Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AFR269W3.564ON1017101749180.0
Ecym_25943.564ON1019100826990.0
SAKL0F00880g3.564ON1009100721840.0
Kwal_47.192583.564ON1011100819150.0
TDEL0D063203.564ON1018102017820.0
KLTH0G00792g3.564ON1021101217440.0
NDAI0B062603.564ON1013101717380.0
NCAS0F039503.564ON1012102217130.0
Smik_7.203.564ON1004101117080.0
Kpol_380.63.564ON1002100317000.0
YGL241W (KAP114)3.564ON1004100916880.0
CAGL0H07777g3.564ON1021101116830.0
Skud_7.263.564ON1015101516810.0
TPHA0G036303.564ON1022103316680.0
ZYRO0E09460g3.564ON1009100516660.0
Suva_7.203.564ON1008103116510.0
KAFR0J001903.564ON1012102216110.0
KNAG0D029403.564ON1009102215990.0
TBLA0E002403.564ON1010101815500.0
KLLA0A00803g3.564ON95210118671e-100
SAKL0H07876g8.624ON103279900.069
Skud_7.5555.111ON1084129840.28
CAGL0J06776g8.624ON1027118830.37
Smik_16.865.111ON1084129820.52
Skud_16.1558.624ON103284820.59
YGR218W (CRM1)5.111ON1084129810.66
Kpol_1050.495.111ON1083117810.69
NCAS0C014308.624ON102990810.74
KLLA0E16061g5.111ON1086117800.90
ACR159C8.624ON102588800.95
Smik_6.3248.624ON103284800.95
Ecym_20685.111ON1082117801.00
NDAI0E021708.624ON1029134801.0
TPHA0K012104.180ON86455791.1
KLLA0E11375g3.342ON289165781.1
Ecym_83098.624ON102751791.1
Suva_7.5135.111ON1084129791.2
TPHA0C010008.295ON4901152791.2
Kwal_26.85958.624ON103478791.3
NDAI0A015407.408ON1114142791.3
ADL128C5.111ON1082117781.6
TPHA0F031608.624ON103187781.7
KNAG0J014208.624ON105372781.7
NCAS0A074505.111ON1084117772.1
TDEL0A057008.624ON103185762.4
YER110C (KAP123)7.408ON111397762.4
TPHA0A049705.111ON1085117762.5
NCAS0A144907.408ON1113115762.7
TBLA0B074905.111ON1091107762.9
KLLA0D06633g8.624ON102377753.4
TDEL0G013605.111ON1089122753.8
Suva_14.2592.214ON36863734.7
CAGL0B02189g5.111ON1087117744.8
ZYRO0B15466g5.111ON1089117745.2
TDEL0D06620singletonON559102726.4
Kpol_530.128.624ON103064736.5
ZYRO0F06160g8.624ON102985736.8
Skud_5.2367.408ON1113110737.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR269W
         (1017 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR269W Chr6 (916446..919499) [3054 bp, 1017 aa] {ON} Syntenic h...  1899   0.0  
Ecym_2594 Chr2 complement(1155746..1158805) [3060 bp, 1019 aa] {...  1044   0.0  
SAKL0F00880g Chr6 (76850..79879) [3030 bp, 1009 aa] {ON} similar...   845   0.0  
Kwal_47.19258 s47 complement(1156969..1160004) [3036 bp, 1011 aa...   742   0.0  
TDEL0D06320 Chr4 complement(1134120..1137176) [3057 bp, 1018 aa]...   691   0.0  
KLTH0G00792g Chr7 (53588..56653) [3066 bp, 1021 aa] {ON} similar...   676   0.0  
NDAI0B06260 Chr2 complement(1515207..1518248) [3042 bp, 1013 aa]...   674   0.0  
NCAS0F03950 Chr6 complement(791754..794792) [3039 bp, 1012 aa] {...   664   0.0  
Smik_7.20 Chr7 (40260..43274) [3015 bp, 1004 aa] {ON} YGL241W (R...   662   0.0  
Kpol_380.6 s380 complement(8594..11602) [3009 bp, 1002 aa] {ON} ...   659   0.0  
YGL241W Chr7 (45445..48459) [3015 bp, 1004 aa] {ON}  KAP114Karyo...   654   0.0  
CAGL0H07777g Chr8 (757134..760199) [3066 bp, 1021 aa] {ON} simil...   652   0.0  
Skud_7.26 Chr7 (49585..52632) [3048 bp, 1015 aa] {ON} YGL241W (R...   652   0.0  
TPHA0G03630 Chr7 complement(770678..773746) [3069 bp, 1022 aa] {...   647   0.0  
ZYRO0E09460g Chr5 complement(753030..756059) [3030 bp, 1009 aa] ...   646   0.0  
Suva_7.20 Chr7 (40012..43038) [3027 bp, 1008 aa] {ON} YGL241W (R...   640   0.0  
KAFR0J00190 Chr10 (30537..33575) [3039 bp, 1012 aa] {ON} Anc_3.5...   625   0.0  
