE 1071
            A +K+  +  +GE+Y L+ MD+QMP++DG+  TK++RQ+L Y+ PIVALTAFADDSNI+ 
Sbjct: 953  AVEKIKEIQSRGEYYGLVLMDIQMPKVDGITATKIIRQELKYDKPIVALTAFADDSNIQA 1012

Query: 1072 CLESGMNSFLAKPIKRPMLKKILLE 1096
            C +SGM+ FLAKPIKR  LK IL E
Sbjct: 1013 CYKSGMDGFLAKPIKREQLKGILTE 1037

>KLLA0A00638g Chr1 complement(60378..63845) [3468 bp, 1155 aa] {ON}
           similar to uniprot|P39928 Saccharomyces cerevisiae
           YIL147C SLN1 Histidine kinase osmosensor that regulates
           a MAP kinase cascade; transmembrane protein with an
           intracellular kinase domain that signals to Ypd1p and
           Ssk1p, thereby forming a phosphorelay system similar to
           bacterial two-component regulators
          Length = 1155

 Score =  650 bits (1677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/727 (50%), Positives = 460/727 (63%), Gaps = 31/727 (4%)

Query: 3   LGYLRKRLAVLKPPFKAGLRTQLTXXXXXXXXXXXXXXXXTTGVYFTSNYRTLRADRLHV 62
           L  LR+R     PPF  GLRTQL                 TTGVYFT+NY+++RA+RL V
Sbjct: 11  LKALRERFT---PPFNVGLRTQLIILVCSICVLSLTIITVTTGVYFTTNYKSVRAERLQV 67

Query: 63  AARLMSSQVDQSLTLLYYQCNMLSTKDTIQNALSDYRAGNRSAENWIEADKILGGFLERS 122
           AA+L SSQVDQ+L  LYYQ   LST+DT+Q+AL ++RAGN S +NW  A+  L  FL  S
Sbjct: 68  AAQLKSSQVDQNLNYLYYQIYWLSTRDTLQDALVNFRAGNSSRDNWNSAEDSLEKFLGSS 127

Query: 123 KTFYIAYLYDEMYQEVLSRWNNDTEGSLAEESLVRLRPLEMDKYEYNEALDVQVETLP-Y 181
             F  A +YD  +  V++  NN +  ++ E  L  L PL   +   +  L   + T P Y
Sbjct: 128 GLFSAARVYDTSFNTVINSTNNGSGDNIPENVLAELFPLSGVEPLSSSLLTTGIVTDPVY 187

Query: 182 NKTLNLMSMTLPVEA--STIIGRGNVVGFLTIVMSADPITAV-NDTSVLGESMVSILTGI 238
           N T  L+SM+LPV    S I+    + G++T++ SA+ + AV NDT  L +S VSIL+ +
Sbjct: 188 NWTNYLLSMSLPVSTNPSIILNTNEIAGYITVIASAESLKAVVNDTIALDKSSVSILSAV 247

Query: 239 PNDKGNLVKYRFVFPPGETDRSVTETEYPIKNASFLRDAFLNRSDNYVTSTSSFYHFGAL 298
            +   +L  Y FVFPP  T    ++  +PIKN +F+ DAF N     V  T+        
Sbjct: 248 FDSNSSLTGYHFVFPPHGTSSFSSKVTFPIKNGTFIADAFENGKVGSVMKTNMVQE---- 303

Query: 299 GHDFKKVAVGYSACKFRQLDWVAVVSQDESVFLSPAFKLTKIIIGTVLGVAVFMCIVTFI 358
               + +AVGYS   F+ ++WVAVV+Q E VFLSP  +L KII GTV  +AVFMC++TF 
Sbjct: 304 ----RNIAVGYSPPTFKLVNWVAVVTQPEQVFLSPTIRLMKIIAGTVCAIAVFMCLLTFP 359

Query: 359 LASWAVKPIVRLQKATEFIAAGRGLRTYNHSGRSSSQNTSIDRSNSRG-SDHSLPRELFE 417
           +A WAV+PIVRLQKATE I +GR L+ Y+++G S S NT+I  S +R  S+ +   +LF 
Sbjct: 360 IAHWAVQPIVRLQKATEIITSGRDLKHYSNTGNSDS-NTAITHSRTRSTSNQNQVMKLFN 418

Query: 418 K---KHHVSPFVTENHAANSGS-CSSMSDHERYLHHIAR-----YHDGETSTNILSDHEK 468
           K   K   S ++  N+     S   S S   R    I R          T +   S+   
Sbjct: 419 KSVTKGTPSNYLNHNYNVFPPSRTDSPSVSARNSQTIPRGPGDLTRSATTGSTPFSNDSS 478

Query: 469 GSTS-----ATNWIDTRVPVYRRLFTDELSELTDTFNTMTDELDRQYVVLEDRVRARTXX 523
             TS     +TN ++  VPVYRR F DELSELTDTFNTMTDELDR Y +LE+RVRART  
Sbjct: 479 SYTSERYIKSTNLVEAYVPVYRRFFQDELSELTDTFNTMTDELDRHYALLEERVRARTKQ 538

Query: 524 XXXXXXXXXXXXXXXTVFIANIFHELRTPLNGILGMTAIAMAEQDQEKIQNSLKLIFRSG 583
                          TVFIANI HELRTPLNGILGMTAIAMAE D +K+QNSLKLIFRSG
Sbjct: 539 LEAAKIQAESANEAKTVFIANISHELRTPLNGILGMTAIAMAETDMQKVQNSLKLIFRSG 598

Query: 584 XXXXXXXXXXXXFSKNVLKRTKLEERHFSIIDIALQVKSIFGKLAKDQHVKLSIYLMPNA 643
                       FSKNVLKRTKLEER FS++DIALQ+KSIFGKLAKDQHVKLSI L PN 
Sbjct: 599 ELLLHILTELLTFSKNVLKRTKLEERDFSVMDIALQIKSIFGKLAKDQHVKLSIALTPNF 658

Query: 644 IRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGKVDVRIKLVGEYDSARSEACNFSEVYIL 703
           IRT+VLWGDSNRIIQIVMNLVSNALKFTPVDGKVDVRIKL+GEYDS RSE+ ++ EV+++
Sbjct: 659 IRTLVLWGDSNRIIQIVMNLVSNALKFTPVDGKVDVRIKLLGEYDSKRSESVDYQEVFVV 718

Query: 704 PGTEVTN 710
           PG+E  +
Sbjct: 719 PGSEAND 725

 Score =  434 bits (1115), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 209/335 (62%), Positives = 263/335 (78%), Gaps = 2/335 (0%)

Query: 766  AVLHAQLKKIPTFIDLEDSDNNVTMSKLEKPRSWVIVIEVQDTGPGIEPSLHESVFKPFV 825
            A+ H+Q KK+ +  D +  +N  T   L+ P++WVI +EV+DTG GI+PSL ESVF+PFV
Sbjct: 816  AIFHSQFKKVLSSTDSDTEEN--TFRDLKVPKTWVISMEVEDTGSGIDPSLQESVFEPFV 873

Query: 826  QGDQTLSRQYGGTGLGLSICRQLATMMKGTMKLESKVGSGSKFTFTVPLQQTGTVKFNDG 885
            QGDQTLSRQYGGTGLGLSICRQLA MMKGTMKL+SKVG GSKF FTVPLQQT  + F+  
Sbjct: 874  QGDQTLSRQYGGTGLGLSICRQLAKMMKGTMKLDSKVGVGSKFIFTVPLQQTKEIVFDGA 933

Query: 886  DTLFEDEFNIFSKKNRKVKFQLNRSGKSRKGKMNNSNGAGSIAESAIESFGKSESEASFG 945
            +  FEDEFNI S+KNRKVKF++N S KS + K + S+  G    +  E    + +E S G
Sbjct: 934  EKQFEDEFNIHSRKNRKVKFKINSSRKSVQTKKSKSSIDGHSDNNVSERKASNSTENSVG 993

Query: 946  SVRVDRPFLQSTGTATSTRSVPTLSSAESSLRILVAEDNNVNQEVIKRMLHLEGAHNIDL 1005
            +VRVDRPFLQSTGTATSTRS+ +++S  +  R+LVAEDNNVNQEVIKRML LEG  ++D+
Sbjct: 994  NVRVDRPFLQSTGTATSTRSISSVASEVTRHRVLVAEDNNVNQEVIKRMLQLEGLTDLDM 1053

Query: 1006 ACDGEDAYQKVSALVEQGEHYDLIFMDVQMPRMDGLLTTKLLRQKLHYEYPIVALTAFAD 1065
            ACDG++AY+KV  +++ GE Y +IFMDVQMPR+DGLL TK++R  L Y+ PIVALTA+AD
Sbjct: 1054 ACDGQEAYEKVEEILKNGESYSMIFMDVQMPRVDGLLATKMIRNDLLYKGPIVALTAYAD 1113

Query: 1066 DSNIKECLESGMNSFLAKPIKRPMLKKILLEHTSQ 1100
            DSNIK CLESGM+ FL KPIKRP+LKKI+ ++ S+
Sbjct: 1114 DSNIKVCLESGMDGFLPKPIKRPLLKKIIAQYCSK 1148

>NCAS0G00250 Chr7 complement(40367..43918) [3552 bp, 1183 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1183

 Score =  610 bits (1573), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/725 (47%), Positives = 454/725 (62%), Gaps = 46/725 (6%)

Query: 12  VLKPPFKAGLRTQLTXXXXXXXXXXXXXXXXTTGVYFTSNYRTLRADRLHVAARLMSSQV 71
           VLKPPF+ G+RTQLT                TTGVYFTSNY+ LR+DRL++AA+L SSQ+
Sbjct: 10  VLKPPFRLGIRTQLTVLVSVVALCSLVILAITTGVYFTSNYKNLRSDRLYIAAQLKSSQI 69

Query: 72  DQSLTLLYYQCNMLSTKDTIQNALSDYRAGNRSAENWIEADKILGGFLERSKTFYIAYLY 131
           DQ+L  LYYQ   LS++DT+Q  L++Y AGN++AENW ++++++  FL  +  F  A LY
Sbjct: 70  DQNLNYLYYQSYWLSSRDTLQIGLTNYVAGNKTAENWADSEQVIQKFLTSNNLFSNAQLY 129

Query: 132 DEMYQEVLSRWNNDTEGSLAEESLVRLRPLEMDKYEYNEALDVQVETLP------YNKTL 185
           D  +  VL+  NN T   + E  L +L PL       N+ L   +ET+        N + 
Sbjct: 130 DSSFNAVLTATNNGTGDLIPESVLKKLYPLAT-----NQPLSSSLETIGILTDPVLNGST 184

Query: 186 NLMSMTLPVEA--STIIGRGNVVGFLTIVMSADPI-TAVNDTSVLGESMVSILTGIPNDK 242
            +MSM+LP+ A  S I+    V G++TIVMSA+ + T  NDT+ L +S V+I++G+ N++
Sbjct: 185 YIMSMSLPIFANPSIILTDSKVYGYITIVMSAEGLKTVFNDTTALEQSNVAIVSGVYNNE 244

Query: 243 GNLVKYRFVFPPGETDRSVTETEYPIKNASFLRDAFLNRSDNYVTSTSSFYHFGALGHDF 302
             L  Y FVF P      V  + + I N SFL  A        V  T  FY         
Sbjct: 245 STLNAYHFVFAPYGAPSYVINSTFRIMNNSFLNTALREGKGGSVKKTKFFYT-------- 296

Query: 303 KKVAVGYSACKFRQLDWVAVVSQDESVFLSPAFKLTKIIIGTVLGVAVFMCIVTFILASW 362
           K +AVGYS C F  ++W+A+VSQDESVFLSP+ KL KII GTV+ + VF+ ++TF LA W
Sbjct: 297 KNIAVGYSPCTFSFVNWIAIVSQDESVFLSPSTKLAKIISGTVVAIGVFVFLITFPLAHW 356

Query: 363 AVKPIVRLQKATEFIAAGRGLRTYNHSGRSSSQNTSID---RSN---SRGSDHSLPRE-- 414
           AVKPIVRLQKATE ++ GRGL++     ++ S+++SI    RSN   +  S H+   +  
Sbjct: 357 AVKPIVRLQKATELMSEGRGLKSTTPGSKNVSRSSSIKHYVRSNIPSTASSVHNFSGDNL 416

Query: 415 -------LFEKKHHVSPFVTENHAANSGS-----CSSMSDHERYLHHIARYHDGETSTNI 462
                  L ++    +P  T +  + S S       S ++  +  + I+R+ D       
Sbjct: 417 STTTNGHLNQRGLTPTPMPTTDLPSPSDSNFATEMISNANTSQRANSISRFTDHTD---- 472

Query: 463 LSDHEKGSTSATNWIDTRVPVYRRLFTDELSELTDTFNTMTDELDRQYVVLEDRVRARTX 522
           LS+  K  T++ N I+ RVP YRRLF+DELS+LTDTFN MTD LD+ Y +LEDRVRART 
Sbjct: 473 LSNRSKKLTTSANLIEARVPDYRRLFSDELSDLTDTFNAMTDALDQHYALLEDRVRARTK 532

Query: 523 XXXXXXXXXXXXXXXXTVFIANIFHELRTPLNGILGMTAIAMAEQDQEKIQNSLKLIFRS 582
                           T+FIANI HELRTPLNGILGMTAI+M E D  KI++SLKLIFRS
Sbjct: 533 QLEAAKIEAETANEAKTIFIANISHELRTPLNGILGMTAISMEETDIAKIRSSLKLIFRS 592

Query: 583 GXXXXXXXXXXXXFSKNVLKRTKLEERHFSIIDIALQVKSIFGKLAKDQHVKLSIYLMPN 642
           G            FSKNVLKRT LE+R F I D+ALQ+KSIFGK+AKDQ V+LSI L+PN
Sbjct: 593 GELLLHILTELLTFSKNVLKRTTLEKRDFCITDVALQIKSIFGKVAKDQRVRLSIVLLPN 652

Query: 643 AIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGKVDVRIKLVGEYDSARSEACNFSEVYI 702
            IRTM+L+GDSNRIIQIVMNLVSNALKFTPVDGKV+VRIKL+GEYD   S   NF +V +
Sbjct: 653 IIRTMILFGDSNRIIQIVMNLVSNALKFTPVDGKVNVRIKLMGEYDENLSRESNFKKVLV 712

Query: 703 LPGTE 707
             GTE
Sbjct: 713 KSGTE 717

 Score =  412 bits (1058), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 210/363 (57%), Positives = 258/363 (71%), Gaps = 34/363 (9%)

Query: 766  AVLHAQLKKIPTFIDLEDSDNNVTMSKLEKPRSWVIVIEVQDTGPGIEPSLHESVFKPFV 825
            AV + Q KK P     ED D N+ + +L  P++WVI IEVQDTGPGI+PSL +SVF+PFV
Sbjct: 807  AVFNNQFKKTPEL--YEDEDGNLGI-ELTNPKTWVIAIEVQDTGPGIDPSLQKSVFEPFV 863

