Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AFR283W5.699ON45245223240.0
Ecym_40215.699ON4594689921e-130
SAKL0E14850g5.699ON4704526173e-74
KLTH0E01122g5.699ON4724435074e-58
Kwal_55.197165.699ON4674594856e-55
ZYRO0G06666g5.699ON5033993941e-41
TDEL0B022205.699ON4894883903e-41
KLLA0A00660g5.699ON5244923722e-38
Smik_9.235.699ON5273823413e-34
YIL146C (ATG32)5.699ON5294092982e-28
Skud_9.225.699ON5372982902e-27
Suva_9.435.699ON5132952866e-27
CAGL0H06545g5.699ON4923992132e-17
NCAS0G002605.699ON5102762024e-16
KNAG0L021005.699ON4443581811e-13
KAFR0D022505.699ON5564701642e-11
TBLA0E020905.699ON7491361633e-11
NDAI0B040602.195ON568100741.8
NOTE: 2 genes in the same pillar as AFR283W were not hit in these BLAST results
LIST: Kpol_2001.73 TPHA0D04580

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR283W
         (452 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR283W Chr6 (945526..946884) [1359 bp, 452 aa] {ON} Syntenic ho...   899   0.0  
Ecym_4021 Chr4 complement(53316..54695) [1380 bp, 459 aa] {ON} s...   386   e-130
SAKL0E14850g Chr5 (1229975..1231387) [1413 bp, 470 aa] {ON} simi...   242   3e-74
KLTH0E01122g Chr5 complement(110889..112307) [1419 bp, 472 aa] {...   199   4e-58
Kwal_55.19716 s55 complement(93412..94815) [1404 bp, 467 aa] {ON...   191   6e-55
ZYRO0G06666g Chr7 complement(532862..534373) [1512 bp, 503 aa] {...   156   1e-41
TDEL0B02220 Chr2 complement(400065..401534) [1470 bp, 489 aa] {O...   154   3e-41
KLLA0A00660g Chr1 complement(64397..65971) [1575 bp, 524 aa] {ON...   147   2e-38
Smik_9.23 Chr9 complement(51874..53457) [1584 bp, 527 aa] {ON} Y...   135   3e-34
YIL146C Chr9 complement(74184..75773) [1590 bp, 529 aa] {ON}  AT...   119   2e-28
Skud_9.22 Chr9 complement(51263..52876) [1614 bp, 537 aa] {ON} Y...   116   2e-27
Suva_9.43 Chr9 complement(68866..68940,68994..69068,69093..69122...   114   6e-27
CAGL0H06545g Chr8 (643447..644925) [1479 bp, 492 aa] {ON} simila...    87   2e-17
NCAS0G00260 Chr7 complement(44445..45977) [1533 bp, 510 aa] {ON}...    82   4e-16
KNAG0L02100 Chr12 (374542..375876) [1335 bp, 444 aa] {ON} Anc_5....    74   1e-13
KAFR0D02250 Chr4 complement(455223..456893) [1671 bp, 556 aa] {O...    68   2e-11
TBLA0E02090 Chr5 (508537..510786) [2250 bp, 749 aa] {ON} Anc_5.6...    67   3e-11
NDAI0B04060 Chr2 complement(1028624..1030330) [1707 bp, 568 aa] ...    33   1.8  

>AFR283W Chr6 (945526..946884) [1359 bp, 452 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL146C (ECM37)
          Length = 452

 Score =  899 bits (2324), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/452 (96%), Positives = 437/452 (96%)

Query: 1   MSTKSQVTRRVRTSIATPEDGVHGNNQHKGILDPHLSVLEMLDRQDGDGAGQVEEGAVMT 60
           MSTKSQVTRRVRTSIATPEDGVHGNNQHKGILDPHLSVLEMLDRQDGDGAGQVEEGAVMT
Sbjct: 1   MSTKSQVTRRVRTSIATPEDGVHGNNQHKGILDPHLSVLEMLDRQDGDGAGQVEEGAVMT 60

Query: 61  VGKRRVERSLHHSISESWQAIKRSDYSFLSGTHEVGAMHSSVGILSSSDTSEEEAEMRPS 120
           VGKRRVERSLHHSISESWQAIKRSDYSFLSGTHEVGAMHSSVGILSSSDTSEEEAEMRPS
Sbjct: 61  VGKRRVERSLHHSISESWQAIKRSDYSFLSGTHEVGAMHSSVGILSSSDTSEEEAEMRPS 120

Query: 121 AHGTVHLGSSLASPMRQLLVEEDNSCAEEDDCQTVTISMPSSSTSLVMPKLSLSQRLGEP 180
           AHGTVHLGSSLASPMRQLLVEEDNSCAEEDDCQTVTISMPSSSTSLVMPKLSLSQRLGEP
Sbjct: 121 AHGTVHLGSSLASPMRQLLVEEDNSCAEEDDCQTVTISMPSSSTSLVMPKLSLSQRLGEP 180

Query: 181 QLLLVGQPARKFWLTIPKCYQKLFDVKNLGMVTRWDVGQRYLAVMVVFHDIAQAPELLDG 240
           QLLLVGQPARKFWLTIPKCYQKLFDVKNLGMVTRWDVGQRYLAVMVVFHDIAQAPELLDG
Sbjct: 181 QLLLVGQPARKFWLTIPKCYQKLFDVKNLGMVTRWDVGQRYLAVMVVFHDIAQAPELLDG 240

Query: 241 LCEKAPCPTVIPVCQKGQKSTLAALLKRYTARKCIRVYCSPIIMSXXXXXXXXXXXXXXX 300
           LCEKAPCPTVIPVCQKGQKSTLAALLKRYTARKCIRVYCSPIIMS               
Sbjct: 241 LCEKAPCPTVIPVCQKGQKSTLAALLKRYTARKCIRVYCSPIIMSNHHEKHRLLKHLHNL 300

Query: 301 CNESESGYETELTVKSKKQHRRPRKKDAGPVALRHWAIWTASFTIGIGIGCCISLMATTR 360
           CNESESGYETELTVKSKKQHRRPRKKDAGPVALRHWAIWTASFTIGIGIGCCISLMATTR
Sbjct: 301 CNESESGYETELTVKSKKQHRRPRKKDAGPVALRHWAIWTASFTIGIGIGCCISLMATTR 360

Query: 361 FTFFSSAPLPLTAVIPAQIPSSVASDKPPHRLVPHFYMLCKTTIRQLGTSLRLFFFEKFE 420
           FTFFSSAPLPLTAVIPAQIPSSVASDKPPHRLVPHFYMLCKTTIRQLGTSLRLFFFEKFE
Sbjct: 361 FTFFSSAPLPLTAVIPAQIPSSVASDKPPHRLVPHFYMLCKTTIRQLGTSLRLFFFEKFE 420

Query: 421 SRTWVHIFGMDLHSDDPLASLGRLMPLDFIML 452
           SRTWVHIFGMDLHSDDPLASLGRLMPLDFIML
Sbjct: 421 SRTWVHIFGMDLHSDDPLASLGRLMPLDFIML 452

>Ecym_4021 Chr4 complement(53316..54695) [1380 bp, 459 aa] {ON}
           similar to Ashbya gossypii AFR283W
          Length = 459

 Score =  386 bits (992), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 211/468 (45%), Positives = 297/468 (63%), Gaps = 30/468 (6%)