KNAG0D02940 Chr4 complement(529102..532131) [3030 bp, 1009 aa] {...   620   0.0  
TBLA0E00240 Chr5 (36791..39823) [3033 bp, 1010 aa] {ON} Anc_3.56...   601   0.0  
KLLA0A00803g Chr1 (76350..79208) [2859 bp, 952 aa] {ON} similar ...   338   e-100
SAKL0H07876g Chr8 (674192..677290) [3099 bp, 1032 aa] {ON} highl...    39   0.069
Skud_7.555 Chr7 (907277..910531) [3255 bp, 1084 aa] {ON} YGR218W...    37   0.28 
CAGL0J06776g Chr10 (651309..654392) [3084 bp, 1027 aa] {ON} high...    37   0.37 
Smik_16.86 Chr16 complement(160938..164192) [3255 bp, 1084 aa] {...    36   0.52 
Skud_16.155 Chr16 (284989..288087) [3099 bp, 1032 aa] {ON} YPL12...    36   0.59 
YGR218W Chr7 (932541..935795) [3255 bp, 1084 aa] {ON}  CRM1Major...    36   0.66 
Kpol_1050.49 s1050 (111270..114521) [3252 bp, 1083 aa] {ON} (111...    36   0.69 
NCAS0C01430 Chr3 complement(262823..265912) [3090 bp, 1029 aa] {...    36   0.74 
KLLA0E16061g Chr5 complement(1428731..1431991) [3261 bp, 1086 aa...    35   0.90 
ACR159C Chr3 complement(631643..634720) [3078 bp, 1025 aa] {ON} ...    35   0.95 
Smik_6.324 Chr6 complement(507726..510824) [3099 bp, 1032 aa] {O...    35   0.95 
Ecym_2068 Chr2 (114936..118184) [3249 bp, 1082 aa] {ON} similar ...    35   1.00 
NDAI0E02170 Chr5 complement(445219..448308) [3090 bp, 1029 aa] {...    35   1.0  
TPHA0K01210 Chr11 (251767..254361) [2595 bp, 864 aa] {ON} Anc_4....    35   1.1  
KLLA0E11375g Chr5 (999242..1000111) [870 bp, 289 aa] {ON} simila...    35   1.1  
Ecym_8309 Chr8 complement(629689..632772) [3084 bp, 1027 aa] {ON...    35   1.1  
Suva_7.513 Chr7 (888432..891683) [3252 bp, 1084 aa] {ON} YGR218W...    35   1.2  
TPHA0C01000 Chr3 (214320..229025) [14706 bp, 4901 aa] {ON} Anc_8...    35   1.2  
Kwal_26.8595 s26 complement(855035..858139) [3105 bp, 1034 aa] {...    35   1.3  
NDAI0A01540 Chr1 (344002..347346) [3345 bp, 1114 aa] {ON} Anc_7....    35   1.3  
ADL128C Chr4 complement(464142..467390) [3249 bp, 1082 aa] {ON} ...    35   1.6  
TPHA0F03160 Chr6 complement(690476..693571) [3096 bp, 1031 aa] {...    35   1.7  
KNAG0J01420 Chr10 complement(260385..263546) [3162 bp, 1053 aa] ...    35   1.7  
NCAS0A07450 Chr1 (1477489..1480743) [3255 bp, 1084 aa] {ON} Anc_...    34   2.1  
TDEL0A05700 Chr1 complement(1003650..1006745) [3096 bp, 1031 aa]...    34   2.4  
YER110C Chr5 complement(378762..382103) [3342 bp, 1113 aa] {ON} ...    34   2.4  
TPHA0A04970 Chr1 (1123879..1127136) [3258 bp, 1085 aa] {ON} Anc_...    34   2.5  
NCAS0A14490 Chr1 complement(2852114..2855455) [3342 bp, 1113 aa]...    34   2.7  
TBLA0B07490 Chr2 complement(1779793..1783068) [3276 bp, 1091 aa]...    34   2.9  
KLLA0D06633g Chr4 complement(568539..571610) [3072 bp, 1023 aa] ...    33   3.4  
TDEL0G01360 Chr7 complement(270498..273767) [3270 bp, 1089 aa] {...    33   3.8  
Suva_14.259 Chr14 complement(475644..476750) [1107 bp, 368 aa] {...    33   4.7  
CAGL0B02189g Chr2 complement(202354..205617) [3264 bp, 1087 aa] ...    33   4.8  
ZYRO0B15466g Chr2 complement(1256964..1260233) [3270 bp, 1089 aa...    33   5.2  
TDEL0D06620 Chr4 (1197405..1199084) [1680 bp, 559 aa] {ON}             32   6.4  
Kpol_530.12 s530 (33954..37046) [3093 bp, 1030 aa] {ON} (33954.....    33   6.5  
ZYRO0F06160g Chr6 complement(509916..513005) [3090 bp, 1029 aa] ...    33   6.8  
Skud_5.236 Chr5 complement(374903..378244) [3342 bp, 1113 aa] {O...    33   7.0  