Query: 826  QGDQTLSRQYGGTGLGLSICRQLATMMKGTMKLESKVGSGSKFTFTVPLQQTGTVKFNDG 885
            QGDQTLSRQYGGTGLGLSICRQLA MM GTM+L+S+VG GS FTFTVPL QT  ++ N+ 
Sbjct: 864  QGDQTLSRQYGGTGLGLSICRQLANMMNGTMELKSEVGVGSTFTFTVPLMQTRELELNED 923

Query: 886  DTLFEDEFNIFSKKNRKVKFQL-----------------------NRSGKSRKGKM--NN 920
            D  FEDEFN  S+KNR+VKF+L                       N   +  + K+  N 
Sbjct: 924  DHPFEDEFNPASRKNRRVKFKLAKSLRSRKSRSSTTTFSTTNSLHNVQEEKEEDKLGDNE 983

Query: 921  SNGAGSIAESAIESFGKSESEAS------FGSVRVDRPFLQSTGTATSTRSVPTLSSAES 974
                G   E A +    S  + +       G+V +DRPFLQSTGTATSTR++ T+  A  
Sbjct: 984  ETKDGGKEEDAHQERRHSHDKNNEHNNHLLGTVNMDRPFLQSTGTATSTRTIQTVPDAGK 1043

Query: 975  SLRILVAEDNNVNQEVIKRMLHLEGAHNIDLACDGEDAYQKVSALVEQGEHYDLIFMDVQ 1034
              +ILVAEDN+VNQEVIKRML+LEG  NI+LA DG+DA+ +V A+VEQGEH+D+IFMDVQ
Sbjct: 1044 KFKILVAEDNHVNQEVIKRMLNLEGVENIELARDGQDAFNEVKAMVEQGEHFDMIFMDVQ 1103

Query: 1035 MPRMDGLLTTKLLRQKLHYEYPIVALTAFADDSNIKECLESGMNSFLAKPIKRPMLKKIL 1094
            MP++DGLL+TK++R  LHY YPIVALTAFADDSNIKECLE+GMN FL+KPIKRP +K IL
Sbjct: 1104 MPKVDGLLSTKMIRNDLHYTYPIVALTAFADDSNIKECLEAGMNGFLSKPIKRPKVKTIL 1163

Query: 1095 LEH 1097
             E+
Sbjct: 1164 EEY 1166

>TBLA0I01680 Chr9 (372270..375914) [3645 bp, 1214 aa] {ON} Anc_5.700
           YIL147C
          Length = 1214

 Score =  610 bits (1573), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/727 (47%), Positives = 449/727 (61%), Gaps = 44/727 (6%)

Query: 3   LGYLRKRLAVLKPPFKAGLRTQLTXXXXXXXXXXXXXXXXTTGVYFTSNYRTLRADRLHV 62
           +G  R   ++L+PP   G+RTQLT                 TG+YFT NY+ +R DRL +
Sbjct: 1   MGPSRMFRSILRPPLAIGIRTQLTALVCFVACVSLIILAVPTGIYFTVNYKHMRVDRLSI 60

Query: 63  AARLMSSQVDQSLTLLYYQCNMLSTKDTIQNALSDYRAGNRSAENWIEADKILGGFLERS 122
           AA L SSQVDQ+L  LYYQC  LS +DT+Q A+++Y AGN+S+  W ++  ++  FL  S
Sbjct: 61  AAELKSSQVDQTLNFLYYQCYWLSIRDTLQTAMANYFAGNKSSSVWYDSQVVVEKFLSSS 120

Query: 123 KTFYIAYLYDEMYQEVLSRWNNDTEGSLAEESLVRLRPLEM-DKYEYNEALDVQVETLPY 181
             F I+ LYD  +  V++  NN T   +  + L +L PL   D    +      +     
Sbjct: 121 DIFSISRLYDANFNLVMNATNNGTGNVVPNDVLAKLLPLSSSDPLPASLGSSGMLTDPVL 180

Query: 182 NKTLNLMSMTLPVEA--STIIGRGNVVGFLTIVMSADPITAV-NDTSVLGESMVSILTGI 238
           N T  LMSM+LP+ A  S I+    V G++TI+MSA+ + +V NDT+ L +S V+I++G 
Sbjct: 181 NSTTYLMSMSLPILANPSIILTDSKVYGYITIIMSAESLMSVYNDTTALEKSNVAIVSGE 240

Query: 239 PND-KGNLVKYRFVFPPGETDRSVTETEYPIKNASFLRDAFLNRSDNYVTSTSSFYHFGA 297
            +D   +L +Y FVFPP      + +  YP++N SFL DA  N+    +  T  FY+   
Sbjct: 241 YSDYSASLTEYHFVFPPYGATPKIIDIYYPLQNGSFLYDAMNNQKKGSIMKTKFFYN--- 297

Query: 298 LGHDFKKVAVGYSACKFRQLDWVAVVSQDESVFLSPAFKLTKIIIGTVLGVAVFMCIVTF 357
                  VA+GYS C F  + WVA+VSQ ESVFLSP+ KLT+II GTV+ +AVF+C VTF
Sbjct: 298 -----NDVAIGYSPCSFDLVSWVAIVSQPESVFLSPSTKLTRIIAGTVVAIAVFVCFVTF 352

Query: 358 ILASWAVKPIVRLQKATEFIAAGRGLRTYNHSGRSSSQNTSIDRSNSRGSDHSLPRELFE 417
            L+ WAVKPIVRLQKATE IA GRGLR+   S R+ S+N S+           +P     
Sbjct: 353 PLSHWAVKPIVRLQKATELIAEGRGLRS--SSNRTLSRNGSLKFGRYSIDSPIIP----- 405

Query: 418 KKHHVSP-FVTENHAANSGSCSSMSDHERYLH-------------HIARYHDGETSTNIL 463
               +SP F+  N+  +  S +   D E+  H               +R+H         
Sbjct: 406 ----ISPTFLHNNNNHHRNSSNESHDPEKLSHLSNDISKSSNSSSTGSRFH---FVCIFF 458

Query: 464 SDHEKGSTSA---TNWIDTRVPVYRRLFTDELSELTDTFNTMTDELDRQYVVLEDRVRAR 520
           S H+  +T     +  ++T+VPVYRRLF DELSELTDTFNTM+D LD+ Y +LE+RVRAR
Sbjct: 459 SSHKSSNTPPPPMSTILETKVPVYRRLFLDELSELTDTFNTMSDALDQHYALLEERVRAR 518

Query: 521 TXXXXXXXXXXXXXXXXXTVFIANIFHELRTPLNGILGMTAIAMAEQDQEKIQNSLKLIF 580
           T                 TVFIANI HELRTPLNGILGMTAI+M E D + I++SLKLIF
Sbjct: 519 TKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEEDDIDNIKSSLKLIF 578

Query: 581 RSGXXXXXXXXXXXXFSKNVLKRTKLEERHFSIIDIALQVKSIFGKLAKDQHVKLSIYLM 640
           RSG            FSKNVL+RTKLEER F I D+ALQ+KSIFGK+AKDQHVKLSIYL+
Sbjct: 579 RSGELLLHILTELLTFSKNVLQRTKLEERDFCITDVALQIKSIFGKVAKDQHVKLSIYLI 638

Query: 641 PNAIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGKVDVRIKLVGEYDSARSEACNFSEV 700
           PN IRT+VLWGDSNRIIQIVMNLVSNALKFTP+DGKV VR+ L+GEYD  +S+A ++ EV
Sbjct: 639 PNEIRTLVLWGDSNRIIQIVMNLVSNALKFTPIDGKVSVRMSLLGEYDKEKSKAADYKEV 698

Query: 701 YILPGTE 707
           ++  GTE
Sbjct: 699 FVKTGTE 705

 Score =  360 bits (925), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 213/413 (51%), Positives = 251/413 (60%), Gaps = 86/413 (20%)

Query: 767  VLHAQLKKIPTFIDLEDSDNNVTMSKLEKPRSWVIVIEVQDTGPGIEPSLHESVFKPFVQ 826
            V + Q KKI     L+D D      ++++P++WVI IEV+DTGPGI P+L ESVF+PFVQ
Sbjct: 786  VFNDQFKKI---TGLQDHDEERLGVEIKEPKTWVICIEVEDTGPGIHPALQESVFEPFVQ 842

Query: 827  GDQTLSRQYGGTGLGLSICRQLATMMKGTMKLESKVGSGSKFTFTVPLQQTGTVKFN--- 883
            GDQ LSRQYGGTGLGLSICRQLATMM GTM LESKVGSGSKFTFTVPL QT  +      
Sbjct: 843  GDQALSRQYGGTGLGLSICRQLATMMNGTMVLESKVGSGSKFTFTVPLTQTREIVIGEDE 902

Query: 884  DGDTLFEDEFNIFSKKNRKVKFQL---------NRSGKSRKGKMN-NSNGAGSI--AESA 931
            D +  F+DEFNI+SKKNRKVKF +         N S KSRK K + NS+  G I     A
Sbjct: 903  DINEFFDDEFNIYSKKNRKVKFAIPSSPGTTLANSSLKSRKSKGSLNSSFVGEIQNVNEA 962

Query: 932  IESFGKSESEASFGSVRV----------------DRPFLQSTGTATSTRSVPTLSSAESS 975
             E    S+   S G +++                DRPFLQSTGTATST  +P L    +S
Sbjct: 963  EEDAYNSKDINSSGELKIRHISTSTSNNNSIPSLDRPFLQSTGTATSTMKIPVLKDFSNS 1022

Query: 976  -----------------------------------------------LRILVAEDNNVNQ 988
                                                           +RILV EDN+VNQ
Sbjct: 1023 ATKDNVTNDEGKSDLSKKGNSGGTIIQEGVTQNNSSIIIDEEEEDEGIRILVTEDNHVNQ 1082

Query: 989  EVIKRMLHLEGAHNIDLACDGEDAYQKVSALV-----EQGEHYDLIFMDVQMPRMDGLLT 1043
            EVIKRML LE   NIDLACDGE+AY KV  +      ++  +YDLIFMDVQMPRMDGL +
Sbjct: 1083 EVIKRMLKLEKLSNIDLACDGEEAYTKVKEITSISNPKKKNYYDLIFMDVQMPRMDGLES 1142

Query: 1044 TKLLRQKLHYEYPIVALTAFADDSNIKECLESGMNSFLAKPIKRPMLKKILLE 1096
            TKL+R +L Y  PIVALTAFAD+SNIKECL+ GM+ FL+KPIKRP LK IL E
Sbjct: 1143 TKLIRSELKYTKPIVALTAFADESNIKECLDVGMDGFLSKPIKRPKLKDILNE 1195

>KLTH0E01100g Chr5 complement(106377..109910) [3534 bp, 1177 aa]
           {ON} similar to uniprot|P39928 Saccharomyces cerevisiae
           YIL147C SLN1 Histidine kinase osmosensor that regulates
           a MAP kinase cascade; transmembrane protein with an
           intracellular kinase domain that signals to Ypd1p and
           Ssk1p, thereby forming a phosphorelay system similar to
           bacterial two-component regulators
          Length = 1177

 Score =  566 bits (1459), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/745 (46%), Positives = 445/745 (59%), Gaps = 56/745 (7%)

Query: 3   LGYLRKRLAVLKPPFKAGLRTQLTXXXXXXXXXXXXXXXXTTGVYFTSNYRTLRADRLHV 62
           LG   KR   LKPPF   +RTQLT                 TGVYFTS+++++RA+RL+V
Sbjct: 9   LGAYAKR--KLKPPFLISIRTQLTALVCLVALLSLIILAVITGVYFTSSFKSMRAERLYV 66

Query: 63  AARLMSSQVDQSLTLLYYQCNMLSTKDTIQNALSDYRAGNRSAENWIEADKILGGFLERS 122
           A++L +SQ+DQ+L  LYYQC  LST+D +QNAL+ Y AGN + ENW +A   L  FL  S
Sbjct: 67  ASQLKASQIDQNLYYLYYQCYYLSTRDVLQNALTQYLAGNTTTENWADAVTTLDKFLGSS 126

Query: 123 KTFYIAYLYDEMYQEVLSRWNNDTEGSLAEESLVRLRPLEMDKYEYNEALDVQ-VETLP- 180
             F +A +YD  +Q+VL+  NN +   + E  L +L PL  +      +L+V+ + T P 
Sbjct: 127 NLFSLARVYDSSFQDVLNASNNASGNLVPESVLTQLFPLSTN-VSLPSSLEVKGMLTDPV 185

Query: 181 YNKTLNLMSMTLPVEA--STIIGRGNVVGFLTIVMSADPI-TAVNDTSVLGESMVSILTG 237
            N T  LMSM+LP+ A  S I+    V G++T+V+SA+ + T  NDT+ L +S V IL  
Sbjct: 186 LNDTGYLMSMSLPIFANPSIILSTSKVYGYITVVISAEGLKTVFNDTTALEDSSV-ILVS 244

Query: 238 IPNDKGNLVKYRFVFPPGETDRSVTETEYPIKNASFLRDAFLNRSDNYVTSTSSFYHFGA 297
              D   L  Y  VFPP      + +  Y I N SFL DAF       + ST   Y    
Sbjct: 245 TVYDNRELAGYHLVFPPYGMPSDIIDKRYTIGNDSFLMDAFKQSKGGSIKSTHFLYS--- 301

Query: 298 LGHDFKKVAVGYSACKFRQLDWVAVVSQDESVFLSPAFKLTKIIIGTVLGVAVFMCIVTF 357
                K VA+GYS C    + WVA+++Q ES FL P+ +L +II+GT + +AV  C VTF
Sbjct: 302 -----KAVAIGYSPCSSDLVQWVAIITQPESKFLYPSTRLARIIVGTCVAIAVVTCAVTF 356

Query: 358 ILASWAVKPIVRLQKATEFIAAGRGLRT------YNHSGRSSSQN-------TSIDRSNS 404
            L+ WAV+PIVRLQKATE I AGRGLR+      Y+H   S++++        SI RS S
Sbjct: 357 PLSHWAVQPIVRLQKATEIITAGRGLRSDNGSTLYSHKRSSTAESFSSALHPASIRRSGS 416

Query: 405 --RGSDH---------SLPRELFEKKHHVSPFVTENHAANSGSCSSMSDHERYLHHIARY 453
             R S H         +L +  FE+   + P   EN            + +  L  +   
Sbjct: 417 VARSSKHKYIPESAKGTLNKNDFEE---IQPDGIEN------------NEDAALQKVHSP 461

Query: 454 HDGETSTNILSDHEKGSTSATNWIDTRVPVYRRLFTDELSELTDTFNTMTDELDRQYVVL 513
             G   +   S   +   ++TN I+ RVP Y RLF+DELSELT+TFNTMTDELDR Y +L
Sbjct: 462 TPGSLFSEQRSARSERYITSTNLIEARVPTYNRLFSDELSELTETFNTMTDELDRHYALL 521

Query: 514 EDRVRARTXXXXXXXXXXXXXXXXXTVFIANIFHELRTPLNGILGMTAIAMAEQDQEKIQ 573
           EDRVRART                 TVFIANI HELRTPLNGILGMTAIAMAE D +K++
Sbjct: 522 EDRVRARTRQLEAAKIEAEGANEAKTVFIANISHELRTPLNGILGMTAIAMAENDMQKVK 581