Query: 5   SQVTRRVRTSIATPEDGVHGNNQHKGILDPHLSVLEMLDRQDGDGAGQVE-----EGAVM 59
           SQ   +++++  T   G+ G  Q + ILDPHLSVLE+L+   G    +VE      GA  
Sbjct: 2   SQTVEKMQSNGHTQNGGLPGTTQ-RSILDPHLSVLEILE---GKELNKVEGPHELSGASR 57

Query: 60  TVGKR-RVERSLHHSISESWQAIKRSDYSFLSGTHEVG-AMHSSVGILSSSDTSEEEAEM 117
             GK+   ER LHHSISESWQ+IK +DY FLS  ++      S+VGILSSSDTSEEE ++
Sbjct: 58  VSGKQFEGERVLHHSISESWQSIKSTDYLFLSRANDTSLQQQSAVGILSSSDTSEEEQDI 117

Query: 118 RPSAHGTVHL------------GSSLASPMRQLLVEEDNSCAEEDDCQTVTISMPSSSTS 165
            PS                   G + ++ +  L  E+     E+DD +TVT+S+P++ TS
Sbjct: 118 HPSPPPPNSASSAFDSRIINIAGQAFSATLSHLRSED-----EDDDGETVTVSLPNTMTS 172

Query: 166 LVMPKLSLSQRLGEPQLLLVGQPARKFWLTIPKCYQKLFDVKNLGMVTRWDVGQRYLAVM 225
           LVMPKLSLS R+ E ++L+VGQPARKFW +IPK YQK+F++ +L ++   DV ++Y  +M
Sbjct: 173 LVMPKLSLSDRIIESKVLIVGQPARKFWFSIPKSYQKMFEICSLSVLRDKDVDEKYSTIM 232

Query: 226 VVFHDIAQAPELLDGLCEKAPCPTVIPVCQKGQKSTLAALLKRYTARKCIRVYCSPIIMS 285
           V+FHD+  APELLD +C K   P +IP+CQKGQK  L++LLK+Y +   I+++C+PI+MS
Sbjct: 233 VIFHDMGLAPELLDRICNKVVRPRIIPICQKGQKQHLSSLLKQYVSGNRIKLFCNPIVMS 292

Query: 286 XXXXXXXXXXXXXXXCNESESGYETELTVKS-KKQHRRPRKKDAGPVALRHWAIWTASFT 344
                           + S+SGYETE+TV+  KK  R+ +K+ + P   R W +WTAS T
Sbjct: 293 NHHEKHRLLKHLHQLSSGSDSGYETEVTVEPVKKLPRKAKKRPSKPSTFRDWVVWTASIT 352

Query: 345 IGIGIGCCISLMATTRFTFFSSAPLPLTAVIPAQIPSSVASDKPPHRLVPHFYMLCKTTI 404
           IGIGIGCC+SLM +TR+ F     L +  +  + + S   +DK  H L  H Y LCKT++
Sbjct: 353 IGIGIGCCVSLMVSTRYAFLVPRQLAVDDITSSPL-SPEGTDKSSHNLFLHAYSLCKTSL 411

Query: 405 RQLGTSLRLFFFEKFESRTWVHIFGMDLHSDDPLASLGRLMPLDFIML 452
           ++L +SLR FF ++ ES TW+H  G++L  DD L S+GR+MPLDFIML
Sbjct: 412 KKLASSLRPFFSDRLESCTWIHTLGIELSYDDSLISMGRIMPLDFIML 459

>SAKL0E14850g Chr5 (1229975..1231387) [1413 bp, 470 aa] {ON} similar
           to uniprot|Q753M9 Ashbya gossypii AFR283W AFR283Wp and
           weakly similar to YIL146C uniprot|P40458 Saccharomyces
           cerevisiae YIL146C ECM37 Non-essential protein of
           unknown function
          Length = 470

 Score =  242 bits (617), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 152/452 (33%), Positives = 240/452 (53%), Gaps = 34/452 (7%)

Query: 27  QHKGILDPHLSVLEMLDRQDGDGAGQVEEGAVMTVGK------------RRVERSLHHSI 74
           Q + ILDPH SVL++L+R   +    V + +     +            +R   +L+ SI
Sbjct: 27  QKRSILDPHFSVLQLLERNGCEQEEDVNQASSQIPVELKSAFNRPLSPHKRYPEALNQSI 86

Query: 75  SESWQAIKRSDYSFLSGTHEVGAMHSSVGILSSSDTSEEEAEM----RPSAHGTVHLGSS 130
           S+SWQ+IK  DYS L+  H+  +  + VGILSSSDTSEEE +      PS+      G  
Sbjct: 87  SDSWQSIKMVDYSILNSLHDTSSSQA-VGILSSSDTSEEELDHLNSPSPSSQQVFPNGPP 145

Query: 131 LASPMRQLLVEE-----DNSCAEEDDCQTVTISMPSSSTSLVMPKLSLSQRLGEPQLLLV 185
           ++   +  ++       +    EEDD +TVT+S+ +SS S VMP+LSLSQR    ++L+V
Sbjct: 146 ISFQTQAGVLTASATLPNPGVLEEDDNETVTVSLAASSNSFVMPQLSLSQRSHRFEILVV 205

Query: 186 GQPARKFWLTIPKCYQKLFDVKNLGMVTRWDVGQRYLAVMVVFHDIAQAPELLDGLCEKA 245
           G+PARKFW  +PK YQK+FD+ +   ++   V   Y AVM++F D  +   +LD L  K 
Sbjct: 206 GKPARKFWNNVPKMYQKMFDIGDFESISAPKVSH-YTAVMIIFQDTKEVSFILDSLVTKL 264

Query: 246 PCPTVIPVCQKGQKSTLAALLKRYTARKCIRVYCSPIIMSXXXXXXXXXXXXXXXCNESE 305
               +IP+CQ+GQK  LA+LL+ +   K IR+   P +MS                 E +
Sbjct: 265 DGKAIIPICQRGQKQQLASLLEPFVKAKKIRLMFQPTVMSNHQEIHKLLRYLHRLSTEID 324

Query: 306 SGYETELTVKSKKQHRRPRKKDAGPVALRHWAIWTASFTIGIGIGCCISLM-----ATTR 360
           SGYET+ T    ++ ++  KK +   + R W IW  S T+G+GIGCCIS +     ++ +
Sbjct: 325 SGYETDETHLKVRKRKKTHKKKSKGTSNR-WVIWGLSLTVGVGIGCCISFILSSYSSSVQ 383

Query: 361 FTFFSSAPLPLTAVIPAQIPSSVASDKPPHRLVPHFYMLCKTTIRQLGTSLRLFFFEKFE 420
               S   + L   +P  +P     + P  +++     L + T++Q    L+ F +E+  
Sbjct: 384 IPHASRDDVVLVEEVPT-LPDKAEGNGPIGQVI----TLLRKTVKQFNLVLKQFIYEQVG 438

Query: 421 SRTWVHIFGMDLHSDDPLASLGRLMPLDFIML 452
           S +W+   G +L S+D   ++GR+  LD ++L
Sbjct: 439 SLSWIQRVGKELISEDSDGTVGRVAALDLVLL 470

>KLTH0E01122g Chr5 complement(110889..112307) [1419 bp, 472 aa] {ON}
           weakly similar to uniprot|P40458 Saccharomyces
           cerevisiae YIL146C ECM37 Non-essential protein of
           unknown function
          Length = 472

 Score =  199 bits (507), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 138/443 (31%), Positives = 234/443 (52%), Gaps = 21/443 (4%)