>AFR269W Chr6 (916446..919499) [3054 bp, 1017 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YGL241W (KAP114)
          Length = 1017

 Score = 1899 bits (4918), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 937/1017 (92%), Positives = 937/1017 (92%)

Query: 1    MKPAALSIKARYWKQSEKMDLRQLVLAAQSAGKIERESAEQSLLEACRADPAAVCVGLVK 60
            MKPAALSIKARYWKQSEKMDLRQLVLAAQSAGKIERESAEQSLLEACRADPAAVCVGLVK
Sbjct: 1    MKPAALSIKARYWKQSEKMDLRQLVLAAQSAGKIERESAEQSLLEACRADPAAVCVGLVK 60

Query: 61   MATQENTELASRQFCLYTLRKLITMYWNAGFESYCGPPGVREDAKETVRDALLRMAVSRT 120
            MATQENTELASRQFCLYTLRKLITMYWNAGFESYCGPPGVREDAKETVRDALLRMAVSRT
Sbjct: 61   MATQENTELASRQFCLYTLRKLITMYWNAGFESYCGPPGVREDAKETVRDALLRMAVSRT 120

Query: 121  QDSKIISASAYCVVQIAAFDFPDEWPGLLKSVYESITGERSLAALGLLHEIFDDVVSEEM 180
            QDSKIISASAYCVVQIAAFDFPDEWPGLLKSVYESITGERSLAALGLLHEIFDDVVSEEM
Sbjct: 121  QDSKIISASAYCVVQIAAFDFPDEWPGLLKSVYESITGERSLAALGLLHEIFDDVVSEEM 180

Query: 181  FFQGGVGWQTIRIIFELLGDDGPVALKDAAMKLYHSCXXXXXXXXXXXXXDTRAAVGAHV 240
            FFQGGVGWQTIRIIFELLGDDGPVALKDAAMKLYHSC             DTRAAVGAHV
Sbjct: 181  FFQGGVGWQTIRIIFELLGDDGPVALKDAAMKLYHSCLLQLAAPQALEEADTRAAVGAHV 240

Query: 241  HEALELFAQLLEHCRSLEPHADLLQFQAHTYENLVLIKTQLPKRFFPGAXXXXXXXXXXX 300
            HEALELFAQLLEHCRSLEPHADLLQFQAHTYENLVLIKTQLPKRFFPGA           
Sbjct: 241  HEALELFAQLLEHCRSLEPHADLLQFQAHTYENLVLIKTQLPKRFFPGALREALLDAVLR 300