Query: 574 NSLKLIFRSGXXXXXXXXXXXXFSKNVLKRTKLEERHFSIIDIALQVKSIFGKLAKDQHV 633
           +SLKLIFRSG            FSKNVLKRTKLEER F++ +IALQV+SIFGKLAKDQHV
Sbjct: 582 SSLKLIFRSGELLLHIMTELLTFSKNVLKRTKLEERDFTVHEIALQVESIFGKLAKDQHV 641

Query: 634 KLSIYLMPNAIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGKVDVRIKLVGEYDSARSE 693
            L+I ++PN +RTMVLWGDSNRI+QIVMNLVSNALKFTPVDG+V+V+  L+GEYD +++ 
Sbjct: 642 NLTISIIPNVLRTMVLWGDSNRIVQIVMNLVSNALKFTPVDGRVNVKFTLLGEYDESKAS 701

Query: 694 ACNFSEVYILPGTEVTNSSVNNIPT 718
              F    ++P  E    S    PT
Sbjct: 702 NGCFDRAAVVPIQESEKESSTLGPT 726

 Score =  405 bits (1040), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 206/332 (62%), Positives = 252/332 (75%), Gaps = 13/332 (3%)

Query: 766  AVLHAQLKKIPTFIDLEDSDNNVTMSKLEKPRSWVIVIEVQDTGPGIEPSLHESVFKPFV 825
            A+ H++L+K        +S  N     LE PR   I +EVQDTGPGIEP+L ESVF+PFV
Sbjct: 840  AIFHSRLRK-------GNSGENEDGRPLEHPRRLAIAMEVQDTGPGIEPALQESVFEPFV 892

Query: 826  QGDQTLSRQYGGTGLGLSICRQLATMMKGTMKLESKVGSGSKFTFTVPLQQTGTVKFNDG 885
            QGDQTLSRQYGGTGLGLSICRQLA MM G+M L+SKVG GSKFTFTVPL QT  + F + 
Sbjct: 893  QGDQTLSRQYGGTGLGLSICRQLAAMMNGSMSLDSKVGVGSKFTFTVPLTQTKELCFEED 952

Query: 886  DTLFEDEFNIFSKKNRKVKFQLNRSGKSRKGKMNNSNGAGSIAESAIESFGKSESEASFG 945
            +  FEDEFN  SKKNRKVKF+++++ K +K   ++S    S+    +     SESE S G
Sbjct: 953  ENPFEDEFNPDSKKNRKVKFKVSKNNKRKKSHSSSSGQNSSVGTPTV-----SESEVSVG 1007

Query: 946  SVRVDRPFLQSTGTATSTRSVPTLSSAESSLRILVAEDNNVNQEVIKRMLHLEGAHNIDL 1005
            SVRVDRPFLQSTGTA STRSV T S A +  ++LVAEDNNVNQEVIKRML+LEG  ++DL
Sbjct: 1008 SVRVDRPFLQSTGTALSTRSVTTTSVA-NKCKVLVAEDNNVNQEVIKRMLNLEGLDDVDL 1066

Query: 1006 ACDGEDAYQKVSALVEQGEHYDLIFMDVQMPRMDGLLTTKLLRQKLHYEYPIVALTAFAD 1065
            ACDG+DA+ KV A  E G+ YDLIFMDVQMPR+DGL  T+++R +L Y +PIVALTA+AD
Sbjct: 1067 ACDGQDAFDKVKARNEAGKFYDLIFMDVQMPRVDGLSATRMIRNELSYTHPIVALTAYAD 1126

Query: 1066 DSNIKECLESGMNSFLAKPIKRPMLKKILLEH 1097
            D NIKEC+++GMN FLAKPI+RP +K+IL E+
Sbjct: 1127 DRNIKECIDAGMNGFLAKPIRRPKIKEILSEY 1158

>TPHA0E00250 Chr5 complement(34875..38081) [3207 bp, 1068 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1068

 Score =  543 bits (1399), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 327/731 (44%), Positives = 425/731 (58%), Gaps = 52/731 (7%)

Query: 9   RLAVLKPPFKAGLRTQLTXXXXXXXXXXXXXXXXTTGVYFTSNYRTLRADRLHVAARLMS 68
           RLA   PP+   LR QL                 +TGVYFT+NY++LRA++L +AA+L S
Sbjct: 7   RLAT-SPPYPMNLRAQLITLCCIVSIISLLILSISTGVYFTNNYKSLRAEQLFIAAQLKS 65

Query: 69  SQVDQSLTLLYYQCNMLSTKDTIQNALSDYRAGNRSAENWIEADKILGGFLERSKTFYIA 128
           SQ+DQSL  LYYQ       D + +AL  Y +GN++ ENW+E+   +  FL  S  F  A
Sbjct: 66  SQLDQSLNYLYYQSIWFRDNDVLTDALIRYFSGNKTTENWVESISSVSAFLTSSSIFSRA 125

Query: 129 YLYDEMYQEVLSRWNNDTEGSLAEESLVRLRPLEMDKYEYNEALDVQVETLPY------N 182
            +YD  + E+ +  NN T   + ++ + +L PL  D     E L   + T+ +      N
Sbjct: 126 TIYDTNFMEIYNVSNNGTGAHIPDDIIRQLTPLSSD-----ERLPASIGTIGFLTDPVLN 180

Query: 183 KTLNLMSMTLPV--EASTIIGRGNVVGFLTIVMSADPITAV-NDTSVLGESMVSILTG-I 238
            +  LMS++LP+    S I+    V G++TI+  A  I AV NDT+ L  S V+I++   
Sbjct: 181 TSNYLMSLSLPIFGNPSIILSDSRVYGYVTIITGASSIVAVFNDTTALENSNVAIISAKY 240

Query: 239 PNDKGNLVKYRFVFPPGETDRSVTETEYPIKNASFLRDAFLNRSDNYVTSTSSFYHFGAL 298
            N       Y FVFPP  +D SV +  YP+ N SFL DAF   +   V+ST+ FY     
Sbjct: 241 RNSTTYADGYHFVFPPYGSDASVIDIFYPLSNNSFLFDAFTEDTTGSVSSTTFFYS---- 296

Query: 299 GHDFKKVAVGYSACKFRQLDWVAVVSQDESVFLSPAFKLTKIIIGTVLGVAVFMCIVTFI 358
                 VAVGYS C F   +WVAVVSQ ESVF S   KLTKII GTV+G+A  +C VTFI
Sbjct: 297 ----SLVAVGYSTCTFSLANWVAVVSQPESVFTSSTVKLTKIISGTVVGIAAVVCFVTFI 352

Query: 359 LASWAVKPIVRLQKATEFIAAGRGLRTY--NHSGRSSSQNTS----IDRSNSRGSDHSLP 412
           ++ + VKPI++L++ATE I+ GRGLR Y  N S R+S  NTS    ID S+  G  +   
Sbjct: 353 MSYYIVKPIIKLKQATELISRGRGLRPYYENLSDRTSQDNTSTRTTIDLSDLDGYTNEKE 412

Query: 413 RELFEKKHHVSPFVTENHAANSGSCSSMSDHERYLHHIARYHD-----GETSTNILSDHE 467
           + L        P  TE+  + S S  +       L  I  +         TSTN + +++
Sbjct: 413 KSL--------PTCTEDERSKSLSNIASKSIFTTLRKILGFSSRSGMLSPTSTNFIVNND 464

Query: 468 KGSTSATNWIDTRVPVYRRLFTDELSELTDTFNTMTDELDRQYVVLEDRVRARTXXXXXX 527
             +         RVPV+    TDEL+EL +TFN M D LD    +LE+RV+ART      
Sbjct: 465 TKTV--------RVPVHSTYITDELTELKETFNIMADSLDEHSNLLEERVKARTKELEAA 516

Query: 528 XXXXXXXXXXXTVFIANIFHELRTPLNGILGMTAIAMAEQDQEKIQNSLKLIFRSGXXXX 587
                      TVFIANI HELRTPLNGILGMTAIA+ E D EK+Q SLKLI+RSG    
Sbjct: 517 KIVAEATNEAKTVFIANISHELRTPLNGILGMTAIALEEDDNEKLQGSLKLIYRSGELLL 576

Query: 588 XXXXXXXXFSKNVLKRTKLEERHFSIIDIALQVKSIFGKLAKDQHVKLSIYLMPNAIRTM 647
                   FSKNVL++TKLE+ HF I DIALQ+KSIFGK+AKDQ V  SI + PN IRTM
Sbjct: 577 HILTELLTFSKNVLQKTKLEKIHFCIHDIALQIKSIFGKIAKDQGVNFSILISPNLIRTM 636

Query: 648 VLWGDSNRIIQIVMNLVSNALKFTPVDGKVDVRIKLVGEYDSARSEACNFSEVYILPGTE 707
           V +GDSNRIIQ++MNLVSNALKFTP+DG VDVRIKL+GEYD  +S   N+ +VYI  GT 
Sbjct: 637 VFFGDSNRIIQVIMNLVSNALKFTPIDGNVDVRIKLLGEYDEEKSSLNNYDKVYIKEGTS 696

Query: 708 VTNSSVNNIPT 718
            T  + + IPT
Sbjct: 697 FTGDN-DAIPT 706

 Score =  302 bits (774), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 155/311 (49%), Positives = 208/311 (66%), Gaps = 30/311 (9%)

Query: 793  LEKPRSWVIVIEVQDTGPGIEPSLHESVFKPFVQGDQTLSRQYGGTGLGLSICRQLATMM 852
            + KP+ WVI ++V+DTGPGI P+L +SVF+PFVQGDQTLSRQYGGTGLGLSICRQLA++M
Sbjct: 773  IPKPKKWVISVDVEDTGPGISPTLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLASIM 832

Query: 853  KGTMKLESKVGSGSKFTFTVPLQQTGTVKFNDGDTLFEDEFNIFSKKNRKVKFQLNR--- 909
             GTM+L+S  G GSKFTFTVPL Q   + F++ +  FEDEFN  SKKNRKV F+ ++   
Sbjct: 833  HGTMELDSTTGLGSKFTFTVPLLQERKIIFSETEKAFEDEFNFNSKKNRKVNFKTDKVTS 892

Query: 910  ----SGKSRKGKMNNSNGAGSIAESAIESFGKSESEASFGSVRVDRPFLQSTGTATSTRS 965
                S  + K    N+NG     ++ + +  KS++             L+ T    S  +
Sbjct: 893  RGIPSKAAEKNDDANTNG-----QTTLNAEAKSKT-------------LKPTHITISEDN 934

Query: 966  VPTLSSAESSLRILVAEDNNVNQEVIKRMLHLEGAHNIDLACDGEDAYQKVSALVEQGEH 1025
            +      +   ++L+ EDN VNQEVIKR+L LE    I+ A DG++A   V   + + + 
Sbjct: 935  ID-----QHDFKVLIVEDNMVNQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKISEKDK 989

Query: 1026 YDLIFMDVQMPRMDGLLTTKLLRQKLHYEYPIVALTAFADDSNIKECLESGMNSFLAKPI 1085
            +D+IFMD+QMP +DG   T+++R +L+Y YPIVALTAFADDSN KEC  SGMN+FLAKPI
Sbjct: 990  FDIIFMDIQMPNVDGHTATRVIRNELNYPYPIVALTAFADDSNKKECENSGMNAFLAKPI 1049

Query: 1086 KRPMLKKILLE 1096
            KR  LK+I+ E
Sbjct: 1050 KRFELKEIIKE 1060

>NDAI0F00310 Chr6 complement(66930..70709) [3780 bp, 1259 aa] {ON}
            Anc_5.700 YIL147C
          Length = 1259

 Score =  496 bits (1278), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 273/502 (54%), Positives = 324/502 (64%), Gaps = 44/502 (8%)

Query: 458  TSTNILSDHEKGST------SATNWIDTRVPVYRRLFTDELSELTDTFNTMTDELDRQYV 511
            +S  + SDH + ST      ++ N I+ RVP YRRLF+DELS+LTDTFNTMTD LD+ Y 
Sbjct: 502  SSVGVFSDHTEFSTKSGHLTTSANLIEARVPDYRRLFSDELSDLTDTFNTMTDALDQHYA 561

Query: 512  VLEDRVRARTXXXXXXXXXXXXXXXXXTVFIANIFHELRTPLNGILGMTAIAMAEQDQEK 571
            +LEDRVRART                 TVFIANI HELRTPLNGILGMTAI+M E D  K
Sbjct: 562  LLEDRVRARTKQLEAAKIEAERANEAKTVFIANISHELRTPLNGILGMTAISMEETDISK 621

Query: 572  IQNSLKLIFRSGXXXXXXXXXXXXFSKNVLKRTKLEERHFSIIDIALQVKSIFGKLAKDQ 631
            I++SLKLIFRSG            FSKNVLKRT LE+R F I D+ALQ+KSIFGK+AKDQ
Sbjct: 622  IRSSLKLIFRSGELLLHILTELLTFSKNVLKRTTLEKRDFCITDVALQIKSIFGKVAKDQ 681

Query: 632  HVKLSIYLMPNAIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGKVDVRIKLVGEYDSAR 691
             VKLSI L PN IRTMVL+GDSNRIIQIVMNLVSNALKFTPVDGKV+V++KL+GEYD A 
Sbjct: 682  RVKLSITLTPNTIRTMVLYGDSNRIIQIVMNLVSNALKFTPVDGKVNVKVKLIGEYDEAL 741

Query: 692  SEACNFSEVYILPGTEV---------TNSSV-------NNIPTVVXXXXXXXXXXP---- 731
            S   NF EVY+  GTE+         TN S+       NN  +                 
Sbjct: 742  SAKNNFKEVYVKQGTELLGCSNPIEKTNESIPSPKSENNNSSSTTSGKDTTNSETSFEDE 801

Query: 732  -TADDTPERK--KKDSEXXXXXXXX-------------XXXXXXXXXXXXAVLHAQLKKI 775
             +ADD  + K   KD+E                                 A+ ++Q KK 
Sbjct: 802  KSADDLDDEKIATKDAENENTDDTENLDEQTDSVCDNISLVSTSTSSYDDAIFNSQFKKS 861

Query: 776  PTFIDLEDSDNNVTMSKLEKPRSWVIVIEVQDTGPGIEPSLHESVFKPFVQGDQTLSRQY 835
            P   D  D +NN     +E P++WVI I V+DTGPGI+ +L ESVF+PFVQGDQTLSRQY
Sbjct: 862  PGLYD--DDENNDAGVLIEDPKTWVIQISVEDTGPGIDKTLQESVFQPFVQGDQTLSRQY 919

Query: 836  GGTGLGLSICRQLATMMKGTMKLESKVGSGSKFTFTVPLQQTGTVKFNDGDTLFEDEFNI 895
            GGTGLGLSICRQLA MM GTMKL+S+VG GS FTFTVPL+QT  + F+D +  FEDEFN 
Sbjct: 920  GGTGLGLSICRQLANMMHGTMKLKSEVGVGSTFTFTVPLKQTREINFDDMEHPFEDEFNP 979

Query: 896  FSKKNRKVKFQLNRSGKSRKGK 917
             S+KNRKVKF+L RS +S+K +
Sbjct: 980  ESRKNRKVKFKLARSIRSKKSR 1001

 Score =  326 bits (836), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 182/402 (45%), Positives = 245/402 (60%), Gaps = 13/402 (3%)