Query: 26  NQHKGILDPHLSVLEMLDRQDGDGA-GQVEEGAVM--TVGKRRVERSLHHSISESWQAIK 82
           NQ   ILDPHLSVL++LDR D       ++ G +      +R    S++ SISESWQ+IK
Sbjct: 35  NQRNSILDPHLSVLQLLDRADPPSELSSLKHGEIAKPATPRRSGFESVNCSISESWQSIK 94

Query: 83  RSDYSFLSGTHEVGAMHSSVGILSSSDTSEEE--AEMRPSAHGTVHLGSSL--------- 131
            +D S ++   +  A H   GILSSSDTSE+E  A++ PS +      S+          
Sbjct: 95  HTDCSMVNTQGD--ATHQHAGILSSSDTSEDEPDAQLSPSPNNFAFPNSATSIFPEAPHN 152

Query: 132 --ASPMRQLLVEEDNSCAEEDDCQTVTISMPSSSTSLVMPKLSLSQRLGEPQLLLVGQPA 189
             AS +R+    E  +  EE+D +TVT+S+ +SS S VMPKLSL Q+  +  +L+VG+PA
Sbjct: 153 LEASSLREYQNSEIANPREENDNETVTMSLMNSSNSFVMPKLSLIQQSQKFCILIVGKPA 212

Query: 190 RKFWLTIPKCYQKLFDVKNLGMVTRWDVGQRYLAVMVVFHDIAQAPELLDGLCEKAPCPT 249
           ++F+  IP+ Y K+F+V+++G ++  ++  +Y AVMV+F +  +  ELL+ +   A    
Sbjct: 213 QRFYRDIPRAYHKMFEVRDVGHLSPREMN-KYSAVMVIFGEPKEGKELLEKVA--AHNSN 269

Query: 250 VIPVCQKGQKSTLAALLKRYTARKCIRVYCSPIIMSXXXXXXXXXXXXXXXCNESESGYE 309
           +I VCQ+GQ+  ++ +L RY+    IR+     +MS                 E +SGYE
Sbjct: 270 IIAVCQRGQQQQISNILNRYSKSNEIRLVYHLTVMSDHQDVHRLLRYLNTLSTEVDSGYE 329

Query: 310 TELTVKSKKQHRRPRKKDAGPVALRHWAIWTASFTIGIGIGCCISLMATTRFTFFSSAPL 369
           TE+  +  ++ R+  KK +  + +  W IW+ S T+G+G+G CIS + ++  +  S    
Sbjct: 330 TEVGSRKIRKRRKSSKKRSPQITVNRWVIWSISLTVGVGLGYCISCLLSSTSSTLSVTLR 389

Query: 370 PLTAVIPAQIPSSVASDKPPHRLVPHFYMLCKTTIRQLGTSLRLFFFEKFESRTWVHIFG 429
               V   +   +   + P    + H  +  K  ++Q+ +S + +   +     W+   G
Sbjct: 390 SGDEVTIMEDIHNSPHESPFDNYLRHLLLAVKRAVKQVNSSFKQYLSGQSLPVLWMQRIG 449

Query: 430 MDLHSDDPLASLGRLMPLDFIML 452
            +  S+    +L  +  LD +++
Sbjct: 450 KEWLSEASDPTLPGVTALDLVLV 472

>Kwal_55.19716 s55 complement(93412..94815) [1404 bp, 467 aa] {ON}
           YIL146C (ECM37) - (putative) involved in cell wall
           biogenesis [contig 159] FULL
          Length = 467

 Score =  191 bits (485), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 147/459 (32%), Positives = 230/459 (50%), Gaps = 49/459 (10%)

Query: 26  NQHKGILDPHLSVLEMLDRQDGDGAGQVEEGAVMT---VGKRRVERSLHHSISESWQAIK 82
           N    ILDPHLSVL++L+R +     Q    + +    +  R     +  SIS+SWQ+I+
Sbjct: 26  NNRNSILDPHLSVLQLLERNEVHSEPQEFRHSDIPSPHLLSRSSSEPMGRSISDSWQSIR 85

Query: 83  RSDYSFLSGTHEVGAMHSSVGILSSSDTSEEEAE--MRPS------AHGTVHL------- 127
            +DYS L+   E    H   GILSSSDTSE+E +  + PS      A+G   +       
Sbjct: 86  HTDYSILNLIGETS--HQPAGILSSSDTSEDEPDHFLSPSPNEYAFANGAKTVFPEASHA 143

Query: 128 --GSSLASPMRQLLVEEDNSCAEEDDCQTVTISMPSSSTSLVMPKLSLSQRLGEPQLLLV 185
             G SLA+   Q  V E ++ AE++D +TVT+S+ +SS S VMPKLSL+Q L +  +L+V
Sbjct: 144 PEGPSLAT--LQDSVYEHSNVAEDNDNETVTLSLINSSNSFVMPKLSLAQPLRKFSILIV 201

Query: 186 GQPARKFWLTIPKCYQKLFDVKNLGMVTRWDVGQRYLAVMVVFHDIAQAPELLDGLCEKA 245
           G+PA++F+  IP+ YQK+F+V +       DV Q + A+MV+F D      LL+ +  ++
Sbjct: 202 GKPAQRFYRDIPRAYQKMFEVCDAESFKTRDVDQ-FSAIMVIFTDPKNGQSLLEMVTGRS 260

Query: 246 PCPTVIPVCQKGQKSTLAALLKRYTARKCIRVYCSPIIMSXXXXXXXXXXXXXXXCNESE 305
               +I VCQ+GQ+  ++ LL R++    +R+     +MS                NE +
Sbjct: 261 --SNIIAVCQRGQQQQISNLLNRFSKTHHLRLIYHLTVMSDHQDVHRLLRYLYTLSNEID 318

Query: 306 SGYETELTVKSKKQHRRPRKKDAGPVALRHWAIWTASFTIGIGIGCCIS-LMATT----- 359
           S Y+TE+  +  ++ R+  KK   P A+  W IW+ S T+G+GIG CIS L+++T     
Sbjct: 319 SEYDTEVGPRKVRKRRKSYKKRETPAAVNRWVIWSISLTVGVGIGYCISCLLSSTMSVRG 378

Query: 360 -RFTFFSSAPLPLTAVIPAQIPSSVASDKPPHRLVPHFY-----MLCKTTIRQLGTSLRL 413
              T  SS  + L    P            PH  V   Y     +  K  ++Q+  S + 
Sbjct: 379 NTLTLHSSDEIALIEEAPIS----------PHETVLENYFRQLVLAFKKAVKQVSQSFKQ 428

Query: 414 FFFEKFESRTWVHIFGMDLHSDDPLASLGRLMPLDFIML 452
                     W+   G D  S+    +L  +  LD +++
Sbjct: 429 CLHGHSLPVLWMQRIGKDWMSEASDTTLPGVTALDLVLI 467

>ZYRO0G06666g Chr7 complement(532862..534373) [1512 bp, 503 aa] {ON}
           similar to uniprot|P40458 Saccharomyces cerevisiae
           YIL146C ECM37 Non-essential protein of unknown function
          Length = 503

 Score =  156 bits (394), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 116/399 (29%), Positives = 187/399 (46%), Gaps = 64/399 (16%)

Query: 27  QHKGILDPHLSVLEMLDRQDGDGAGQVEEGAVMTVGKR--RVERSLHHSISESWQAIKRS 84
           + + ILDPHLSVLE+L R       +  +G V  +         + + SIS+SWQ I R+
Sbjct: 22  ERRSILDPHLSVLELLRRPSDTRPHEALKGEVSDIVGNCAGTTGTGNGSISQSWQTIHRN 81