Query: 301  XXXXXGAYYEQHLAEGDEELLKAVAESAIHMVIFLSSVHECKLNTERMCMLLGSLARLSC 360
                 GAYYEQHLAEGDEELLKAVAESAIHMVIFLSSVHECKLNTERMCMLLGSLARLSC
Sbjct: 301  DLVLLGAYYEQHLAEGDEELLKAVAESAIHMVIFLSSVHECKLNTERMCMLLGSLARLSC 360

Query: 361  LSAIQTEAWDVDYNSFISKETGLTSSYTPRDEIFQYLSDLGGHNYREFLRVLFEQLLQVE 420
            LSAIQTEAWDVDYNSFISKETGLTSSYTPRDEIFQYLSDLGGHNYREFLRVLFEQLLQVE
Sbjct: 361  LSAIQTEAWDVDYNSFISKETGLTSSYTPRDEIFQYLSDLGGHNYREFLRVLFEQLLQVE 420

Query: 421  SMAWRSQESLLFLLQSCQLNSEGPQFDEQTVAGLLEKSQRLLRSGDVHPLVRCRVAMTVP 480
            SMAWRSQESLLFLLQSCQLNSEGPQFDEQTVAGLLEKSQRLLRSGDVHPLVRCRVAMTVP
Sbjct: 421  SMAWRSQESLLFLLQSCQLNSEGPQFDEQTVAGLLEKSQRLLRSGDVHPLVRCRVAMTVP 480

Query: 481  RLLEKYMDSLPNVKDLVREFVFLTFNTTVTSENQLLSASALIAFTYYSSFVDFGSVLGVQ 540
            RLLEKYMDSLPNVKDLVREFVFLTFNTTVTSENQLLSASALIAFTYYSSFVDFGSVLGVQ
Sbjct: 481  RLLEKYMDSLPNVKDLVREFVFLTFNTTVTSENQLLSASALIAFTYYSSFVDFGSVLGVQ 540

Query: 541  TAEELEKLVLSTIKNILDGIDEDTPGFLLEVLSGVTGCNKESRNRELKLYELQLVQNVAT 600
            TAEELEKLVLSTIKNILDGIDEDTPGFLLEVLSGVTGCNKESRNRELKLYELQLVQNVAT
Sbjct: 541  TAEELEKLVLSTIKNILDGIDEDTPGFLLEVLSGVTGCNKESRNRELKLYELQLVQNVAT 600

Query: 601  ADPSNIQVVVEAQECLKNLLQYDPENYLQYAELCIPSFLEVLRADSSHGYAYTPXXXXXX 660
            ADPSNIQVVVEAQECLKNLLQYDPENYLQYAELCIPSFLEVLRADSSHGYAYTP      
Sbjct: 601  ADPSNIQVVVEAQECLKNLLQYDPENYLQYAELCIPSFLEVLRADSSHGYAYTPLVSLSL 660

Query: 661  XXXXXFMRKKPVDSALPRSMVDYIFDPLSSMLLNAEDDELLQLSTEAFXXXXXXXXXXXX 720
                 FMRKKPVDSALPRSMVDYIFDPLSSMLLNAEDDELLQLSTEAF            
Sbjct: 661  ELLVVFMRKKPVDSALPRSMVDYIFDPLSSMLLNAEDDELLQLSTEAFTALLASSLTDDL 720

Query: 721  XGRIPVIITILEKLLSARTSHSAAINAGTLLIAVLTKFANQIQDIMPKILEAAAKRLVQI 780
             GRIPVIITILEKLLSARTSHSAAINAGTLLIAVLTKFANQIQDIMPKILEAAAKRLVQI
Sbjct: 721  LGRIPVIITILEKLLSARTSHSAAINAGTLLIAVLTKFANQIQDIMPKILEAAAKRLVQI 780

Query: 781  KNLHTAENLLFVFCYLTSIDARQTVDFLSSTIIDEGGRTALQAIVPRWLEAFEVLRGEHK 840
            KNLHTAENLLFVFCYLTSIDARQTVDFLSSTIIDEGGRTALQAIVPRWLEAFEVLRGEHK
Sbjct: 781  KNLHTAENLLFVFCYLTSIDARQTVDFLSSTIIDEGGRTALQAIVPRWLEAFEVLRGEHK 840