Query: 12  VLKPPFKAGLRTQLTXXXXXXXXXXXXXXXXTTGVYFTSNYRTLRADRLHVAARLMSSQV 71
           VLKPPF+ G+R QLT                TTGVYFT+NY+ LR+DRL++AA+L SSQ+
Sbjct: 8   VLKPPFRIGIRAQLTALVSIVACVSLMILAITTGVYFTANYKNLRSDRLYIAAQLKSSQI 67

Query: 72  DQSLTLLYYQCNMLSTKDTIQNALSDYRAGNRSAENWIEADKILGGFLERSKTFYIAYLY 131
           DQ+L  LYYQC  +S++DT+Q AL++Y AGN+S ENW ++  IL  FL  S  F +A +Y
Sbjct: 68  DQTLNYLYYQCYYVSSRDTLQYALTNYVAGNKSNENWADSASILQKFLSSSNLFSVAKVY 127

Query: 132 DEMYQEVLSRWNNDTEGSLAEESLVRLRPLEMDKYEYNEALDVQVETLP-YNKTLNLMSM 190
           D  +  VL+  NN T   + +  L +L PL  +    +      + T P  N +  LMSM
Sbjct: 128 DASFTTVLNVTNNGTGDQIPDSILAKLLPLSTNIPLSSSLETTGILTDPVLNSSTYLMSM 187

Query: 191 TLPVEA--STIIGRGNVVGFLTIVMSADPI-TAVNDTSVLGESMVSILTGIPNDKGNLVK 247
           +LP+ A  S I+    V G+LT+VMSA+ + T  NDT+ L +S V+I++ + N+   L  
Sbjct: 188 SLPIFANPSVILAESRVYGYLTVVMSAEGLRTVFNDTTALEKSNVAIVSAVYNNVSALTA 247

Query: 248 YRFVFPPGETDRSVTETEYPIKNASFLRDAFLNRSDNYVTSTSSFYHFGALGHDFKKVAV 307
           YRFVF P      +  + Y + N SFL  A        + ST  FY         K VA+
Sbjct: 248 YRFVFAPMGAPSYIINSTYRLTNGSFLSSALREGKGGSLKSTKFFYS--------KNVAI 299

Query: 308 GYSACKFRQLDWVAVVSQDESVFLSPAFKLTKIIIGTVLGVAVFMCIVTFILASWAVKPI 367
           GYS C F  ++WVAVVSQ ESVFLSP+ KL KII GTV+ + VF+ I+TF LA WAVKPI
Sbjct: 300 GYSPCTFSFVNWVAVVSQAESVFLSPSTKLAKIIAGTVVAIGVFVFIMTFPLAHWAVKPI 359

Query: 368 VRLQKATEFIAAGRGLRTYNHSGRSSSQNTSIDRSNSRGSDH 409
           VRLQKATE I+ GRGL++ N   RS S+N S+ +  SR + H
Sbjct: 360 VRLQKATELISEGRGLKSTNPDSRSVSRNNSL-KLPSRNTSH 400

 Score =  229 bits (584), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 106/163 (65%), Positives = 135/163 (82%), Gaps = 6/163 (3%)

Query: 947  VRVDRPFLQSTGTATSTRSVPTLSSAE------SSLRILVAEDNNVNQEVIKRMLHLEGA 1000
            V +DRPFLQSTGTATS+R+VP LS +        +++ILVAEDN+VNQEVIKRML+LEG 
Sbjct: 1094 VSLDRPFLQSTGTATSSRNVPVLSESNKDEDPAQNIKILVAEDNHVNQEVIKRMLNLEGV 1153

Query: 1001 HNIDLACDGEDAYQKVSALVEQGEHYDLIFMDVQMPRMDGLLTTKLLRQKLHYEYPIVAL 1060
            + IDLACDG++A+ KV  L EQ + Y++IFMDVQMP++DGLL+TK++R+ LHY++PIVAL
Sbjct: 1154 NKIDLACDGQEAFDKVKTLSEQNDSYNIIFMDVQMPKVDGLLSTKMIRKDLHYDHPIVAL 1213

Query: 1061 TAFADDSNIKECLESGMNSFLAKPIKRPMLKKILLEHTSQLKT 1103
            TAFADDSNIKECLESGMN FL+KPIKRP L+ I+ E+    K+
Sbjct: 1214 TAFADDSNIKECLESGMNGFLSKPIKRPKLRTIIKEYCPGWKS 1256

>TBLA0E02100 Chr5 (513016..516438) [3423 bp, 1140 aa] {ON} Anc_5.700
           YIL147C
          Length = 1140

 Score =  446 bits (1146), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 279/730 (38%), Positives = 409/730 (56%), Gaps = 30/730 (4%)

Query: 1   MRLGYLRKRLAV----LKPPFKAGLRTQLTXXXXXXXXXXXXXXXXTTGVYFTSNYRTLR 56
           MRL   + +L +    +KPP++  LR QLT                 TGVYFT++Y+ L 
Sbjct: 1   MRLPSWKIKLKMNKQTVKPPYRFSLRAQLTILVCIVAIISLTTLAIITGVYFTTHYKDLN 60

Query: 57  ADRLHVAARLMSSQVDQSLTLLYYQCNMLSTKDTIQNALSDYRAGNRSAENWIEADKILG 116
            +RL++A++L SSQ+DQ+L  LYYQC  +++++TIQ  +     G  +A   IE+  +L 
Sbjct: 61  VNRLYIASQLKSSQIDQTLNYLYYQCYWVASRNTIQTMVFSNHTGMHNASGIIESQSVLD 120

Query: 117 GFLERSKTFYIAYLYDEMYQEVLSRWNNDTEGSLAEESLVRLRPLEMDKYEYNEALD-VQ 175
            F+  S  FY   +YD+  + +++  NN++  ++    L RL PL          ++   
Sbjct: 121 KFVGTSDLFYYTMIYDKNLKSIMNSTNNESGSNVEPSILSRLLPLSSTNTTIPPLINNTG 180

Query: 176 VETLP-YNKTLNLMSMTLPVE-----ASTIIGRGNVVGFLTIVMSADPITAV-NDTSVLG 228
           + T P  N T  LMSM+LP+      A+ I  + N+ G+LT+VMSA+ + +V NDT+ L 
Sbjct: 181 ILTDPILNSTKYLMSMSLPISGPYSTATKIGNQSNIYGYLTVVMSAESLKSVFNDTAGLS 240

Query: 229 ESMVSILTGIPNDKGNLVKYRFVFPPGETDRSVTETEYPIKNASFLRDAF-LNRSDNYVT 287
           +S  ++L+ I  +      + FVFPP + D S+ +    IKN +F   AF  N+S +   
Sbjct: 241 DSTTALLSAIYTNDTLPRYFHFVFPPFDLDDSIIDERQTIKNGTFQYRAFDKNKSGSKKK 300

Query: 288 STSSFYHFGALGHDFKKVAVGYSACKFRQLDWVAVVSQDESVFLSPAFKLTKIIIGTVLG 347
                          K  A+GY+   F    WVAVV+  +  F S + KLTKII GTV+G
Sbjct: 301 VKLVNK---------KNYAIGYAPTNFPLCKWVAVVALPDHQFYSESRKLTKIICGTVVG 351

Query: 348 VAVFMCIVTFILASWAVKPIVRLQKATEFIAAGRGLRTYNHSGRSSSQNTSIDRSNSRGS 407
           +AVF+ +++  L+ WAV+PIVRLQ+A+E I   RGLR  N      S +     SN    
Sbjct: 352 IAVFVFLISLPLSYWAVQPIVRLQRASELITKRRGLRNLNDDSFDDSNDDHTYDSND--- 408

Query: 408 DHSLPRELFEKKHHVSPFVTENHAANSGSCSSMSDHERYLHHIARYHDGETST-NILSDH 466
           DH+   +L      +    +  H   SG     ++      +    ++      N L  +
Sbjct: 409 DHTYESKLISSTPTLKNSDSNIHDEKSGRTRGDANSGTLNSNNTITNNTNNKDFNRLRRN 468

Query: 467 EKGST--SATNWIDTRVPVYRRLFTDELSELTDTFNTMTDELDRQYVVLEDRVRARTXXX 524
              ST  S + + + +VPVYR+LF DEL+ELTDTFN M++ LD  Y +LE RV  RT   
Sbjct: 469 VSVSTHVSLSEFDEIQVPVYRKLFDDELTELTDTFNVMSNALDEHYALLEKRVHQRTKQL 528

Query: 525 XXXXXXXXXXXXXXTVFIANIFHELRTPLNGILGMTAIAMAEQDQEKIQNSLKLIFRSGX 584
                         TVFIANI HELRTPLNGILGMT+ ++ E D +KI++ LKLIFRSG 
Sbjct: 529 EAAKVQAEAANEAKTVFIANISHELRTPLNGILGMTSTSLEENDIKKIKDGLKLIFRSGE 588

Query: 585 XXXXXXXXXXXFSKNVLKRTKLEERHFSIIDIALQVKSIFGKLAKDQHVKLSIYLMPNA- 643
                      FSKNVL +TKLE R F+II+I  Q+K+IF KL + Q VKL I L+P   
Sbjct: 589 LLLNILTELLTFSKNVLNKTKLEYREFNIIEITSQIKTIFNKLIQLQEVKLFIRLLPKKF 648

Query: 644 IRTMVLWGDSNRIIQIVMNLVSNALKFTP-VDGKVDVRIKLVGEYDSARSEACNFSEVYI 702
           +++++ +GDSNRI+Q++MNL+SNA+KFTP V+GKV+V + L+GEYD   S+  N+S+V I
Sbjct: 649 LKSLLFYGDSNRILQVLMNLISNAIKFTPTVNGKVEVNMYLLGEYDEEESKTENYSKVCI 708

Query: 703 LPGTEVTNSS 712
            P T++   S
Sbjct: 709 KPSTQIVTES 718

 Score =  275 bits (704), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 153/326 (46%), Positives = 209/326 (64%), Gaps = 20/326 (6%)

Query: 790  MSKLEKPRSWVIVIEVQDTGPGIEPSLHESVFKPFVQGDQTLSRQYGGTGLGLSICRQLA 849
            + ++E  + WVI  EV D GPGI+ +LH+SVFKPFVQGDQTLSRQYGGTGLGLSIC+QL 
Sbjct: 821  LEQIEGNKKWVIRFEVIDNGPGIDQNLHDSVFKPFVQGDQTLSRQYGGTGLGLSICKQLC 880

Query: 850  TMMKGTMKLESKVGSGSKFTFTVPLQQTGTVKFNDGDTLFEDEFNIFSKKNRKVKFQL-- 907
             MMKGT++LES++G GSKF +T+PL Q G  K ++ D   E++ N     N  V   +  
Sbjct: 881  EMMKGTLELESELGKGSKFIYTIPLLQVGGTKKDNDDN--EEDHN--DNTNSSVDIDIIE 936

Query: 908  ----NRSGKSRKGKMNNSNGAGSIAESAIE-SFGKSESEASFGSVRVDRPFLQSTGTATS 962
                + +  S+     NS  + S  E  ++ SF ++E++++  S+  D+  LQ T     
Sbjct: 937  DTPVSITSSSQTHSDLNSLQSNSTNEVGLDDSFSEAENDSTVASL--DKSVLQKTRMDAQ 994

Query: 963  TRSVPTLSSAE-------SSLRILVAEDNNVNQEVIKRMLHLEGAHNIDLACDGEDAYQK 1015
                  +   +       S L++LVAEDN VNQEVIKRML LE   +I+LA DG +A++K
Sbjct: 995  KVEANEIDDIDHCNKGIPSKLKVLVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEK 1054

Query: 1016 VSALVEQGEHYDLIFMDVQMPRMDGLLTTKLLRQKLHYEYPIVALTAFADDSNIKECLES 1075
            V   +   + YD+IFMD+QMP+MDGL +T  +RQ+L YE  IVALTAFAD+SNIKEC ++
Sbjct: 1055 VKKNLLSYKKYDIIFMDIQMPKMDGLESTTKIRQELKYEGKIVALTAFADESNIKECRDA 1114

Query: 1076 GMNSFLAKPIKRPMLKKILLEHTSQL 1101
            GM+ F+ KPIKR  L  +L E    L
Sbjct: 1115 GMDGFIEKPIKRVALHTLLEEFQQDL 1140

>CAGL0F09097g Chr6 (898706..900598) [1893 bp, 630 aa] {ON} similar to
            uniprot|P38889 Saccharomyces cerevisiae YHR206w SKN7
            transcription factor
          Length = 630

 Score = 68.2 bits (165), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 71/142 (50%), Gaps = 7/142 (4%)

Query: 956  STGTATSTRSVPTLSSAESSLRILVAEDNNVNQEVIKRMLHLEGAHNIDLACDGEDAYQK 1015
            S+ ++++T+ V           +L+ ED++V+ ++  + L   G   + +  DG  A   
Sbjct: 385  SSNSSSTTKEVDQNIVLRKGFHVLLVEDDSVSIQLCSKFLRKYGC-TVQVVTDGLSAISN 443

Query: 1016 VSALVEQGEHYDLIFMDVQMPRMDGLLTTKLLRQKLHYEYPIVALTAFADDSNIKECLES 1075
            +         YDL+ MD+ MP +DG   T ++R     + PI+A+T   +D ++   L+ 
Sbjct: 444  LEKF-----RYDLVLMDIVMPNLDGATATSIVR-SFDNQTPIIAMTGNIEDQDLITYLQH 497

Query: 1076 GMNSFLAKPIKRPMLKKILLEH 1097
            GMN  LAKP  R  L  IL+ H
Sbjct: 498  GMNDILAKPFTRNDLHSILIRH 519

>NDAI0D03430 Chr4 (809977..811770) [1794 bp, 597 aa] {ON} Anc_4.385
          Length = 597

 Score = 67.8 bits (164), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 84/178 (47%), Gaps = 16/178 (8%)

Query: 923  GAGSIAESAIESFGKSESEASFGSVRVDRPFLQSTGTATSTRSVPTLSSAESSLRILVAE 982
            G   + E  I + G S S  S   V + +   +++ + T+T  +           +L+ E
Sbjct: 380  GILPLQEENINTTGHSVSSISKSDVDIKQ---ENSQSPTATEEL------RKGYHVLLVE 430

Query: 983  DNNVNQEVIKRMLHLEGAHNIDLACDGEDAYQKVSALVEQGEHYDLIFMDVQMPRMDGLL 1042
            D+ V+ ++  + L   G   +++  DG  A   + A       YDL+ MD+ MP +DG  
Sbjct: 431  DDAVSIQLCSKFLRKSGC-TVEVVTDGLAAISILEAF-----RYDLVLMDIVMPNLDGAT 484

Query: 1043 TTKLLRQKLHYEYPIVALTAFADDSNIKECLESGMNSFLAKPIKRPMLKKILLEHTSQ 1100
             T ++R     E PI+A+T   +D ++   L+ GM   LAKP  R  L  +L+ H S+
Sbjct: 485  ATSIIR-NFDKETPIIAMTGNIEDQDLITYLQHGMTDILAKPFTRDDLLSMLIRHLSK 541