Query: 85  DYSFLSGTHEVGAMHSSVGILSSSDTSEEE--AEMRPSA-HGTVHLGSSLASPMRQ---- 137
           D           +  ++ GILSSSDTSE+E  A   PSA H  +H     A+P ++    
Sbjct: 82  DSCLSVVPERCPSQATAAGILSSSDTSEDEPDAVNSPSAVHQQLH-----ATPPQKHTKS 136

Query: 138 ------------LLVEEDN--------------SCAEEDDCQTVTISMPSSSTSLVMPKL 171
                       L++ ED+              S  EEDD  T+T S+ SSS S +MPKL
Sbjct: 137 LEDYRSLNVGIPLVLPEDSNNINNNNKNGSTTGSNGEEDDNDTITKSLNSSSNSFIMPKL 196

Query: 172 SLSQRLGEPQLLLVGQPARKFWLTIPKCYQKLFDVKNLGMVTRWDVGQRYLAVMVVFHDI 231
           SLSQ+  + ++L++G+P  KF+ +IPK YQ +F++        +   ++Y  ++VVF ++
Sbjct: 197 SLSQKTQKFRILVLGRPGLKFYHSIPKKYQHMFELPRSHDPAEF---KQYTGILVVFQEL 253

Query: 232 AQAPELLDGLCEKAPCPTVIPVCQKGQKSTLAALLKRYTARKCIRVYCSPIIMSX----- 286
            +   LL+ +C+  P   VIPVCQ GQ+  +  LL+     + + +   P++++      
Sbjct: 254 KEMVSLLNRVCQCNPNRPVIPVCQSGQRQQVRNLLESLLKNRLVSLLYPPVVVNNQPDLL 313

Query: 287 ---------XXXXXXXXXXXXXXCNESESGYETELTVKSKK-------QHRRPRKKDAGP 330
                                   N      +  L  K KK       ++ RP KK    
Sbjct: 314 GMFRFLQELSKTVSDNSDMDAEEPNNGSKRLKRSLQRKKKKFIETSAERNGRPHKKRHNN 373

Query: 331 VALRHWAIWTASFTIGIGIGCCISLMATTRFTFFSSAPL 369
             +  W +W  S T+G+G+G CIS + ++ +   ++ PL
Sbjct: 374 EKVNRWVLWGVSLTLGVGVGYCISHLVSSTWISLTTNPL 412

>TDEL0B02220 Chr2 complement(400065..401534) [1470 bp, 489 aa] {ON}
           Anc_5.699 YIL146C
          Length = 489

 Score =  154 bits (390), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 138/488 (28%), Positives = 224/488 (45%), Gaps = 87/488 (17%)

Query: 27  QHKGILDPHLSVLEMLDRQDGDGAGQVEEGAVMTVGKRRVER-----SLHHSISESWQAI 81
           + K +LDPHLSVLE+L+R           G    VG R VE+     +  +SIS SWQAI
Sbjct: 27  EKKSLLDPHLSVLELLERT----------GDTQRVG-RGVEKADDMANTTNSISSSWQAI 75

Query: 82  KRSDYSFLSGTHEVGAMHSSVGILSSSDTSEEEAEMRPS---AHGT-------------- 124
            R+D           +  ++VGILSSSDTSEEE +   S   AH T              
Sbjct: 76  HRNDAMITGVPERCSSQAAAVGILSSSDTSEEEIDPASSPNVAHFTQFHQSQQPPRLPFK 135

Query: 125 ----VHLGSSLASPMRQLLVEEDNSCAEEDDCQTVTISMPSSSTSLVMPKLSLSQRLGEP 180
               V L +    P  Q    +++   +E D +T+T S+ +SS S VMPKLSLSQ+  + 
Sbjct: 136 LDVPVILPARDQEPSGQTQTPDND---DERDDETLTKSLSNSSNSFVMPKLSLSQKSHKL 192

Query: 181 QLLLVGQPARKFWLTIPKCYQKLFDVKNLGMVTRWDVGQRYLAVMVVFHDIAQAPELLDG 240
           ++L++G+P  KF+ +IPK YQ  F++  L   + +   +++  +++VF ++ +   LL+ 
Sbjct: 193 RILILGRPGLKFYQSIPKRYQHFFELSRLQDPSEF---RQFTGILIVFQELKEMVSLLNR 249

Query: 241 LCEKAPCPTVIPVCQKGQKSTLAALLKRYTARKCIRVYCSPIIMSXXXXXXX-------- 292
           +C+ AP   VIPVCQ GQ   +  +L+     K I +   P+++S               
Sbjct: 250 VCQCAPTRPVIPVCQTGQHQQVRNVLESLLKSKLISLLYPPVVISNHSDLNNMYRFLLDL 309

Query: 293 XXXXXXXXCNESESGYETELTVKSKKQHRR-------------PRKKDAGPVALRHWAIW 339
                    ++ +      L  K KK H+R             PRK+ +    +  W +W
Sbjct: 310 SKTISDNSEDDEDEEERELLDKKIKKSHQRKKKRAGSYDKTDKPRKRRSKETKINKWIVW 369

Query: 340 TASFTIGIGIGCCISLMATTRFTFFSSAPL-------PLTAVIPAQIPSSVASDKPPHRL 392
             S T+G+G+G C+S  A++     S+  +       P   V+     SS+   +  H L
Sbjct: 370 GISLTVGVGVGYCMSYFASSGLISMSAKSIASINGCRPNDNVVVFD-DSSLGMGEYDHDL 428

Query: 393 ---VPHFYMLCKTTIRQLGTSLRLFFFEKFE-----SRTWVHIFGMDLHSDDPLASLGRL 444
                H   L K T++Q   +++ F  +        S T    +G + +S+       R+
Sbjct: 429 ENPFAHALYLLKQTLKQWNWAMKQFLMKHLHLPESSSSTNYKEWGAEDNSN-------RV 481

Query: 445 MPLDFIML 452
           + L +I+L
Sbjct: 482 LALGYILL 489

>KLLA0A00660g Chr1 complement(64397..65971) [1575 bp, 524 aa] {ON}
           weakly similar to uniprot|P40458 Saccharomyces
           cerevisiae YIL146C ECM37 Non-essential protein of
           unknown function
          Length = 524

 Score =  147 bits (372), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 121/492 (24%), Positives = 208/492 (42%), Gaps = 70/492 (14%)

Query: 27  QHKGILDPHLSVLEMLDRQDG--------DGAGQVE-EGAVMTVGKRRVERSLH-HSISE 76
           Q   ILDPH SV+++L+ Q               ++ +G    +    +    H   +++
Sbjct: 37  QRHSILDPHDSVMDLLNGQQSCAFDSRLIQNQDLIDRKGKSNNIDHNDINTHTHSKGLTD 96

Query: 77  SWQAIKRSDYSFLS-GTHEV------GAMHSSVGILSSSDTSEEEAEMR----PSAHGTV 125
           SWQAI R +YSFL+ G H        G  +   G + SSDTSEEE E+     P+   + 
Sbjct: 97  SWQAIDRDEYSFLNAGNHNNYHNTSNGDFNQQFGGVLSSDTSEEEVEINAAPSPNLSASQ 156

Query: 126 HLGSSLASPMR-----------------------------QLLVEEDNSCAEEDDCQTVT 156
                LA P+                              Q    E  +   ED+   V 
Sbjct: 157 QHNQFLAYPLSSTGFGDQGNSETTVHQFSDGDPVKSTKTGQFSKAELGAGTGEDETIMVN 216