Query: 841  IKENILSLSKLFFLEDPRIAGITVNGDLIPHDGDIIITRSMAKKMPDKYTQISAAEKIVK 900
            IKENILSLSKLFFLEDPRIAGITVNGDLIPHDGDIIITRSMAKKMPDKYTQISAAEKIVK
Sbjct: 841  IKENILSLSKLFFLEDPRIAGITVNGDLIPHDGDIIITRSMAKKMPDKYTQISAAEKIVK 900

Query: 901  LFVAELAFQQNQPDPGRYPKDGSGPADPHDSEGXXXXXXXXXXXXXXXXXKLQEYAXXXX 960
            LFVAELAFQQNQPDPGRYPKDGSGPADPHDSEG                 KLQEYA    
Sbjct: 901  LFVAELAFQQNQPDPGRYPKDGSGPADPHDSEGDSADEDWEDVDDILDYEKLQEYADDSD 960

Query: 961  XXXXXXSLLFTSNIEEDATTLLTQFFKEAVARNASGFQEIYSRLTEQEKKSLSACMV 1017
                  SLLFTSNIEEDATTLLTQFFKEAVARNASGFQEIYSRLTEQEKKSLSACMV
Sbjct: 961  IDDTGDSLLFTSNIEEDATTLLTQFFKEAVARNASGFQEIYSRLTEQEKKSLSACMV 1017

>Ecym_2594 Chr2 complement(1155746..1158805) [3060 bp, 1019 aa] {ON}
            similar to Ashbya gossypii AFR269W
          Length = 1019

 Score = 1044 bits (2699), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 520/1008 (51%), Positives = 692/1008 (68%), Gaps = 8/1008 (0%)

Query: 18   KMDLRQLVLAAQSAGKIERESAEQSLLEACRADPAAVCVGLVKMATQENTELASRQFCLY 77
            KMDL +L+L AQS  K +RESAE +LL  C +DP +V V L+ +A+  + E+AS+QFCL 
Sbjct: 12   KMDLSELILHAQSPVKDQRESAETALLSLCSSDPGSVFVSLINIASDPSAEVASKQFCLV 71

Query: 78   TLRKLITMYWNAGFESYCGPPGVREDAKETVRDALLRMAVSRTQDSKIISASAYCVVQIA 137
            ++RKLITMYWNAGFESYCGPPGV E AKE VR+ LL++ +  +Q+SKI+SAS+YC+VQIA
Sbjct: 72   SIRKLITMYWNAGFESYCGPPGVNEGAKEVVRENLLKLVLGDSQNSKIVSASSYCIVQIA 131

Query: 138  AFDFPDEWPGLLKSVYESITGERSLAALGLLHEIFDDVVSEEMFFQGGVGWQTIRIIFEL 197
            A DFPDEWP LL +VY++IT + S  AL LLHEIFDDVVSEEMFFQGG+GW+T++I+F L
Sbjct: 132  AVDFPDEWPSLLDTVYDAITYDYSANALSLLHEIFDDVVSEEMFFQGGIGWKTVQIVFSL 191

Query: 198  LGD-DGPVALKDAAMKLYHSCXXXXXXXXXXXXXDTRAAVGAHVHEALELFAQLLEHCRS 256
            L +      +KDAAMKLYHSC             + R+ +  HV+E L +F QLL +   
Sbjct: 192  LSNTSSSFGIKDAAMKLYHSCLLQLLSPHALESDENRSQIAQHVNETLHIFLQLLGNHNL 251

Query: 257  LEPHADLLQFQAHTYENLVLIKTQLPKRFFPGAXXXXXXXXXXXXXXXXGAYYEQHLAEG 316
             +P  +LL  +AHTYENL L+KTQ PK+ FP                  G YY Q LA  
Sbjct: 252  ADPSNELLDLKAHTYENLTLLKTQFPKKLFPDDLKGSFKTVALKDLDTLGKYYSQILASV 311