>ADL388W Chr4 (30355..31803) [1449 bp, 482 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YHR206W (SKN7) and YJR147W
            (HMS2)
          Length = 482

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 46/159 (28%), Positives = 78/159 (49%), Gaps = 20/159 (12%)

Query: 951  RPFLQSTGTATSTRSVPTLSSAES--------SLR----ILVAEDNNVNQEVIKRMLHLE 998
            +P +   GT   T S+P   +  S        SLR    +L+ ED++V  ++  + L   
Sbjct: 282  QPHVSPLGTVAPT-SIPLAQATPSKEEANPPTSLRPGFHVLLVEDDSVCIQLCSKFLRKY 340

Query: 999  GAHNIDLACDGEDAYQKVSALVEQGEHYDLIFMDVQMPRMDGLLTTKLLRQKLHYEYPIV 1058
            G  ++++  DG  A + V         YDL+ MD+ MP +DG   T ++R     + PI+
Sbjct: 341  GC-SVEVVTDGLSAIETVEKF-----QYDLVLMDIVMPNLDGATATSVIR-SFDNQTPII 393

Query: 1059 ALTAFADDSNIKECLESGMNSFLAKPIKRPMLKKILLEH 1097
            A+T   +D ++   L+ GMN  LAKP  +  L  +L+ +
Sbjct: 394  AMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSMLVRY 432

>KLLA0A10219g Chr1 (896931..898358) [1428 bp, 475 aa] {ON} similar to
            uniprot|Q75BF2 Ashbya gossypii ADL388W ADL388Wp and some
            similarites with YHR206W uniprot|P38889 Saccharomyces
            cerevisiae
          Length = 475

 Score = 65.1 bits (157), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 39/122 (31%), Positives = 67/122 (54%), Gaps = 7/122 (5%)

Query: 976  LRILVAEDNNVNQEVIKRMLHLEGAHNIDLACDGEDAYQKVSALVEQGEHYDLIFMDVQM 1035
              +L+ ED++V  ++  + L   G  ++++  DG  A   +S L +Q   +DL+ MD+ M
Sbjct: 329  FHVLLVEDDSVCIQLCSKFLRKYGC-SVEVVTDGLSA---ISTLEKQ--RFDLVLMDIVM 382

Query: 1036 PRMDGLLTTKLLRQKLHYEYPIVALTAFADDSNIKECLESGMNSFLAKPIKRPMLKKILL 1095
            P +DG   T ++R     E PI+A+T   DD ++   L+ GMN  LAKP  +  L  +L+
Sbjct: 383  PNLDGATATSIVR-SFDNETPIIAMTGNIDDQDLVTYLQHGMNDILAKPFTKDDLHSMLI 441

Query: 1096 EH 1097
             +
Sbjct: 442  RY 443

>Ecym_7474 Chr7 (967242..968732) [1491 bp, 496 aa] {ON} similar to
            Ashbya gossypii ADL388W
          Length = 496

 Score = 65.1 bits (157), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 64/120 (53%), Gaps = 7/120 (5%)

Query: 978  ILVAEDNNVNQEVIKRMLHLEGAHNIDLACDGEDAYQKVSALVEQGEHYDLIFMDVQMPR 1037
            +L+ ED++V  ++  + L   G  ++++  DG  A + V         YDL+ MD+ MP 
Sbjct: 331  VLLVEDDSVCIQLCSKFLRKYGC-SVEVVTDGLSAIETVEKF-----QYDLVLMDIVMPN 384

Query: 1038 MDGLLTTKLLRQKLHYEYPIVALTAFADDSNIKECLESGMNSFLAKPIKRPMLKKILLEH 1097
            +DG   T ++R     + PI+A+T   +D ++   L+ GMN  LAKP  +  L  +L+ +
Sbjct: 385  LDGATATSVIRS-FDNQTPIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSMLIRY 443

>KNAG0M00180 Chr13 complement(22500..24347) [1848 bp, 615 aa] {ON}
            Anc_4.385 YJR147W
          Length = 615

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 62/122 (50%), Gaps = 7/122 (5%)

Query: 976  LRILVAEDNNVNQEVIKRMLHLEGAHNIDLACDGEDAYQKVSALVEQGEHYDLIFMDVQM 1035
              +L+ ED+ ++ ++  + L   G   + +  DG  A   +     +   YDL+ MD+ M
Sbjct: 403  FHVLLVEDDAISIQLCSKFLRKYGC-TVQVVTDGLSAITTL-----ENSRYDLVLMDIVM 456

Query: 1036 PRMDGLLTTKLLRQKLHYEYPIVALTAFADDSNIKECLESGMNSFLAKPIKRPMLKKILL 1095
            P +DG   T ++R     + PI+A+T   DD ++   L+ GMN  LAKP  R  L  +L+
Sbjct: 457  PNLDGATATSIIR-SFDNQTPIIAMTGNIDDGDLITYLQHGMNDILAKPFTRDDLHSMLI 515

Query: 1096 EH 1097
             +
Sbjct: 516  RY 517

>Smik_8.296 Chr8 (487452..489329) [1878 bp, 625 aa] {ON} YHR206W
            (REAL)
          Length = 625

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 51/187 (27%), Positives = 85/187 (45%), Gaps = 13/187 (6%)

Query: 916  GKMNNSNGAGS----IAESAIESFGKSESEASFGS-VRVDRPFLQSTGTATSTRSVPTLS 970
            G   N N AG+    ++ +AI S   + + +   S V +  P L    + T      T++
Sbjct: 315  GDNGNQNSAGNANNRMSTAAIHSNNNTNNASPAASTVSLQLPNLPDENSLTPNAQGTTVT 374

Query: 971  SAESSLRILVAEDNNVNQEVIKRMLHLEGAHNIDLACDGEDAYQKVSALVEQGEHYDLIF 1030
                   +L+ ED+ V+ ++  + L   G   + +  DG  A   +         YDL+ 
Sbjct: 375  -LRKGFHVLLVEDDAVSIQLCSKFLRKYGC-TVQVVTDGLSAISTLEKF-----RYDLVL 427

Query: 1031 MDVQMPRMDGLLTTKLLRQKLHYEYPIVALTAFADDSNIKECLESGMNSFLAKPIKRPML 1090
            MD+ MP +DG   T ++R     E PI+A+T    + ++   L+ GMN  LAKP  R  L
Sbjct: 428  MDIVMPNLDGATATSIVR-SFDNETPIIAMTGNIMNQDLITYLQHGMNDILAKPFTRDDL 486

Query: 1091 KKILLEH 1097
              IL+ +
Sbjct: 487  HSILIRY 493

>SAKL0B12408g Chr2 (1065161..1066558) [1398 bp, 465 aa] {ON} similar
            to uniprot|Q75BF2 Ashbya gossypii ADL388W ADL388Wp and
            weakly similar to YHR206W uniprot|P38889 Saccharomyces
            cerevisiae
          Length = 465

 Score = 62.4 bits (150), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 64/122 (52%), Gaps = 7/122 (5%)

Query: 976  LRILVAEDNNVNQEVIKRMLHLEGAHNIDLACDGEDAYQKVSALVEQGEHYDLIFMDVQM 1035
              +L+ ED++V  ++  + L L+   ++++  DG  A   +         YDL+ MD+ M
Sbjct: 307  FHVLLVEDDSVCIQLCSKFL-LKYGCSVEVVTDGLSAISTLEKF-----RYDLVLMDIVM 360

Query: 1036 PRMDGLLTTKLLRQKLHYEYPIVALTAFADDSNIKECLESGMNSFLAKPIKRPMLKKILL 1095
            P +DG   T ++R     + PI+A+T   +D ++   LE GMN  LAKP  +  L  +L+
Sbjct: 361  PNLDGATATSIVRS-FDNQTPIIAMTGNIEDQDLVTYLEHGMNDILAKPFTKDDLHSMLI 419

Query: 1096 EH 1097
             +
Sbjct: 420  RY 421

>KAFR0B06990 Chr2 (1455520..1457157) [1638 bp, 545 aa] {ON} Anc_4.385
            YJR147W
          Length = 545

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 62/122 (50%), Gaps = 7/122 (5%)

Query: 976  LRILVAEDNNVNQEVIKRMLHLEGAHNIDLACDGEDAYQKVSALVEQGEHYDLIFMDVQM 1035
              +L+ ED+ ++ ++  + L   G   +++  DG  A   +         YDL+ MD+ M
Sbjct: 353  FHVLLVEDDAISIQLCSKFLRKYGC-TVEVVTDGLSAISTLEKF-----RYDLVLMDIVM 406

Query: 1036 PRMDGLLTTKLLRQKLHYEYPIVALTAFADDSNIKECLESGMNSFLAKPIKRPMLKKILL 1095
            P +DG   T ++R     + PI+A+T   +D ++   L+ GMN  LAKP  R  L  +L+
Sbjct: 407  PNLDGATATSIIR-SFDNQTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTRDDLHSMLI 465

Query: 1096 EH 1097
             +
Sbjct: 466  RY 467

>YHR206W Chr8 (512732..514600) [1869 bp, 622 aa] {ON}  SKN7Nuclear
            response regulator and transcription factor; physically
            interacts with the Tup1-Cyc8 complex and recruits Tup1p
            to its targets; part of a branched two-component
            signaling system; required for optimal induction of
            heat-shock genes in response to oxidative stress;
            involved in osmoregulation
          Length = 622

 Score = 61.6 bits (148), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 39/122 (31%), Positives = 63/122 (51%), Gaps = 7/122 (5%)

Query: 976  LRILVAEDNNVNQEVIKRMLHLEGAHNIDLACDGEDAYQKVSALVEQGEHYDLIFMDVQM 1035
              +L+ ED+ V+ ++  + L   G   + +  DG  A   +S L  +   YDL+ MD+ M
Sbjct: 377  FHVLLVEDDAVSIQLCSKFLRKYGC-TVQVVSDGLSA---ISTL--EKYRYDLVLMDIVM 430

Query: 1036 PRMDGLLTTKLLRQKLHYEYPIVALTAFADDSNIKECLESGMNSFLAKPIKRPMLKKILL 1095
            P +DG   T ++R     E PI+A+T    + ++   L+ GMN  LAKP  R  L  IL+
Sbjct: 431  PNLDGATATSIVR-SFDNETPIIAMTGNIMNQDLITYLQHGMNDILAKPFTRDDLHSILI 489

Query: 1096 EH 1097
             +
Sbjct: 490  RY 491

>TDEL0D00320 Chr4 complement(53243..54886) [1644 bp, 547 aa] {ON}
            Anc_4.385 YJR147W
          Length = 547

 Score = 61.2 bits (147), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 54/210 (25%), Positives = 92/210 (43%), Gaps = 34/210 (16%)

Query: 906  QLNRSGKSRKGKMNNSNGAGSIAESAIESFGKSESEASF--GSVRVDRPFLQSTGTATST 963
            Q+NR G   KG +N             +SF    + AS   G++ +  P    +G A   
Sbjct: 255  QMNRGGNLSKGALNEHKPQ--------KSFDLDTAAASMVPGTMPLAAPS-HPSGAAPGD 305

Query: 964  RSVPT-----------LSSAESSL-----RILVAEDNNVNQEVIKRMLHLEGAHNIDLAC 1007
             S+P            L + ++S+      +L+ ED+ V  ++  + L   G   +++  
Sbjct: 306  LSLPLAHITASKPPGGLDTNDTSVLKEGFHVLLVEDDAVCIQLCSKFLRKYGC-TVEVVT 364

Query: 1008 DGEDAYQKVSALVEQGEHYDLIFMDVQMPRMDGLLTTKLLRQKLHYEYPIVALTAFADDS 1067
            DG  A   +         YDL+ MD+ MP +DG   T ++R       PI+A+T   +D 
Sbjct: 365  DGLSAISTLEKF-----RYDLVLMDIVMPNLDGATATSIVR-SFDNHTPIIAMTGNIEDQ 418

Query: 1068 NIKECLESGMNSFLAKPIKRPMLKKILLEH 1097
            ++   L+ GMN  LAKP  +  L  +L+ +
Sbjct: 419  DLITYLQHGMNDILAKPFTKDDLHSMLIRY 448

>NCAS0A06450 Chr1 (1273459..1275288) [1830 bp, 609 aa] {ON} Anc_4.385
          Length = 609

 Score = 61.2 bits (147), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 66/130 (50%), Gaps = 11/130 (8%)

Query: 972  AESSLR----ILVAEDNNVNQEVIKRMLHLEGAHNIDLACDGEDAYQKVSALVEQGEHYD 1027
            A++ LR    +L+ ED+ V+  +  + L   G   +++  DG  A   +         YD
Sbjct: 373  AQAVLRPGFHVLLVEDDAVSIRLCSKFLRKYGC-TVEVVTDGLSAISTLEKF-----RYD 426

Query: 1028 LIFMDVQMPRMDGLLTTKLLRQKLHYEYPIVALTAFADDSNIKECLESGMNSFLAKPIKR 1087
            L+ MD+ MP +DG   T ++R     + PI+A+T   +D ++   L+ GMN  LAKP  +
Sbjct: 427  LVLMDIVMPNLDGATATSIIR-NFDNQTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTK 485

Query: 1088 PMLKKILLEH 1097
              L  +L+ +
Sbjct: 486  DDLHSMLIRY 495

>KLTH0D17182g Chr4 complement(1424948..1426342) [1395 bp, 464 aa] {ON}
            similar to uniprot|P38889 Saccharomyces cerevisiae
            YHR206W
          Length = 464

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 62/122 (50%), Gaps = 7/122 (5%)

Query: 976  LRILVAEDNNVNQEVIKRMLHLEGAHNIDLACDGEDAYQKVSALVEQGEHYDLIFMDVQM 1035
              +L+ ED+++  ++  + L   G   +++  DG  A   +         YDL+ MD+ M
Sbjct: 305  FHVLLVEDDSICIQLCSKFLMKYGC-TVEVVTDGLSAISTLEKF-----RYDLVLMDIVM 358

Query: 1036 PRMDGLLTTKLLRQKLHYEYPIVALTAFADDSNIKECLESGMNSFLAKPIKRPMLKKILL 1095
            P +DG   T ++R     + PI+A+T   +D ++   L+ GMN  LAKP  +  L  +L+
Sbjct: 359  PNLDGATATSIVRS-FDNQTPIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSMLI 417

Query: 1096 EH 1097
             +
Sbjct: 418  RY 419

>Suva_15.412 Chr15 (719438..721291) [1854 bp, 617 aa] {ON} YHR206W
            (REAL)
          Length = 617

 Score = 61.2 bits (147), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 60/122 (49%), Gaps = 7/122 (5%)

Query: 976  LRILVAEDNNVNQEVIKRMLHLEGAHNIDLACDGEDAYQKVSALVEQGEHYDLIFMDVQM 1035
              +L+ ED+ V+ ++  + L   G   + +  DG  A   +         YDL+ MD+ M
Sbjct: 378  FHVLLVEDDAVSIQLCSKFLRKYGC-TVQVVTDGLSAISTLEKF-----RYDLVLMDIVM 431

Query: 1036 PRMDGLLTTKLLRQKLHYEYPIVALTAFADDSNIKECLESGMNSFLAKPIKRPMLKKILL 1095
            P +DG   T ++R     E PI+A+T    + ++   L+ GMN  LAKP  R  L  IL+
Sbjct: 432  PNLDGATATSIVR-SFDNETPIIAMTGNIMNQDLITYLQHGMNDILAKPFTRDDLHSILI 490