Query: 157 ISMPSSSTSLVMPKLSLSQRLGEPQLLLV--GQPARKFWLTIPKCYQKLFDVKNLGMVTR 214
           +    + +  VMPKLSLS+ +   ++L++  G  A  F+  + + ++ +FDV  L   ++
Sbjct: 217 LGHSWAGSFFVMPKLSLSESMKRFKILILSDGDSANSFYNRLSRYHRLMFDVGKLNEASK 276

Query: 215 WDVGQRYLAVMVVFHDIAQAPELLDGLCEKAPCPTVIPVCQKGQKSTLAALLKRYTARKC 274
            +   +Y A M++F D  +   +L+ + +K    T+IP+CQKGQK ++   +K +     
Sbjct: 277 -EEALKYTAFMIIFSDSKKVTTILNRMWKKYGDFTLIPICQKGQKQSVTEKVKTFANSNK 335

Query: 275 IRVYCSPIIMSXXXXXXXXXXXXXXXCNESESGYETELTVKSKKQHRRPRKKDAGPVALR 334
           I++   P+++S                 E +S YET++  K+K   R+  KK   P   +
Sbjct: 336 IKLMSYPVVISDHYEIHGLLRHLHSLYVEVDSDYETDIPKKTKP--RKGAKKKPAPHLAK 393

Query: 335 HWAIWTASFTIGIGIGCCISLMATTRFT--FFSSAPLPLTA---------VIPAQIPSSV 383
            W  W  S  +G+GIGCC++   +   T  + SS  +  TA          I    P S+
Sbjct: 394 RWWFWPISIALGVGIGCCVTFYFSKFETSSYNSSVGVIQTADKEIDAIVDAIEGNSP-SI 452

Query: 384 ASDKPPHRLVPHFYMLC---KTTIRQLGTSLRLFFFEKFESRTWVHIFGMDLHSDDPLAS 440
             +  P  +      +C   K T  Q+   L+ F      +  W+   G +    D  ++
Sbjct: 453 LEESSPQSISDFLGQVCKLVKDTAIQINELLKQFLSAHLMTSAWIQSIGKEFMQPDSQST 512

Query: 441 LGRLMPLDFIML 452
           + ++  LD +M 
Sbjct: 513 ISKVTALDLVMF 524

>Smik_9.23 Chr9 complement(51874..53457) [1584 bp, 527 aa] {ON}
           YIL146C (REAL)
          Length = 527

 Score =  135 bits (341), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 102/382 (26%), Positives = 177/382 (46%), Gaps = 52/382 (13%)

Query: 27  QHKGILDPHLSVLEMLDRQDGDGAGQVEEGAVMTVGKRRVERSLHHSISESWQAIKRSDY 86
           + +G+LDPHLSVLE+L +  G     + +  V ++      ++++ SIS SWQAI+  D 
Sbjct: 37  EDRGLLDPHLSVLELLGKT-GHSPSPMGQSLVTSIDISG-HQNVNDSISGSWQAIQPLDL 94

Query: 87  SFLSGTHEVGAMHSSVGILSSSDTSEEEAEM-RPSAHGTVHL------GSSLAS---PMR 136
                     +  ++  ILSSSDTSEEE E+ +  A   +++      G+++ S   P R
Sbjct: 95  GASFIPERCSSQTTNGSILSSSDTSEEEQELLQAPAADIINIIKQGQEGTNVTSSSHPFR 154

Query: 137 QLL-------------------VEEDNSCAEEDDCQTVTISMPSSSTSLVMPKLSLSQRL 177
           QL                    + +D   A E+D  T+T S+ SS+ S VMPKLSLSQ+ 
Sbjct: 155 QLHKVISLPIPSREKTPYKEQDINDDEDGAYEEDSVTITKSLTSSTNSFVMPKLSLSQKN 214

Query: 178 GEPQLLLVGQPARKFWLTIPKCYQKLFDVKNLGMVTRWDVGQRYLAVMVVFHDIAQAPEL 237
              +LL++G+    F+ +IPK YQ LF++        +    +Y  ++++F ++ +   L
Sbjct: 215 PVFRLLILGRTGSNFYQSIPKEYQSLFELPKYHDSATF---PQYTGIIIIFQELREMVSL 271

Query: 238 LDGLCEKAPCPTVIPVCQKGQKSTLAALLKRYTARKCIRVYCSPIIMSXXXXXXXXXXXX 297
           L+ + + +    +IP+CQ GQ   +  +LK +   K I++   P++++            
Sbjct: 272 LNRIVQYSQGKPIIPICQPGQTIQVKNVLKSFLRNKLIKLLFPPVVVTNRKDLKKMFQRL 331

Query: 298 XXXCNE----SESGYETELTVKSKKQHRRPRKKDAGPVA--------------LRHWAIW 339
                E         + + T KS+  +R  +  ++   +                 W  W
Sbjct: 332 QDLSLEYAEDENEEGDDDETTKSRSYYRYKKANNSKRKSPKSNKKPKKKKQRFFTSWFTW 391

Query: 340 TASFTIGIGIGCCISLMATTRF 361
             S TIGI  GCC++   T  +
Sbjct: 392 GISITIGISFGCCVTYFVTAAY 413

>YIL146C Chr9 complement(74184..75773) [1590 bp, 529 aa] {ON}
           ATG32Mitochondrial outer membrane protein required to
           initiate mitophagy; recruits the autophagy adaptor
           protein Atg11p and the ubiquitin-like protein Atg8p to
           the mitochondrial surface to initiate mitophagy, the
           selective vacuolar degradation of mitochondria in
           response to starvation; can promote pexophagy when
           placed ectopically in the peroxisomal membrane
          Length = 529

 Score =  119 bits (298), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 108/409 (26%), Positives = 183/409 (44%), Gaps = 56/409 (13%)

Query: 2   STKSQVTRRVRTSIATPEDGVHGNNQHKGILDPHLSVLEMLDRQDGDGAGQVEEGAVMTV 61
           S+KS       T+I T  +   G  + KG+LDPHLSVLE+L +  G     + +  V ++
Sbjct: 14  SSKSMPPDSSSTTIHTCSEAQTG--EDKGLLDPHLSVLELLSK-TGHSPSPMGQNLVTSI 70

Query: 62  GKRRVERSLHHSISESWQAIKRSDYSFLSGTHEVGAMHSSVGILSSSDTSEEEAEM-RPS 120
                  +++ SIS SWQAI+  D           +  ++  ILSSSDTSEEE E+ +  
Sbjct: 71  DISG-NHNVNDSISGSWQAIQPLDLGASFIPERCSSQTTNGSILSSSDTSEEEQELLQAP 129

Query: 121 AHGTVHL------GSSLASP---MRQL-------------------LVEEDNSCAEEDDC 152
           A   +++      G+++ SP    +QL                     + D   A E+D 
Sbjct: 130 AADIINIIKQGQEGANVVSPSHPFKQLQKIISLPLPGKEKTPFNEQDDDGDEDEAFEEDS 189

Query: 153 QTVTISMPSSSTSLVMPKLSLSQRLGEPQLLLVGQPARKFWLTIPKCYQKLFDVKNLGMV 212
            T+T S+ SS+ S VMPKLSL+Q+    +LL++G+    F+ +IPK YQ LF++      
Sbjct: 190 VTITKSLTSSTNSFVMPKLSLTQKNPVFRLLILGRTGSSFYQSIPKEYQSLFELPKYHDS 249