Query: 317  DEELLKAVAESAIHMVIFLSSVHECKLNTERMCMLLGSLARLSCLSAIQTEAWDVDYNSF 376
            DE LL++V ESAI+++ FLSS+HEC+L    +  LL SL +L  L   Q +    D NSF
Sbjct: 312  DEALLQSVDESAINIIGFLSSLHECELEGPEVNNLLESLVQLCSLPMHQADDLTNDLNSF 371

Query: 377  ISKETGLTSSYTPRDEIFQYLSDLGGHNYREFLRVLFEQLLQVESMAWRSQESLLFLLQS 436
            +SKETG++  YT RDE+FQ+LSD+ G NYR   + L EQ   V  + W  QES+L+LLQS
Sbjct: 372  VSKETGVSGVYTIRDEVFQFLSDMIGTNYRNIFQTLLEQAGSVMHLDWEKQESMLYLLQS 431

Query: 437  CQLNSEGPQFDEQTVAGLLEKSQRLLRSGDVHPLVRCRVAMTVPRLLEKYMDSLPNVKDL 496
            CQ N+E  + + Q +  LL + Q +L S ++H LV  R+++T+ ++LEK++  L N+K +
Sbjct: 432  CQGNTEEFEVNSQGLVELLLRLQNILESQNIHCLVWSRLSITIAKILEKFVCKLENIKLI 491

Query: 497  VREFVFLTFNTTVTSENQLLSASALIAFTYYSSFVDFGSVLGVQTAEELEKLVLSTIKNI 556
            V+EF+F T     +S N  + A +LI++  YSSFV  GSVLGV+  E+LE+ VL  I +I
Sbjct: 492  VKEFIFKTLTIASSSPNSTMKAGSLISYKCYSSFVALGSVLGVEDCEKLERQVLDIINDI 551

Query: 557  LDGIDEDTPGFLLEVLSGVTGCNKESRNRELKLYELQLVQNVATADPSNIQVVVEAQECL 616
               +D+DTPGFLLEVLSGV   N ES N+ LK  EL+ V  ++T+DP ++QVVVEAQ+CL
Sbjct: 552  YAEVDDDTPGFLLEVLSGVIASNPESTNKSLKASELEFVLKLSTSDPYSVQVVVEAQDCL 611

Query: 617  KNLLQ-YDPENYLQYAELCIPSFLEVLRADSSHGYAYTPXXXXXXXXXXXFMRKKPVDSA 675
             +LLQ    ++Y+ YAELCIPSF+ VLRAD +HG+AYTP           F++K P D  
Sbjct: 612  SSLLQKVRSDDYIYYAELCIPSFVSVLRADGTHGFAYTPLVSLSLELLTVFLKKNPSDGF 671

Query: 676  LPRSMVDYIFDPLSSMLLNAEDDELLQLSTEAFXXXXXXXXXXXXXGRIPVIITILEKLL 735
            LP+S+V+Y+F+PL+S+++++EDDELLQLSTEAF               +   I ILE+LL
Sbjct: 672  LPQSVVEYVFEPLTSLIMSSEDDELLQLSTEAFAFLLANSKKDDISSHLQTAIMILERLL 731

Query: 736  SARTSHSAAINAGTLLIAVLTKFANQIQDIMPKILEAAAKRLVQIKNLHTAENLLFVFCY 795
            ++ TS+SA+   G+LL++VLTKFA+QIQDIMPK+LEAAA+RLVQ+ N+HT ENL+ VFC+
Sbjct: 732  ASDTSYSASSKVGSLLLSVLTKFADQIQDIMPKLLEAAARRLVQVNNIHTVENLILVFCH 791

Query: 796  LTSIDARQTVDFLSSTIIDEGGRTALQAIVPRWLEAFEVLRGEHKIKENILSLSKLFFLE 855
            LTS+D +QTVDFLSS I+D  G +ALQ I+P+WL++FE++RGE KIKENI++LSKLFFL 
Sbjct: 792  LTSVDVKQTVDFLSSLILDSDGHSALQLIIPKWLDSFEIIRGEKKIKENIVALSKLFFLN 851