Query: 1096 EH 1097
             +
Sbjct: 491  RY 492

>Skud_8.273 Chr8 (481627..483498) [1872 bp, 623 aa] {ON} YHR206W
            (REAL)
          Length = 623

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 60/122 (49%), Gaps = 7/122 (5%)

Query: 976  LRILVAEDNNVNQEVIKRMLHLEGAHNIDLACDGEDAYQKVSALVEQGEHYDLIFMDVQM 1035
              +L+ ED+ V+ ++  + L   G   + +  DG  A   +         YDL+ MD+ M
Sbjct: 379  FHVLLVEDDVVSIQLCSKFLRKYGC-TVQVVTDGLSAISTLEKF-----RYDLVLMDIVM 432

Query: 1036 PRMDGLLTTKLLRQKLHYEYPIVALTAFADDSNIKECLESGMNSFLAKPIKRPMLKKILL 1095
            P +DG   T ++R     E PI+A+T    + ++   L+ GMN  LAKP  R  L  IL+
Sbjct: 433  PNLDGATATSIVR-SFDNETPIIAMTGNIMNQDLITYLQHGMNDILAKPFTRDDLHSILI 491

Query: 1096 EH 1097
             +
Sbjct: 492  RY 493

>ZYRO0G00484g Chr7 complement(35793..37736) [1944 bp, 647 aa] {ON}
            similar to uniprot|P38889 Saccharomyces cerevisiae
            YHR206W
          Length = 647

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 60/122 (49%), Gaps = 7/122 (5%)

Query: 976  LRILVAEDNNVNQEVIKRMLHLEGAHNIDLACDGEDAYQKVSALVEQGEHYDLIFMDVQM 1035
              +L+ ED+ V  ++  + L   G   +++  DG  A   +         YDL+ MD+ M
Sbjct: 376  FHVLLVEDDAVCIQLCSKFLRKYGC-TVEVVTDGLAAISTLEKF-----RYDLVLMDIVM 429

Query: 1036 PRMDGLLTTKLLRQKLHYEYPIVALTAFADDSNIKECLESGMNSFLAKPIKRPMLKKILL 1095
            P +DG   T ++R       PI+A+T   +D ++   L+ GMN  LAKP  +  L  +L+
Sbjct: 430  PNLDGATATSIVR-SFDIHTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTKDDLHSMLI 488

Query: 1096 EH 1097
             +
Sbjct: 489  RY 490

>TBLA0A10700 Chr1 (2646036..2647799) [1764 bp, 587 aa] {ON} Anc_4.385
            YJR147W
          Length = 587

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 64/122 (52%), Gaps = 7/122 (5%)

Query: 976  LRILVAEDNNVNQEVIKRMLHLEGAHNIDLACDGEDAYQKVSALVEQGEHYDLIFMDVQM 1035
              +L+ ED+ V  ++  + L   G   + +  DG  A   +S L  +   +DL+ MD+ M
Sbjct: 416  FHVLLVEDDEVCIQLCSKFLRKYGC-TVRVVTDGLTA---ISVL--ENHRFDLVLMDIVM 469

Query: 1036 PRMDGLLTTKLLRQKLHYEYPIVALTAFADDSNIKECLESGMNSFLAKPIKRPMLKKILL 1095
            P +DG   T ++R   +Y  PI+A+T   +D ++   L+ GMN  LAKP  +  L  +L+
Sbjct: 470  PNLDGATATSIVRNFDNYT-PIIAMTGNIEDQDLITYLQHGMNDILAKPFTKRDLHSMLV 528

Query: 1096 EH 1097
             +
Sbjct: 529  RY 530

>Kwal_47.16770 s47 (103208..104593) [1386 bp, 461 aa] {ON} YHR206W
            (SKN7) - transcription factor involved in oxidative
            stress response [contig 376] FULL
          Length = 461

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 64/122 (52%), Gaps = 7/122 (5%)

Query: 976  LRILVAEDNNVNQEVIKRMLHLEGAHNIDLACDGEDAYQKVSALVEQGEHYDLIFMDVQM 1035
              +L+ ED+++  ++  + L ++ A  +++  DG  A   +         +DL+ MD+ M
Sbjct: 302  FHVLLVEDDSICIQLCSKFL-MKYACTVEVVTDGLSAISTLEKF-----RFDLVLMDIVM 355

Query: 1036 PRMDGLLTTKLLRQKLHYEYPIVALTAFADDSNIKECLESGMNSFLAKPIKRPMLKKILL 1095
            P +DG   T ++R     + PI+A+T   +D ++   L+ GMN  LAKP  +  L  +L+
Sbjct: 356  PNLDGATATSIVR-SFDNQTPIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSMLI 414

Query: 1096 EH 1097
             +
Sbjct: 415  RY 416

>Kpol_265.2 s265 (9842..11491) [1650 bp, 549 aa] {ON} (9842..11491)
            [1650 nt, 550 aa]
          Length = 549

 Score = 58.5 bits (140), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 63/122 (51%), Gaps = 7/122 (5%)

Query: 976  LRILVAEDNNVNQEVIKRMLHLEGAHNIDLACDGEDAYQKVSALVEQGEHYDLIFMDVQM 1035
              +L+ ED++V+ ++  + L   G   + +  DG  A   +S L  +   +DL+ MD+ M
Sbjct: 382  FHVLLVEDDDVSIQLCSKFLRKYGC-TVQVVTDGLAA---ISIL--EKFRFDLVLMDIVM 435

Query: 1036 PRMDGLLTTKLLRQKLHYEYPIVALTAFADDSNIKECLESGMNSFLAKPIKRPMLKKILL 1095
            P +DG   T ++R       PI+A+T   +  ++   L+ GMN  LAKP  R  L  IL+
Sbjct: 436  PNLDGATATSIIRN-FDNRTPIIAMTGSIEHQDLITYLQHGMNDILAKPFTRKDLYSILI 494

Query: 1096 EH 1097
             +
Sbjct: 495  RY 496

>TPHA0C00150 Chr3 complement(15029..16561) [1533 bp, 510 aa] {ON}
            Anc_4.385 YJR147W
          Length = 510

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 61/119 (51%), Gaps = 7/119 (5%)

Query: 976  LRILVAEDNNVNQEVIKRMLHLEGAHNIDLACDGEDAYQKVSALVEQGEHYDLIFMDVQM 1035
              +L+ ED+ V+ ++  + L   G   + +  DG  A   +S L  +   +DL+ MD+ M
Sbjct: 350  FNVLLVEDDEVSIQLCSKFLIKYGC-TVQVVTDGLAA---ISTL--EKYRFDLVLMDIVM 403

Query: 1036 PRMDGLLTTKLLRQKLHYEYPIVALTAFADDSNIKECLESGMNSFLAKPIKRPMLKKIL 1094
            P +DG   T ++R     E PI+A+T   +  ++   L+ GMN  LAKP  R  L  +L
Sbjct: 404  PNLDGATATSIIRN-FDNETPIIAMTGSIEHQDLITYLQHGMNDILAKPFTRRDLYSML 461

>Suva_10.84 Chr10 complement(167272..169359) [2088 bp, 695 aa] {ON}
            YLR006C (REAL)
          Length = 695

 Score = 55.1 bits (131), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 68/258 (26%), Positives = 108/258 (41%), Gaps = 55/258 (21%)

Query: 876  QTGTVKFNDGDTLFEDEFNIFSKKNRKVKFQLNRSG--------KSRKGKMNNSNGAGSI 927
            Q   V + D DT+   E  + ++   +    L+ SG        + ++ K N +  +  +
Sbjct: 388  QNKPVPYTDSDTILHSERAVDTESLLQESGPLDESGVGLNQPLAEDQRRKHNITPTSPIL 447

Query: 928  AESAIESFGKSESEASFGSVRVDRPFLQSTGTATSTRSVPTLSSAESSLRILVAEDNNVN 987
            A S    +  S   A F       P L +  T TS +  P ++       +L+ EDN +N
Sbjct: 448  ANSQTPHY--SIYNAPFAVSSPPDP-LPNLFTTTSEKVFPKIN-------VLIVEDNVIN 497

Query: 988  QEVIKRMLHLEGAHNID--LACDGEDAYQKVSALVEQGEHYDLIFMDVQMPRMDGLLTTK 1045
            Q ++   L     H I   LA +G++A   V+   E G H  LIFMD+Q+P + G+   K
Sbjct: 498  QAILGSFLR---KHKISYKLAKNGQEA---VNIWKEGGLH--LIFMDLQLPVLSGIEAAK 549

Query: 1046 LLR-----------QKLHYEYP----------------IVALTAFADDSNIKECLESGMN 1078
             +R           + L+  YP                IVALTA     + ++ L SG N
Sbjct: 550  QIRDFEKQNGIGIQKSLNNSYPNHEKLPCKKFSQAPVIIVALTASNSQMDKRKALVSGCN 609

Query: 1079 SFLAKPIKRPMLKKILLE 1096
             +L KP+    L K + E
Sbjct: 610  DYLTKPVNLHWLSKKITE 627

>KNAG0B05140 Chr2 (985361..987307) [1947 bp, 648 aa] {ON} Anc_5.230
            YLR006C
          Length = 648

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 83/176 (47%), Gaps = 22/176 (12%)

Query: 930  SAIESFGKSESEASFGSVRVDRPFLQSTGTATSTRSVPTLSSAESSLRILVAEDNNVNQE 989
            + +E   + ++     S+ +    + + GT TST +     +    + +L+ EDN +NQ 
Sbjct: 476  TTVEPTVRPQTPIKLSSLPIALKTIPNNGTNTSTSA-----NVFPKINVLIVEDNVINQA 530

Query: 990  VIKRMLHLEGAHNID--LACDGEDAYQKVSALVEQGEHYDLIFMDVQMPRMDGLLTTKLL 1047
            ++   L     H I   +A +G++A   V    E G H  LIFMD+Q+P + G+   K +
Sbjct: 531  ILGSFLR---KHKISYKVAKNGKEA---VDIWKEGGLH--LIFMDLQLPVLSGIDAAKQI 582

Query: 1048 R-----QKLHYEYP--IVALTAFADDSNIKECLESGMNSFLAKPIKRPMLKKILLE 1096
            R     +      P  IVALTA     + ++ L SG N +L KP+    L K + E
Sbjct: 583  RDCEKKRTASQNAPVIIVALTASNSIEDKRKALISGCNDYLTKPVNLHWLSKKITE 638

>Kwal_33.15288 s33 complement(1045147..1046910) [1764 bp, 587 aa] {ON}
            YLR006C (SSK1) - Two-component signal transducer that
            with Sln1p regulates osmosensing MAP kinase
            cascade(suppressor of sensor kinase) [contig 94] FULL
          Length = 587

 Score = 53.5 bits (127), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 51/172 (29%), Positives = 76/172 (44%), Gaps = 30/172 (17%)

Query: 948  RVDRPFLQSTGTATSTRSVPTLSSAESSLRILVAEDNNVNQEVIKRMLHLEGAHNIDLAC 1007
            R D PFL+S     +T S+ T       + +LV EDN +NQ ++   L     H I    
Sbjct: 392  REDSPFLRSAMETFTTESI-TRDKVFPKISVLVVEDNMINQTILSSFLR---KHKISYKV 447

Query: 1008 DGEDAYQKVSALVEQGEHYDLIFMDVQMPRMDGLLTTKLLR--QKLH------------- 1052
              ++  + V    E G H  LI MD++MP + G+   K +R  +KL+             
Sbjct: 448  -AKNGIEAVDRWKEGGMH--LILMDLEMPLLSGIDAAKEIRRLEKLNGIGSGKPSTGEHA 504

Query: 1053 ------YEYP--IVALTAFADDSNIKECLESGMNSFLAKPIKRPMLKKILLE 1096
                   + P  IVALTA    S+  E L +G N +L KP+    L + + E
Sbjct: 505  PAKRSTSKAPVIIVALTASNSQSDKTEALLAGCNDYLTKPVNLDWLTRKITE 556

>KAFR0J00700 Chr10 (127858..129720) [1863 bp, 620 aa] {ON} Anc_5.230
            YLR006C
          Length = 620

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 63/129 (48%), Gaps = 17/129 (13%)

Query: 976  LRILVAEDNNVNQEVIKRMLHLEGAHNID--LACDGEDAYQKVSALVEQGEHYDLIFMDV 1033
            + +L+ EDN +NQ ++   L     H I   +A +G++A   V      G H  LIFMD+
Sbjct: 475  INVLIVEDNVINQAILGGFLR---KHKISYKVAKNGKEA---VEMWKNGGLH--LIFMDL 526

Query: 1034 QMPRMDGLLTTKLLRQKLHYEYP------IVALTAFADDSNIKECLESGMNSFLAKPIKR 1087
            Q+P + G+   K +R     E P      IVALTA     + +  L SG N +L KP+  
Sbjct: 527  QLPVLSGIDAAKQIRD-FEKERPSCAPVIIVALTASNSAEDKRNALVSGCNDYLTKPVNL 585

Query: 1088 PMLKKILLE 1096
              L K + E
Sbjct: 586  HWLSKKITE 594

>Ecym_5077 Chr5 (166792..169179) [2388 bp, 795 aa] {ON} similar to
            Ashbya gossypii ADR343C
          Length = 795

 Score = 53.5 bits (127), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 43/140 (30%), Positives = 67/140 (47%), Gaps = 38/140 (27%)

Query: 976  LRILVAEDNNVNQEVIKRMLHLEGAHNI--DLACDGEDAYQKVSALVEQGEHYDLIFMDV 1033
            + +L+ EDN +NQ ++   L     H I  ++A +G +A +K     + G H  LI MD+
Sbjct: 549  INVLIVEDNIINQAILVSFLK---RHRISYEIAKNGAEAVEK---WRQGGIH--LILMDL 600

Query: 1034 QMPRMDGLLTTKLLR--------QKLH------------------YEYP--IVALTAFAD 1065
            Q+P + GL  TK +R         K H                  +  P  IVALTAF+ 
Sbjct: 601  QLPLLSGLEATKQIRDMEKLNGINKFHKSDLKPGRDTSLDLDRSKFRSPVIIVALTAFSS 660

Query: 1066 DSNIKECLESGMNSFLAKPI 1085
             ++ +E L +G N +L KP+
Sbjct: 661  HADRREALVAGCNDYLTKPV 680

>Smik_12.68 Chr12 complement(148821..150959) [2139 bp, 712 aa] {ON}
            YLR006C (REAL)
          Length = 712

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 69/150 (46%), Gaps = 37/150 (24%)

Query: 976  LRILVAEDNNVNQEVIKRMLHLEGAHNID--LACDGEDAYQKVSALVEQGEHYDLIFMDV 1033
            + +L+ EDN +NQ ++   L     H I   LA +G++A   V+   E G H  LIFMD+
Sbjct: 503  INVLIVEDNVINQAILGSFLR---KHKISYKLAKNGQEA---VNIWKEGGLH--LIFMDL 554