Query: 213 TRWDVGQRYLAVMVVFHDIAQAPELLDGLCEKAPCPTVIPVCQKGQKSTLAALLKRYTAR 272
             +    +Y  ++++F ++ +   LL+ + + +    VIP+CQ GQ   +  +LK +   
Sbjct: 250 ATFP---QYTGIVIIFQELREMVSLLNRIVQYSQGKPVIPICQPGQVIQVKNVLKSFLRN 306

Query: 273 KCIRVYCSPIIMSXXXXXXXXXXXXXXXCNE-----SESGYETELTVKSKKQHRRPRKKD 327
           K +++   P++++                 E     +E   + E      + + R +K +
Sbjct: 307 KLVKLLFPPVVVTNKRDLKKMFQRLQDLSLEYGEDVNEEDNDDEAIHTKSRSYCRNKKAE 366

Query: 328 AGPVA---------------LRHWAIWTASFTIGIGIGCCISLMATTRF 361
                                  W  W  S TIGI  GCC++   T  +
Sbjct: 367 NSKKKSPKSNKKPKRKKQKFFTSWFTWGISITIGISFGCCVTYFVTAAY 415

>Skud_9.22 Chr9 complement(51263..52876) [1614 bp, 537 aa] {ON}
           YIL146C (REAL)
          Length = 537

 Score =  116 bits (290), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 90/298 (30%), Positives = 150/298 (50%), Gaps = 48/298 (16%)

Query: 27  QHKGILDPHLSVLEMLDRQDGDGAGQVEEGAVMTVGKRRVERSLHH----SISESWQAIK 82
           + KG+LDPHLSVLE+L +  G     +    V ++     + S HH    SIS SWQAI 
Sbjct: 37  EDKGLLDPHLSVLELLGKT-GHSPSPMGHSLVTSI-----DISSHHYVNDSISGSWQAIH 90

Query: 83  RSDYSFLSGTHEVGAMHSSVGILSSSDTSEEEAEM-RPSAHGTVHL------GSSLASP- 134
             D           +  ++  ILSSSDTSEEE E+ +  A   +++      G+S+ SP 
Sbjct: 91  PLDLGASFVPERSSSQTTNGSILSSSDTSEEEQELLQAPAADIINIIKQGQEGASVTSPS 150

Query: 135 --MRQL-------------------------LVEEDNSCAEEDDCQTVTISMPSSSTSLV 167
              RQL                         + ++ +  A E+D  T+T S+ SS+ S V
Sbjct: 151 RPFRQLHKVISLPLPAKGRTSYGEQDDDDNNVDDDYDDGAYEEDSGTITKSLTSSTNSFV 210

Query: 168 MPKLSLSQRLGEPQLLLVGQPARKFWLTIPKCYQKLFDVKNLGMVTRWDVGQRYLAVMVV 227
           MPKLSLSQ+    +LL++G+    F+ +IPK +Q LF++      T +    +Y  ++++
Sbjct: 211 MPKLSLSQKNPVFRLLILGRTGSNFYQSIPKEHQSLFELPKYHDSTAFP---QYTGIIII 267

Query: 228 FHDIAQAPELLDGLCEKAPCPTVIPVCQKGQKSTLAALLKRYTARKCIRVYCSPIIMS 285
           F ++ +   LL+ + + +    +IP+CQ GQ   +  +LK +   K I++   P++++
Sbjct: 268 FQELREMVSLLNRIVQYSQGKPIIPICQPGQTIQVKNVLKSFLRNKLIKLLYPPVVVT 325

 Score = 37.7 bits (86), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 17/30 (56%)

Query: 332 ALRHWAIWTASFTIGIGIGCCISLMATTRF 361
           +L  W  W  S TIGI  GCC++  AT  +
Sbjct: 394 SLTRWFTWGVSITIGISFGCCVTYFATAAY 423

>Suva_9.43 Chr9
           complement(68866..68940,68994..69068,69093..69122,
           69126..70484) [1539 bp, 513 aa] {ON} YIL146C (REAL)
          Length = 513

 Score =  114 bits (286), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 87/295 (29%), Positives = 147/295 (49%), Gaps = 47/295 (15%)

Query: 27  QHKGILDPHLSVLEMLDRQDGDGAGQVEEGAVMTVGKRRVERSLHHS----ISESWQAIK 82
           + KG+LDPHLSVLE+L +  G     + +  V ++     + S HH+    IS SWQ I+
Sbjct: 37  EDKGLLDPHLSVLELLGKT-GSSPSPLGQSLVTSI-----DISNHHNVIDNISGSWQTIQ 90

Query: 83  RSDYSFLSGTHEVGAMHSSVGILSSSDTSEEEAEM-RPSAHGTVHL------GSSLASP- 134
             D           +  ++  ILSSSDTSEEE ++ +  A   +++      G+S+ SP 
Sbjct: 91  PLDLGASFIPERCSSQTTNGSILSSSDTSEEEQDLLQAPAADIINIIKQGQDGTSVTSPS 150

Query: 135 --MRQL------------------------LVEEDNSCAEEDDCQTVTISMPSSSTSLVM 168
              +QL                        +  +D++   E+D  T+T S+ SS+ S VM
Sbjct: 151 HPFKQLHTVISLPMPPRERTFYGEQEDVVCIDNDDDNGMYEEDSVTITKSLTSSTNSFVM 210

Query: 169 PKLSLSQRLGEPQLLLVGQPARKFWLTIPKCYQKLFDVKNLGMVTRWDVGQRYLAVMVVF 228
           PKLSLS++    +LL++G+    F+ + PK YQ LF++      T   +  +Y  +++VF
Sbjct: 211 PKLSLSRKNPVFRLLILGRTGTNFYQSTPKEYQSLFELPKSHDST---IFPQYTGIVIVF 267

Query: 229 HDIAQAPELLDGLCEKAPCPTVIPVCQKGQKSTLAALLKRYTARKCIRVYCSPII 283
            ++ +   LL+ + E A    +IP+CQ GQ   +  +LK +     I++   P++
Sbjct: 268 QELREMVSLLNRIVEYAQGKPIIPICQPGQTIQVKNVLKSFLKNSLIKLLYPPVV 322

 Score = 34.7 bits (78), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 14/26 (53%)

Query: 336 WAIWTASFTIGIGIGCCISLMATTRF 361
           W  W  S TIGI  GCC++   T  +
Sbjct: 399 WFTWGVSITIGISFGCCVTYFVTAAY 424

>CAGL0H06545g Chr8 (643447..644925) [1479 bp, 492 aa] {ON} similar
           to uniprot|P40458 Saccharomyces cerevisiae YIL146c ECM37
          Length = 492

 Score = 86.7 bits (213), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 92/399 (23%), Positives = 157/399 (39%), Gaps = 80/399 (20%)

Query: 25  NNQHKGILDPHLSVLEMLDRQDGDGAGQVEEGAVMTVGKRRVERSLHHSISESWQAIKRS 84
           N     ILDPH SV+E+L RQ  +G+    E  V+                ESWQ I+ S
Sbjct: 23  NGPESSILDPHHSVMELLQRQ-MEGSEVPSESGVL---------------GESWQQIRES 66

Query: 85  DYSFLSGTHEVGAMHSSVGILSSSDTSEE------------------------EAEMRPS 120
           D     G        ++  ILSSS  + E                        E +++  
Sbjct: 67  DVG-DGGDSNFDQQSNTSAILSSSSEASEDEDLDIQQQLLGGQQEYKNFHMTAEEQLQEQ 125