Query: 856  DPRIAGITVNGDLIPHDGDIIITRSMAKKMPDKYTQISAAEKIVKLFVAELAFQQNQPDP 915
            D R+A I VNGDLIP+DGD+IITRSMAK +PDKYT+ISA EKI+KL V EL FQ NQPDP
Sbjct: 852  DSRVANILVNGDLIPYDGDLIITRSMAKSLPDKYTRISAYEKIIKLMVTELMFQYNQPDP 911

Query: 916  GRYPKDGS------GPADPHDSEGXXXXXXXXXXXXXXXXXKLQEYAXXXXXXXXXXSLL 969
             +Y    S         +  +S                   KLQEY            LL
Sbjct: 912  DKYMSSQSEKLTKTNQDNKSNSGNADHDDDWEDIDDVLEYEKLQEYIEGSDIDDDDDDLL 971

Query: 970  FTSNIEEDATTLLTQFFKEAVARNASGFQEIYSRLTEQEKKSLSACMV 1017
              +NI+E  + LL+QFFKEAV ++ SGF++IY+RL EQEK+ LS  +V
Sbjct: 972  IMNNIQETTSELLSQFFKEAVIKDISGFKDIYTRLNEQEKRCLSIYIV 1019

>SAKL0F00880g Chr6 (76850..79879) [3030 bp, 1009 aa] {ON} similar to
            uniprot|P53067 Saccharomyces cerevisiae YGL241W
          Length = 1009

 Score =  845 bits (2184), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/1007 (44%), Positives = 628/1007 (62%), Gaps = 10/1007 (0%)

Query: 20   DLRQLVLAAQSAGKIERESAEQSLLEACRADPAAVCVGLVKMATQENTELASRQFCLYTL 79
            ++ QLV+ AQSA K ERE+AE SLL+    +P ++ + L+ +A   +  L SRQF L  L
Sbjct: 4    NVAQLVIQAQSADKKEREAAESSLLQFSAQEPESMFLSLIDIACN-SYPLTSRQFSLLFL 62

Query: 80   RKLITMYWNAGFESYCGPPGVREDAKETVRDALLRMAVSRTQDSKIISASAYCVVQIAAF 139
            R+L+TMYW+AGFESY GPPGV    K  VR++LLR+++  +QD K  ++S+YCVVQI+A 
Sbjct: 63   RRLVTMYWSAGFESYVGPPGVGSRGKSIVRESLLRLSLDDSQDIKTKNSSSYCVVQISAV 122

Query: 140  DFPDEWPGLLKSVYESITGERSLAALGLLHEIFDDVVSEEMFFQGGVGWQTIRIIFELLG 199
            DFPDEWP LL  +YE+I    SL+A+ LL EIFDDVVSEEMFFQGG+GWQTI+I+ ++L 
Sbjct: 123  DFPDEWPDLLIRIYEAIVEHYSLSAMSLLTEIFDDVVSEEMFFQGGIGWQTIQIVSQVLT 182

Query: 200  DDGPVALKD-AAMKLYHSCXXXXXXXXXXXXXDTRAAVGAHVHEALELFAQLLEHCRSL- 257
                      AA+ LYH+C             + + A+  H+ + L LF QLL+  +S  
Sbjct: 183  SSTSSVESKSAALDLYHACVLQLQSPQATSTIERKHAIAEHIKQMLGLFIQLLQFYQSSQ 242

Query: 258  -EPHADLLQFQAHTYENLVLIKTQLPKRFFPGAXXXXXXXXXXXXXXXXGAYYEQHLAEG 316
             E    LL+ +A  YENL ++K+   K+FFP                     Y + L   
Sbjct: 243  DEIQPTLLKLKASIYENLGMLKSNFSKQFFPEEEKNILKGLVLKDLNAISNIYYRSLNNT 302

Query: 317  DEELLKAVAESAIHMVIFLSSVHECKLNTERMCMLLGSLARLSCLSAIQTEAWDVDYNSF 376
            D++ + ++ E AIH+++FLSS+HE   +     +LL SL ++ CL+  QT  WD  +N F
Sbjct: 303  DDKDIDSLDECAIHIIVFLSSLHELVFSPTETPVLLDSLTKVCCLTDTQTSDWDNYFNIF 362