Query: 1034 QMPRMDGLLTTKLLR----------QKL----HYEYP-------------IVALTAFADD 1066
            Q+P + G+   K +R          QK     HY +              IVALTA    
Sbjct: 555  QLPVLSGIEAAKQIRDFEKQNGIGIQKTPNNSHYNFEKSASKRFSQAPVIIVALTASNSQ 614

Query: 1067 SNIKECLESGMNSFLAKPIKRPMLKKILLE 1096
             + ++ L SG N +L KP+    L K + E
Sbjct: 615  MDKRKALLSGCNDYLTKPVNLHWLSKKITE 644

>ZYRO0A11154g Chr1 (893793..896123) [2331 bp, 776 aa] {ON} similar to
            uniprot|Q07084 Saccharomyces cerevisiae YLR006C SSK1
            Cytoplasmic response regulator part of a two- component
            signal transducer that mediates osmosensing via a
            phosphorelay mechanism dephosphorylated form is degraded
            by the ubiquitin-proteasome system potential Cdc28p
            substrate
          Length = 776

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 49/169 (28%), Positives = 77/169 (45%), Gaps = 45/169 (26%)

Query: 945  GSVRVDRPFLQSTGTATSTRSVPTLSSAESSLRILVAEDNNVNQEVIKRMLHLEGAHNI- 1003
            GS R ++PF     +ATS +  P ++       +L+ EDN +NQ ++   L     H I 
Sbjct: 543  GSSR-EKPF-PGEWSATSDKVFPKIN-------VLIVEDNVINQTILSSFLR---KHKIF 590

Query: 1004 -DLACDGEDAYQKVSALVEQGEHYDLIFMDVQMPRMDGLLTTKLLRQ------------- 1049
              +A +G++A   +    E G H  LIFMD+Q+P + G+   K +R+             
Sbjct: 591  YKVAKNGQEA---IDVWREGGIH--LIFMDLQLPVLSGIDAAKKIRELEREHGIGIQKSR 645

Query: 1050 -------------KLHYEYPIVALTAFADDSNIKECLESGMNSFLAKPI 1085
                         +++    IVA TA    S+ KE L SG N +L KP+
Sbjct: 646  KTPHIESNKINKDQINAPVIIVAFTASKSQSDKKEALISGCNDYLTKPV 694

>YLR006C Chr12 complement(161755..163893) [2139 bp, 712 aa] {ON}
            SSK1Cytoplasmic response regulator; part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism; required for mitophagy;
            dephosphorylated form is degraded by the
            ubiquitin-proteasome system; potential Cdc28p substrate
          Length = 712

 Score = 52.4 bits (124), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 64/252 (25%), Positives = 103/252 (40%), Gaps = 53/252 (21%)

Query: 882  FNDGDTLFEDEFNIFSKKNRKVKFQLNRSG--------KSRKGKMNNSNGAGSIAESAIE 933
            FN+ DT+   E  + +    +    LN +G        + ++ K + +  +  +  S   
Sbjct: 410  FNNEDTITHSELEVNTGSPSQESGSLNEAGIGITQPMSEVQRRKEDVTPASPILTSSQTP 469

Query: 934  SFGKSESEASFGSVRVDRPFLQSTGTATSTRSVPTLSSAESSLRILVAEDNNVNQEVIKR 993
             +  S   A F       P L +  T TS +  P ++       +L+ EDN +NQ ++  
Sbjct: 470  HYSNSLYNAPFAVSSPPDP-LPNLFTTTSEKVFPKIN-------VLIVEDNVINQAILGS 521

Query: 994  MLHLEGAHNID--LACDGEDAYQKVSALVEQGEHYDLIFMDVQMPRMDGLLTTKLLR--- 1048
             L     H I   LA +G++A   V+   E G H  LIFMD+Q+P + G+   K +R   
Sbjct: 522  FLR---KHKISYKLAKNGQEA---VNIWKEGGLH--LIFMDLQLPVLSGIEAAKQIRDFE 573

Query: 1049 ----------------------QKLHYEYP--IVALTAFADDSNIKECLESGMNSFLAKP 1084
                                   K   + P  IVALTA     + ++ L SG N +L KP
Sbjct: 574  KQNGIGIQKSLNNSHSNLEKGTSKRFSQAPVIIVALTASNSQMDKRKALLSGCNDYLTKP 633

Query: 1085 IKRPMLKKILLE 1096
            +    L K + E
Sbjct: 634  VNLHWLSKKITE 645

>KLTH0B02684g Chr2 (207260..209047) [1788 bp, 595 aa] {ON} some
            similarities with uniprot|Q07084 Saccharomyces cerevisiae
            YLR006C SSK1 Cytoplasmic response regulator part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism dephosphorylated form is
            degraded by the ubiquitin-proteasome system potential
            Cdc28p substrate
          Length = 595

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/171 (28%), Positives = 75/171 (43%), Gaps = 29/171 (16%)

Query: 948  RVDRPFLQSTGTATSTRSVPTLSSAESSLRILVAEDNNVNQEVIKRMLHLEGAHNIDLAC 1007
            R   PF+ S   + +T S+ T       + +LV EDN +NQ ++   L     H   +A 
Sbjct: 379  REGSPFILSAMESVTTESI-TRDKVFPKISVLVVEDNMINQAILSSFLRKHKIH-YKVAK 436

Query: 1008 DGEDAYQKVSALVEQGEHYDLIFMDVQMPRMDGLLTTKLLRQ------------------ 1049
            +G +A   V    E G H  LI MD++MP + G+   K +R+                  
Sbjct: 437  NGVEA---VDRWKEGGMH--LILMDLEMPLLSGIDAAKEIRKLEKQNGIGTGDPLGKHAE 491

Query: 1050 --KLHYEYP--IVALTAFADDSNIKECLESGMNSFLAKPIKRPMLKKILLE 1096
               L  + P  IVALTA    ++  E L +G N +L KP+    L + + E
Sbjct: 492  LKGLTCKAPVIIVALTASNSQTDKTEALLAGCNDYLTKPVNLDWLTRKITE 542

>TPHA0N00850 Chr14 complement(189011..191023) [2013 bp, 670 aa] {ON}
            Anc_5.230 YLR006C
          Length = 670

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 46/152 (30%), Positives = 69/152 (45%), Gaps = 38/152 (25%)

Query: 975  SLRILVAEDNNVNQEVIKRMLHLEGAHNID--LACDGEDAYQKVSALVEQGEHYDLIFMD 1032
            ++ +L+ EDN +NQ ++   L     H I   +A +G +A +K     E G H  LIFMD
Sbjct: 470  NITVLIVEDNVINQTILASFLR---KHKISYRIAKNGREAVEKWK---EGGIH--LIFMD 521

Query: 1033 VQMPRMDGLLTTKLLR--QKLH-------------------YEYPI-------VALTAFA 1064
            +Q+P M G+   K +R  +KL                     E P+       VA TA  
Sbjct: 522  LQLPVMSGIDAAKEIRECEKLKGIGIRNPMASSSSLSIVESVEKPVLGAPVIMVAFTASN 581

Query: 1065 DDSNIKECLESGMNSFLAKPIKRPMLKKILLE 1096
              ++ +E L SG N +L KP+    L K + E
Sbjct: 582  SLTDKREALVSGCNDYLTKPVNLHWLSKKITE 613

>Skud_12.72 Chr12 complement(153012..155120) [2109 bp, 702 aa] {ON}
            YLR006C (REAL)
          Length = 702

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 45/150 (30%), Positives = 67/150 (44%), Gaps = 37/150 (24%)

Query: 976  LRILVAEDNNVNQEVIKRMLHLEGAHNID--LACDGEDAYQKVSALVEQGEHYDLIFMDV 1033
            + +L+ EDN +NQ ++   L     H I   LA +G++A   V+   E G H  LIFMD+
Sbjct: 493  INVLIVEDNVINQAILGSFLR---KHKISYKLAKNGQEA---VNIWKEGGLH--LIFMDL 544

Query: 1034 QMPRMDGLLTTKLLRQ-------------------------KLHYEYP--IVALTAFADD 1066
            Q+P + G+   K +R                          K   + P  IVALTA    
Sbjct: 545  QLPVLSGIEAAKQIRDFEKQNGIGIQKGLNNSHSNFDKGTSKKFSQAPVIIVALTASNSQ 604

Query: 1067 SNIKECLESGMNSFLAKPIKRPMLKKILLE 1096
             + ++ L SG N +L KP+    L K + E
Sbjct: 605  MDKRKALLSGCNDYLTKPVNLHWLSKKITE 634

>NCAS0D02900 Chr4 complement(551013..553301) [2289 bp, 762 aa] {ON}
            Anc_5.230 YLR006C
          Length = 762

 Score = 49.7 bits (117), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 66/142 (46%), Gaps = 29/142 (20%)

Query: 976  LRILVAEDNNVNQEVIKRMLHLEGAHNID--LACDGEDAYQKVSALVEQGEHYDLIFMDV 1033
            + +L+ EDN +NQ ++   L     H I   +A +G++A   V    E G H  LIFMD+
Sbjct: 545  INVLIVEDNVINQAILGSFLR---KHKISYKVAKNGKEA---VDIWKEGGLH--LIFMDL 596

Query: 1034 QMPRMDGLLTTKLLR-----------------QKLHYEYP--IVALTAFADDSNIKECLE 1074
            Q+P + G+   + +R                 +K   + P  IVALTA     + +  L 
Sbjct: 597  QLPVLSGIEAARQIRAFEKENGIGIQEHSNSLKKNKTKAPVIIVALTASNSQDDKRNALI 656

Query: 1075 SGMNSFLAKPIKRPMLKKILLE 1096
            SG N +L KP+    L K + E
Sbjct: 657  SGCNDYLTKPVNLHWLSKKITE 678

>TDEL0E03980 Chr5 (741644..743836) [2193 bp, 730 aa] {ON} Anc_5.230
            YLR006C
          Length = 730

 Score = 49.3 bits (116), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 44/143 (30%), Positives = 66/143 (46%), Gaps = 30/143 (20%)

Query: 976  LRILVAEDNNVNQEVIKRMLHLEGAHNID--LACDGEDAYQKVSALVEQGEHYDLIFMDV 1033
            + +L+ EDN +NQ +++  L     H I   +A +G++A   V    E G   DLIFMD+
Sbjct: 501  ITVLIVEDNVINQAILRSFLK---KHKISYKVAKNGQEA---VDRWKEGG--IDLIFMDL 552

Query: 1034 QMPRMDGLLTTKLLRQ------------------KLHYEYP--IVALTAFADDSNIKECL 1073
            Q+P   G+   K +R                   K   + P  IVA TA    ++ +E L
Sbjct: 553  QLPVFSGMDAAKKIRDLEKLNASSETLPDSKEGDKKRSKAPVIIVAFTASNTRADKREAL 612

Query: 1074 ESGMNSFLAKPIKRPMLKKILLE 1096
             SG N +L KP+    L K + E
Sbjct: 613  LSGCNDYLTKPVNLHWLSKKINE 635

>ADR343C Chr4 complement(1311984..1314233) [2250 bp, 749 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR006C
            (SSK1)
          Length = 749

 Score = 48.5 bits (114), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 39/140 (27%), Positives = 64/140 (45%), Gaps = 38/140 (27%)

Query: 976  LRILVAEDNNVNQEVIKRMLHLEGAHNI--DLACDGEDAYQKVSALVEQGEHYDLIFMDV 1033
            + +L+ EDN +NQ ++   L     H I  ++A +G +A +K     + G H  LI MD+
Sbjct: 509  INVLIVEDNIINQAILSSFLR---KHKISYEIAKNGVEAVEK---WRKGGIH--LILMDL 560

Query: 1034 QMPRMDGLLTTKLLRQ--------------------------KLHYEYP--IVALTAFAD 1065
            Q+P + G+   K +R                           +  +  P  IVALTAF+ 
Sbjct: 561  QLPLLSGIDAAKQIRNLERASGICAFQKHCEARSQETYSELNRAKFRAPVIIVALTAFSS 620

Query: 1066 DSNIKECLESGMNSFLAKPI 1085
             ++  E L +G N +L KP+
Sbjct: 621  HADRNEALVAGCNDYLTKPV 640

>Kpol_1004.4 s1004 complement(9754..11898) [2145 bp, 714 aa] {ON}
            complement(9754..11898) [2145 nt, 715 aa]
          Length = 714

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 48/173 (27%), Positives = 72/173 (41%), Gaps = 49/173 (28%)

Query: 965  SVPTLSSAE---------SSLRILVAEDNNVNQEVIKRMLHLEGAHNID--LACDGEDAY 1013
            SVP +S  E           + +L+ EDN +NQ ++   L     H I   +A +G +A 
Sbjct: 491  SVPIVSHPEFKITGEKVFPKINVLIVEDNVINQTILASFLR---KHKISYKVAKNGREAV 547

Query: 1014 QKVSALVEQGEHYDLIFMDVQMPRMDGLLTTKLLRQKLHYE------------------- 1054
             K     E G H  LIFMD+Q+P + G+   K +R+   ++                   
Sbjct: 548  DKWK---EGGLH--LIFMDLQLPVLSGIDAAKEIREYEKHKGIGIQKASSTTSTTNLEDT 602

Query: 1055 ---------YP--IVALTAFADDSNIKECLESGMNSFLAKPIKRPMLKKILLE 1096
                      P  IVA TA    ++ +E L SG N +L KP+    L K + E
Sbjct: 603  KKIDKNSTGAPVIIVAFTASNSLTDKREALISGCNDYLTKPVNLHWLSKKITE 655

>CAGL0D02882g Chr4 complement(300025..302028) [2004 bp, 667 aa] {ON}
            similar to uniprot|Q07084 Saccharomyces cerevisiae
            YLR006c SSK1 two-component signal transducer
          Length = 667

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 46/165 (27%), Positives = 70/165 (42%), Gaps = 40/165 (24%)

Query: 959  TATSTRSVPTLSSAESSLRILVAEDNNVNQEVIKRMLHLEGAHNIDLACDGEDAYQKVSA 1018
            T TS +  P ++       +L+ EDN +NQ ++   L  +   +  +A +G++A   V  
Sbjct: 453  TTTSEKVFPKIN-------VLIVEDNVINQAILGSFLR-KNKISYKIAKNGKEA---VDK 501

Query: 1019 LVEQGEHYDLIFMDVQMPRMDGLLTTKLLR----------QKLHYEYP------------ 1056
              E   H  LIFMD+Q+P + G+   K +R          Q      P            
Sbjct: 502  WKEGNLH--LIFMDLQLPVLSGIEAAKKIRELEKERGIANQSERVSTPGSLSSINMNGST 559

Query: 1057 -----IVALTAFADDSNIKECLESGMNSFLAKPIKRPMLKKILLE 1096
                 IVALTA     + +E L SG N +L KP+    L K + E
Sbjct: 560  NSPVIIVALTASNSQEDKREALISGCNDYLTKPVNLLWLSKKITE 604

>NDAI0I02000 Chr9 complement(464492..467164) [2673 bp, 890 aa] {ON}
            Anc_5.230 YLR006C
          Length = 890

 Score = 45.4 bits (106), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 66/146 (45%), Gaps = 33/146 (22%)