Query: 121 AHGTVHLGSSLASPMRQLLVEEDN-------------SCAEEDDCQTVTISMPSSS---- 163
           A G      SL    +  L E+D+             SC+   D   +     S S    
Sbjct: 126 AQGQGFGRPSLLKGTQSRLSEQDSNRSGSVRTIVDKGSCSSSLDEHELNSIFTSDSMSLT 185

Query: 164 -------TSLVMPKLSLSQRLGEPQ-LLLVGQPARKFWLTIPKCYQKLFDVKNLGMVTRW 215
                  TS VMPKLSL+ +  + + LL+VG+ +++F   IP+ Y++ F +      + +
Sbjct: 186 KSTGSSSTSFVMPKLSLTYKPSQAKKLLVVGRLSKRFHQDIPREYRQYFHISQSSDPSEF 245

Query: 216 DVGQRYLAVMVVFHDIAQAPELLDGLCEKAPCPTVIPVCQKGQKSTLAALLKRYTARKCI 275
              Q Y+ +++VF ++ +   +L+ + +      +IP+CQ GQ+  +  +LK +     I
Sbjct: 246 ---QNYIGIVIVFQELKEFVAMLNRIVQYTDKKPIIPICQPGQRIRVKNILKSFLKNDAI 302

Query: 276 RVYCSPIIMSXXXXXXXXXXXXXXXCNESESGYE-----------TELTVKSKKQHRRPR 324
            ++  P+ ++                N+ E+  +           ++ T   +K +RR +
Sbjct: 303 TLWYPPVTIANEKSMEKLFKHTVKLVNKLENEEDVLSLSTSDKSLSDETSGYRKNNRRKK 362

Query: 325 KKDAGPVALRHWAIWTASFTIGIGIGCCISLMATTRFTF 363
                      W  W  S TIG+ IG   + M TT   +
Sbjct: 363 HGGKPSTNYSKWITWGISLTIGVSIGYYATYMITTTLLY 401

>NCAS0G00260 Chr7 complement(44445..45977) [1533 bp, 510 aa] {ON}
           Anc_5.699 YIL146C
          Length = 510

 Score = 82.4 bits (202), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 93/276 (33%), Positives = 140/276 (50%), Gaps = 39/276 (14%)

Query: 29  KGILDPHLSVLEMLDRQDGDGAGQVEEGAVMTVGKRRVERSLHHSISESWQAIKRSDYSF 88
           K +LDPHLSVLEML+R+D D         VM    R         IS SWQ I+    S 
Sbjct: 36  KSLLDPHLSVLEMLERKDND--------TVMEASSR---------ISRSWQNIESPADSK 78

Query: 89  LSGTHEVGAMHSSVGILSSSDTSEEEAEMRPSAHGTVHLGSSLA----SPMRQ-LLVEE- 142
              + +   + + V ILSSS  + +E   R ++  +   GSS      SP++  + + E 
Sbjct: 79  QLLSAKSSQVSNLVSILSSSSDTSDEEVDRINSLNSAGEGSSKNYNNPSPLQNPIYLPEF 138

Query: 143 -DNSCAEEDD--CQTVTISMPSSST---SLVMPKLSLSQRLG---EPQLLLVGQPARKFW 193
            D +  + DD    T+T S+ SSST   S VMP LSLS       + Q+L+ G+    F+
Sbjct: 139 TDVTAGDNDDGIASTITKSLTSSSTISNSFVMPTLSLSSSQSQQRKFQILIFGRLGPSFY 198

Query: 194 LTIPKCYQKLFDVKN-LGMVTRWDVGQRYLAVMVVFHDIAQAPELLDGLCEKAPCPTV-- 250
            TIPK YQ LF V N L  +TR ++   + A +++F ++ +   LL+ + E+     V  
Sbjct: 199 RTIPKQYQYLFHVPNQLNTLTRNEMDN-FTAFLIIFEELKELVSLLNRISEELSFKKVPP 257

Query: 251 --IPVCQKGQKSTLAALLKRYTARKCIRVYCSPIIM 284
             IP+CQ GQK  + ++LK +     + +  SPII+
Sbjct: 258 PIIPICQPGQKIKVKSILKYFLKNNFVTL-LSPIII 292

 Score = 35.4 bits (80), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 55/138 (39%), Gaps = 30/138 (21%)

Query: 336 WAIWTASFTIGIGIGCCISLMATTRFTFFSSAPLPLTAVIPAQIPSSVA------SDKP- 388
           W +W+ S T+G G+G  IS        F SS  LPL  +     P  ++      S+K  
Sbjct: 382 WVVWSISLTVGAGMGYIISYCV-----FNSSKRLPLEKIAHQTRPGPLSSLIHLKSNKNL 436

Query: 389 --PHRLVPHFYM---------LCKTTIRQLGTSLRLFF---FEKFESRTWVHIFGMDLHS 434
               R  P+ Y           CK T+ QL ++ +      F  FE+     I   D   
Sbjct: 437 LYLERTTPNDYSWSYFQNTWEFCKETVNQLNSTFKKIIRKPFAMFENLITTTINSKDWKF 496

Query: 435 DDPLASLGRLMPLDFIML 452
           D+      R++ L +++L
Sbjct: 497 DEQ----DRILALCYLLL 510

>KNAG0L02100 Chr12 (374542..375876) [1335 bp, 444 aa] {ON} Anc_5.699
           YIL146C
          Length = 444

 Score = 74.3 bits (181), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 84/358 (23%), Positives = 153/358 (42%), Gaps = 42/358 (11%)

Query: 29  KGILDPHLSVLEMLDRQDGDGAGQVEEGAVMTVGKRRVERSLHHSISESWQAIKRSDYSF 88
             +LDPHLSVLE+L++    G      G+    G  +++      +SESW  ++R +   
Sbjct: 6   NSVLDPHLSVLELLEKSCERGGHAEAPGSSRNKGAGQIQ------LSESWCTVERDE--- 56

Query: 89  LSGTHEVGAMHSSVGILSSSDTSEE---EAEMRPSAHGTVHLGSSLASPMRQLLVEEDNS 145
           LS      +  ++ G+LSSSDTSEE   E        G     + +A P   L       
Sbjct: 57  LSAMERSASQQTNNGVLSSSDTSEEGEPEQGSPGDGEGGGVADTRMARPAMSLQSTSSTL 116

Query: 146 CAEEDDCQTVTISMPSSSTSLVMPKLSLSQRLGEP------------QLLLVGQPARKFW 193
              +DD  TV+ S+ SSS S +MPKL  +   G P            ++ ++G+ A KF 
Sbjct: 117 DGVDDDSATVSKSLTSSSNSFIMPKL-YTTVAGAPSTVSTALQTRCFKVAVLGRGAVKFC 175

Query: 194 L-TIPKCYQKLFDVKNLGMVTRWDVGQRYLAVMVVFHDIAQAPELLDGLCEKAPCPTVIP 252
             T+P+ ++  F++   G+        R   +++V  ++ +   LL+ +    P   V+ 
Sbjct: 176 QETVPEQFRHRFEL-TAGVHDLAQCADRQ-GILIVVQEVRELISLLNRVHCACPEVPVVA 233

Query: 253 VCQKGQKSTLAALLKRYTARKCIRVYCSPIIMSXXXXXXXXXXXXXXXC----------N 302
           V  + ++  +  +L+ +T ++ + +   P+ +S                          N
Sbjct: 234 VYDRDRQVQVKNVLRNFTRQRLVSLLHPPVPLSNNEALDKMFHFVDNLARQQEPAGVIHN 293