Query: 976  LRILVAEDNNVNQEVIKRMLHLEGAHNID--LACDGEDAYQKVSALVEQGEHYDLIFMDV 1033
            + +L+ EDN +NQ ++   L     H I   +A +G++A   V    E G H  LIFMD+
Sbjct: 670  INVLIVEDNVINQAILGSFLR---KHKISYKVAKNGKEA---VDIWKEGGLH--LIFMDL 721

Query: 1034 QMPRMDGLLTTKLLR----------------QKL-------HYEYPIVALTAFADDSNIK 1070
            Q+P + G+   + +R                QK+            IVALTA     + +
Sbjct: 722  QLPVLSGIEAARQIRDFEKEKGIGIQENNLKQKIIPASNINQAPVIIVALTASNSLDDKR 781

Query: 1071 ECLESGMNSFLAKPIKRPMLKKILLE 1096
            + L SG N +L KP+    L K + E
Sbjct: 782  KALLSGCNDYLTKPVNLHWLSKKITE 807

>KLLA0E09505g Chr5 (840647..842554) [1908 bp, 635 aa] {ON} weakly
            similar to uniprot|Q07084 Saccharomyces cerevisiae
            YLR006C SSK1 Cytoplasmic response regulator part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism dephosphorylated form is
            degraded by the ubiquitin-proteasome system potential
            Cdc28p substrate
          Length = 635

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 44/74 (59%), Gaps = 6/74 (8%)

Query: 976  LRILVAEDNNVNQEVIKRMLHLEGAHNIDLACDGEDAYQKVSALVEQGEHYDLIFMDVQM 1035
            + +L+ EDN +NQ ++   L   G  +  +A DG +A +K     ++G+ + LI MD+Q+
Sbjct: 394  INVLIVEDNAINQAILALFLRKNGI-SYKVAKDGVEAIEKW----KEGDSH-LILMDLQL 447

Query: 1036 PRMDGLLTTKLLRQ 1049
            P + GL  TK +R+
Sbjct: 448  PLLSGLEATKKIRE 461

>TBLA0D03170 Chr4 complement(771345..773642) [2298 bp, 765 aa] {ON}
            Anc_5.230 YLR006C
          Length = 765

 Score = 40.8 bits (94), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 61/154 (39%), Gaps = 42/154 (27%)

Query: 976  LRILVAEDNNVNQEVIKRMLHLEGAHNIDLACDGEDAYQKVSALVEQGEHYDLIFMDVQM 1035
            + IL+ EDN +NQ ++   L         +A +G +A  K     E G H  LIFMD+Q+
Sbjct: 565  INILIVEDNVINQTILGSFLRKNKIF-YKVAKNGREAVDKWK---EGGIH--LIFMDLQL 618

Query: 1036 PRMDGLLTTKLLRQKLHYEYP---------------------------------IVALTA 1062
            P + G    K +RQ   YE                                   IVA TA
Sbjct: 619  PVLSGTDAAKEIRQ---YEKKIGIGIQKKQSSSSDLSLSESFLNTKSSACAPVIIVAFTA 675

Query: 1063 FADDSNIKECLESGMNSFLAKPIKRPMLKKILLE 1096
                ++ +  L +G N +L KP+    L K + E
Sbjct: 676  SNSLADKRAALIAGCNDYLTKPVNLHWLSKKITE 709

>TBLA0E04980 Chr5 (1275927..1278302) [2376 bp, 791 aa] {ON} Anc_4.385
            YJR147W
          Length = 791

 Score = 37.0 bits (84), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 39/75 (52%), Gaps = 11/75 (14%)

Query: 1026 YDLIFMD-----VQMPRMDGLLTTKLLRQKLHYEYPIVALTAFADDSNIKECLESGMNSF 1080
            YDL+ +D     + +P ++ +L++      + Y  PI+ +T+  +D  +   L+ G+NS 
Sbjct: 536  YDLVIIDAHVKFLNVPILESMLSS------IQYHPPIILMTSSLNDQQLIFYLQHGINSI 589

Query: 1081 LAKPIKRPMLKKILL 1095
            L KP     L K L+
Sbjct: 590  LEKPFHSHKLLKFLV 604

>Kwal_47.18151 s47 (709368..710612) [1245 bp, 414 aa] {ON} YIL042C -
           Hypothetical ORF [contig 197] FULL
          Length = 414

 Score = 36.2 bits (82), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 42/105 (40%), Gaps = 26/105 (24%)

Query: 784 SDNNVTMSKLEKPRSWVIV-------IEVQDTGPGIEPSLHESVFKPFVQGDQTLSRQYG 836
           SDNN      EKP    IV       I ++D G GI P + + +F        T ++  G
Sbjct: 299 SDNNTA----EKPVEVTIVRKDNDLKIRIRDFGGGIPPVVEDRMFDYSYSTVNTDAKDSG 354

Query: 837 ---------------GTGLGLSICRQLATMMKGTMKLESKVGSGS 866
                          G G GL +C+    M  GT+ ++S  G G+
Sbjct: 355 MSAYVIPGADVCNVSGMGFGLPMCKAYMEMFNGTLDIQSLWGWGT 399

>KLLA0E04533g Chr5 (408415..409680) [1266 bp, 421 aa] {ON} similar
           to uniprot|P40530 Saccharomyces cerevisiae YIL042C
           Hypothetical ORF
          Length = 421

 Score = 36.2 bits (82), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 42/99 (42%), Gaps = 19/99 (19%)

Query: 783 DSDNNVTMSKLEKPRSWVIVIEVQDTGPGIEPSLHESVF-----------KPFVQGDQTL 831
           D D  VT+ K +      + I ++D G GI+P + + VF           K     D  L
Sbjct: 311 DKDVEVTIVKNDDQ----LEIRIRDFGGGIDPQVEDRVFDYSFSTTVKEEKDSGMSDYVL 366

Query: 832 SRQ----YGGTGLGLSICRQLATMMKGTMKLESKVGSGS 866
             Q      G G GL +C+    +  GT+ ++S  G G+
Sbjct: 367 PGQEVQNVAGMGFGLPMCKAYLELFNGTLDIQSLWGWGT 405

>SAKL0G12100g Chr7 (1029250..1031466) [2217 bp, 738 aa] {ON} weakly
            similar to uniprot|Q07084 Saccharomyces cerevisiae
            YLR006C SSK1 Cytoplasmic response regulator part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism dephosphorylated form is
            degraded by the ubiquitin-proteasome system potential
            Cdc28p substrate
          Length = 738

 Score = 35.4 bits (80), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 40/75 (53%), Gaps = 10/75 (13%)

Query: 976  LRILVAEDNNVNQEVIKRMLHLEGAHNID--LACDGEDAYQKVSALVEQGEHYDLIFMDV 1033
            + +L+ EDN +NQ ++   L     H I   +A +G +A  K     + G H  LI +D+
Sbjct: 462  INVLIVEDNVINQAILGSFLR---KHKISYKVAKNGREAVDKWK---QGGIH--LILLDL 513

Query: 1034 QMPRMDGLLTTKLLR 1048
            Q+P + G+  TK +R
Sbjct: 514  QLPILSGIEATKEIR 528

>Kwal_14.1159 s14 complement(219896..224461) [4566 bp, 1521 aa] {ON}
            YFL033C (RIM15) - Trehalose-associated protein kinase
            related to S. pombe cek1+ [contig 244] FULL
          Length = 1521

 Score = 35.4 bits (80), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 30/127 (23%), Positives = 67/127 (52%), Gaps = 13/127 (10%)

Query: 975  SLRILVAEDNNVNQEVIKRMLHLEGAHNIDLACDGEDAYQKVSALVEQGEHYDLIFMDVQ 1034
            ++ ILV E   +++  + + L   G   + ++  G++  ++ ++ V+    +DLIF  ++
Sbjct: 1385 NMDILVCEPIPIHRFKLTKDLESLGCSVVSVSM-GDEMVRRATSDVK----FDLIFTALK 1439

Query: 1035 MPRMDGLLTTKLLR--QKLHYEYPIVALTAFADDSNIKECLESGM-NSFLAKPIKRPMLK 1091
            +P++  +   KLLR    ++    I+A+TA+      +E  ++G+    L +P     L+
Sbjct: 1440 LPKLGAIDIVKLLRNTNSVNSTTSIIAVTAY-----YQEAQQAGVFEDVLERPATVQQLR 1494

Query: 1092 KILLEHT 1098
             +LL+HT
Sbjct: 1495 SLLLKHT 1501

>KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} similar
            to uniprot|P43565 Saccharomyces cerevisiae YFL033C RIM15
            Glucose-repressible protein kinase involved in signal
            transduction during cell proliferation in response to
            nutrients specifically the establishment of stationary
            phase originally identified as a regulator of IME2
          Length = 1524

 Score = 34.3 bits (77), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 27/126 (21%), Positives = 67/126 (53%), Gaps = 11/126 (8%)

Query: 975  SLRILVAEDNNVNQEVIKRMLHLEGAHNIDLACDGEDAYQKVSALVEQGEHYDLIFMDVQ 1034
            ++ +LV E   +++  + R L   G   + ++  G++  ++ ++ V+    +DLIF  ++
Sbjct: 1388 NMDVLVCEPIPIHRFKLTRDLESLGCSVVSVSM-GDEMVRRATSDVK----FDLIFTALK 1442

Query: 1035 MPRMDGLLTTKLLR--QKLHYEYPIVALTAFADDSNIKECLESGMNSFLAKPIKRPMLKK 1092
            +P++  +   KLLR    ++    I+A+TA+  ++  + C     +  L +P+    L+ 
Sbjct: 1443 LPKLGAIDIVKLLRNTNSVNSTTSIIAVTAYFQEAQ-QAC---AFDEVLERPVSVQQLRS 1498

Query: 1093 ILLEHT 1098
            +LL+++
Sbjct: 1499 LLLKYS 1504

>KLLA0A03289g Chr1 complement(294825..295898) [1074 bp, 357 aa] {ON}
           weakly similar to uniprot|P47177 Saccharomyces
           cerevisiae YJR149W
          Length = 357

 Score = 33.5 bits (75), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 23/42 (54%)

Query: 473 ATNWIDTRVPVYRRLFTDELSELTDTFNTMTDELDRQYVVLE 514
           A NWI+   P++ R  T    ELT  +N+  ++ +   VVLE
Sbjct: 85  ARNWIEYLKPIFARFHTKPEKELTKIYNSFLEDPEMLAVVLE 126

>TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8.34
            YFL033C
          Length = 1972

 Score = 33.5 bits (75), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 18/77 (23%), Positives = 41/77 (53%), Gaps = 6/77 (7%)

Query: 1026 YDLIFMDVQMPRMDGLLTTKLLRQK--LHYEYPIVALTAFADDSNIKECLESGMNSFLAK 1083
            +DLI   +++P++D +   KL++Q   ++   PI+A T +  ++          N  + K
Sbjct: 1884 FDLIITALKLPKIDAVDIVKLIKQTNGINSLTPIIAATNYTQEAETCHVF----NDIMEK 1939

Query: 1084 PIKRPMLKKILLEHTSQ 1100
            PI+  +L++++  +  Q
Sbjct: 1940 PIQLDILRRVVSRYALQ 1956

>ABL146C Chr2 complement(123312..124574) [1263 bp, 420 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL216C
           (RRI1)
          Length = 420

 Score = 32.7 bits (73), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 7/62 (11%)

Query: 422 VSPFVTENHAANSGSCSSMSDHERYLHHIARYHDGETSTNILSDHEKGSTSATNWIDTRV 481
           +  F T    A++ S SS S+  RY HH ARY++ E S   +    +       W D+R+
Sbjct: 199 IGAFRTMPETADTRSVSSHSNASRYGHHSARYYELEVSYFEVPQERR-------WCDSRL 251

Query: 482 PV 483
            V
Sbjct: 252 SV 253

>Skud_6.19 Chr6 complement(36582..39149) [2568 bp, 855 aa] {ON}
           YFL050C (REAL)
          Length = 855

 Score = 32.7 bits (73), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 36/67 (53%), Gaps = 8/67 (11%)

Query: 345 VLGVAVFMCIVTFILASWAVKPI---VRLQKATE-----FIAAGRGLRTYNHSGRSSSQN 396
           +LGV +F+ I+++ LAS+ +K I     L +A E     FI++    R    + RS S+N
Sbjct: 775 ILGVLIFLAILSWFLASYWIKNIDAPTTLNEAAESGAKSFISSFLPKRNRRFNDRSKSEN 834

Query: 397 TSIDRSN 403
             +  SN
Sbjct: 835 IRVGPSN 841

>TPHA0D00360 Chr4 complement(55596..60206) [4611 bp, 1536 aa] {ON}
            Anc_8.34 YFL033C
          Length = 1536

 Score = 32.7 bits (73), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 43/172 (25%), Positives = 80/172 (46%), Gaps = 28/172 (16%)

Query: 936  GKSESEASFGSVRVDRPFLQSTGTATSTRSVPTLSSAESS--------LRILVAEDNNVN 987
            GK  SE S  +  VD+  LQ+     S R+    +   SS        L IL+ E   ++
Sbjct: 1359 GKKNSEES-SAEEVDK--LQAISKIQSVRNRRKSARKNSSNVEQMLFKLDILLCEPIPIH 1415

Query: 988  QEVIKRMLHLEGAHNIDLACDGEDAYQKVSALVEQGEHYDLIFMDVQMPRMDGLLTTKLL 1047
            +  I + L   G   + +A  G++   + ++    G  +DLI   +++P++  +   KLL
Sbjct: 1416 RYYITKDLETLGCTVVSVAA-GDELISRATS----GIKFDLIITALKLPKLGAVDIVKLL 1470

Query: 1048 RQK--LHYEYPIVALTAF---ADDSNIKECLESGMNSFLAKPIKRPMLKKIL 1094
            +    ++   P+VA+T++   A ++NI        +    KPI   +LKK++
Sbjct: 1471 KHTNGINSFTPVVAVTSYYHEATNANI-------FSDVFEKPITLDVLKKLV 1515

>YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}
            RIM15Glucose-repressible protein kinase involved in
            signal transduction during cell proliferation in response
            to nutrients, specifically the establishment of
            stationary phase; identified as a regulator of IME2;
            substrate of Pho80p-Pho85p kinase
          Length = 1770

 Score = 32.3 bits (72), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 40/77 (51%), Gaps = 6/77 (7%)

Query: 1023 GEHYDLIFMDVQMPRMDGLLTTKLLRQK--LHYEYPIVALTAFADDSNIKECLESGMNSF 1080
            G  +DLI   +++P++  +   +LL+Q    +   PIVA+T +  ++      +      
Sbjct: 1677 GVSFDLIMTALKLPKLGAIDIVQLLKQTNGANSTTPIVAITNYFQEAATSRVFD----DV 1732

Query: 1081 LAKPIKRPMLKKILLEH 1097
            L KP+K   LKK++ ++
Sbjct: 1733 LEKPVKLDELKKLVAKY 1749

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.132    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 103,918,204
Number of extensions: 4280144
Number of successful extensions: 14387
Number of sequences better than 10.0: 103
Number of HSP's gapped: 14614
Number of HSP's successfully gapped: 133
Length of query: 1103
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 983
Effective length of database: 39,721,479
Effective search space: 39046213857
Effective search space used: 39046213857
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 71 (32.0 bits)