Query: 303 ESESGYETELTVKSKKQHRRPRKKDAGPVALRHWAIWTASFTIGIGIG-CCISLMATT 359
           + ++  E          HR P K +      + W +W  S ++GIG G  C+S + ++
Sbjct: 294 DPQTTQEQHPDHNEDDPHRGPSKPEG---TFKRWLLWGVSISLGIGAGYYCVSYVVSS 348

>KAFR0D02250 Chr4 complement(455223..456893) [1671 bp, 556 aa] {ON}
           Anc_5.699 YIL146C
          Length = 556

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 103/470 (21%), Positives = 185/470 (39%), Gaps = 122/470 (25%)

Query: 29  KGILDPHLSVLEMLDRQDGDGAGQVEEGAVMTVGKRRVER-----------------SLH 71
             ILDPHLSVLE+L+R  G      ++  +M+   R +                   S+ 
Sbjct: 28  NSILDPHLSVLELLER--GFQNVHEQDDTIMSTTPRDIAVEMATVRLNSEASGVSTPSVG 85

Query: 72  HSISESWQAIKRSDY--SFLSGTHEVGAMHSSVGILSSSDTSEEEA--EMRPSAHGTVHL 127
             IS+SW  I+R D   S  + ++++    ++ GILSSSDTSEEE   ++    +  +HL
Sbjct: 86  DIISQSWHTIQRRDLEESLHNNSNKLVLQSATAGILSSSDTSEEEEGYDINGKKNSPLHL 145

Query: 128 G-SSLASPMRQ--------LLVEEDNSCAEEDDCQTVTIS-----MPSSST--------- 164
               L  P+ Q        ++    +S  + D  +  T+S     +PS++          
Sbjct: 146 QPKRLCEPIIQDICSSHMNVVKRLQSSPVKADSDKICTVSDLNRRVPSNNAMTPDTEEEE 205

Query: 165 -----------------SLVMPKLSLSQR------LGEPQLLLVGQPARKFWLTIPKCYQ 201
                            S +MP+LSL+++        E ++L+VG+ + K +  IP  +Q
Sbjct: 206 EGEDYMTASKSLTSSSTSFIMPRLSLTKKERQQLNANEFRILIVGRLSSKLFKMIPHKFQ 265

Query: 202 KLFDVKNLGMVTRWDVGQRYLAVMVVFHDIAQAPELLDGL--CEKAPCPTVIPVCQKGQK 259
            LF ++    +  +   Q++ A++VV  +  +   LL+ +   EK   P +I +C+K   
Sbjct: 266 NLFQLQKSYDINEY---QKFTAILVVIQETRELISLLNRISRSEKVKRP-LIAICEKDAF 321

Query: 260 STLAALLKRYTARKCIRVYCSPIIMSXXXXXXXXXX-XXXXXCNESESGYETELTVKSK- 317
                +LK Y     I +   P ++S                    E  Y  ++ +K K 
Sbjct: 322 LQCKNVLKSYLRNDLITLLYQPFVISNTEELDRMLVFLKETSIKFYEQAYNPKIQIKEKV 381

Query: 318 -----------------------------------------KQHRRPRKKDAGPVALRHW 336
                                                    +  R+P++ +        W
Sbjct: 382 PNDGNRNAPTSSDLTLSKDRVKNDKHRHTKGDGSGGSKKGNEHDRKPKENE----EYNKW 437

Query: 337 AIWTASFTIGIGIGCCISLMATTRFTFFSSAPLPLTAVIPAQIPSSVASD 386
            IW  S +IG+GIG CIS   ++ ++       P +  I A +P  ++++
Sbjct: 438 IIWGISLSIGVGIGYCISYFGSSPWSSLVQYFNPESDSISATVPVPLSNE 487

>TBLA0E02090 Chr5 (508537..510786) [2250 bp, 749 aa] {ON} Anc_5.699
           YIL146C
          Length = 749

 Score = 67.4 bits (163), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 69/136 (50%), Gaps = 13/136 (9%)

Query: 154 TVTISMPSSSTSLVMPKLSLSQRLGEPQLLLVGQPAR-KFWLTIPKCYQKLFDVKNLGMV 212
            +T SM SSS S +MPKLS +    + ++L++G      F+  IP  Y+ LF++      
Sbjct: 324 NLTKSMTSSSNSFIMPKLSWTNTFRKFRILILGSNQNLTFYQNIPTSYKYLFELP----P 379

Query: 213 TRWDVG-QRYLAVMVVFHDIAQAPELLDGL----CEKAPCPTVIPVCQKGQKSTLAALLK 267
             +D   + Y  + +V HD+     +L+ +      K P   +IP+C+KGQ + +  +LK
Sbjct: 380 NNFDYNFKHYAGIAIVIHDLTDFKSILNKIDKYSMNKKP---IIPICEKGQINEVKNILK 436

Query: 268 RYTARKCIRVYCSPII 283
            Y   K + +   PI+
Sbjct: 437 PYIKTKDLSLLYPPIV 452

 Score = 38.5 bits (88), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 51/117 (43%), Gaps = 29/117 (24%)

Query: 29  KGILDPHLSVLEMLDRQDGDGAGQVEEGAVMTV----------GKRRVERS--------- 69
           +G LDPH S++E+L+           E  V  V           + R+E S         
Sbjct: 25  RGFLDPHFSLIELLENAKYSLQENSNEATVTNVLQPDNPTSPLNEIRLELSGMNVDDINS 84

Query: 70  -------LHHSISESWQAIKRSDYSFLS---GTHEVGAMHSSVGILSSSDTSEEEAE 116
                  L  S+S SWQ I+  DYS L            +++VGILSS+D+SEEE +
Sbjct: 85  ENQESSELSQSLSNSWQRIQTPDYSPLDVKDSNSINNINNNTVGILSSTDSSEEEQD 141

 Score = 35.8 bits (81), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 22/35 (62%)

Query: 333 LRHWAIWTASFTIGIGIGCCISLMATTRFTFFSSA 367
           L+    WT S ++G+G+G C+S  A+T F+  S +
Sbjct: 610 LKKIIYWTVSLSVGVGLGFCLSYYASTIFSNISES 644

>NDAI0B04060 Chr2 complement(1028624..1030330) [1707 bp, 568 aa]
           {ON} Anc_2.195 YOR090C
          Length = 568

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 47/100 (47%), Gaps = 8/100 (8%)

Query: 48  DGAGQVEEGAVMTVGKRRVERSLH-----HSISESWQAIKRSDYSFLSGTHEVGAMHSS- 101
           +G  Q +EG +M + + ++E+ LH     HSI+ + + I R D S L   H +   H   
Sbjct: 111 NGNTQNKEGTIMILAEDQIEKKLHDNEESHSINRN-KGIFRYDVSQLPSNHPIEDNHVEQ 169

Query: 102 -VGILSSSDTSEEEAEMRPSAHGTVHLGSSLASPMRQLLV 140
            + I +   +S +E ++        H G+  +  + Q LV
Sbjct: 170 IITIPNEDQSSNDEEDLYFFGIFDGHSGTFTSKKLSQDLV 209

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.133    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 43,499,695
Number of extensions: 1707125
Number of successful extensions: 4611
Number of sequences better than 10.0: 30
Number of HSP's gapped: 4682
Number of HSP's successfully gapped: 40
Length of query: 452
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 339
Effective length of database: 40,524,141
Effective search space: 13737683799
Effective search space used: 13737683799
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)