Query: 377  ISKETGLTSSYTPRDEIFQYLSDLGGHNYREFLRVLFEQLLQVESMAWRSQESLLFLLQS 436
            ++KETGL +SY+ RDE FQ+ S+L G NY   L  L + +       W+ QESL++L+++
Sbjct: 363  VTKETGLAASYSARDESFQFFSNLTGTNYTNLLAFLTQNVHASGIEDWKYQESLMYLMEA 422

Query: 437  CQLNSEGPQFDEQTVAGLLEKSQRLLRSGDVHPLVRCRVAMTVPRLLEKYMDSLPNVKDL 496
               N E    D Q V   L+    LL S + +  V+ RV + +P++LEK+MDSL ++K L
Sbjct: 423  AVNNDEEITNDFQPVLQTLDAFSELLASCETNEFVKVRVILILPKILEKFMDSLEDIKLL 482

Query: 497  VREFVFLTFNTTVTSENQLLSASALIAFTYYSSFVDFGSVLGVQTAEELEKLVLSTIKNI 556
            V++F+F TF         +L  ++LI+FTYYSSF +  SVLG +T ++L++ VL  I  I
Sbjct: 483  VKKFLFQTFTLVSAPTKDILKVASLISFTYYSSFAELDSVLGTETYQQLKEAVLKIINEI 542

Query: 557  LDGIDEDTPGFLLEVLSGVTGCNKESRN-RELKLYELQLVQNVATADPSNIQVVVEAQEC 615
             +  ++DTP  LLE L+ + G    +     ++  ELQL+  ++  DPSNIQVV+EAQEC
Sbjct: 543  YEDAEDDTPALLLETLNQIIGSTSNAEVIASVRFDELQLILKISAKDPSNIQVVLEAQEC 602

Query: 616  LKNLLQ-YDPENYLQYAELCIPSFLEVLRADSSHGYAYTPXXXXXXXXXXXFMRKKPVDS 674
            L+NLL+    E YL+YAE+ IPSF+ VL   +S G+ Y+P           FM+KKP + 
Sbjct: 603  LQNLLKNISLEIYLKYAEMAIPSFVNVLEGSNSSGFEYSPILSLSLELLTVFMKKKPTNG 662

Query: 675  ALPRSMVDYIFDPLSSMLLNAEDDELLQLSTEAFXXXXXXXXXXXXXGRIPVIITILEKL 734
             LP  + D++F PLS  L+ ++DDE+LQL+T+ +               +  I+++LEKL
Sbjct: 663  TLPPRITDFVFQPLSETLVGSQDDEVLQLTTDIYSFLINNSENSQIAPHLNTILSVLEKL 722

Query: 735  LSARTSHSAAINAGTLLIAVLTKFANQIQDIMPKILEAAAKRLVQIKNLHTAENLLFVFC 794
            LS  TS SAA+N G+L+IA+  K ++Q+Q+ +P ILEAAAKRLVQ+ N+ TAENL+FVFC
Sbjct: 723  LSINTSDSAAMNVGSLIIAIFCKLSDQLQETIPTILEAAAKRLVQVHNIATAENLIFVFC 782

Query: 795  YLTSIDARQTVDFLSSTIIDEGGRTALQAIVPRWLEAFEVLRGEHKIKENILSLSKLFFL 854
            YLTS +  QTVDFLSS ++D  G +AL+ I+P+WLE+FE++RGE +IKENIL+LSKLFFL
Sbjct: 783  YLTSTNPNQTVDFLSSLVLDSEGNSALKLILPKWLESFEIIRGEKRIKENILALSKLFFL 842

Query: 855  EDPRIAGITVNGDLIPHDGDIIITRSMAKKMPDKYTQISAAEKIVKLFVAELAFQQNQPD 914
             D RI+ I VNGD IP+DGD++ITRSM+K MP+KYTQISA EKIVKLFVAEL+FQ NQP 
Sbjct: 843  NDERISSIIVNGDSIPYDGDLVITRSMSKIMPEKYTQISAYEKIVKLFVAELSFQGNQPG 902

Query: 915  PGRY-PKDGSGPADPH-DSEGXXXXXXXXXXXXXXXXXKLQEYA--XXXXXXXXXXSLLF 970
              +Y P D     D    +                   KLQEY              ++ 
Sbjct: 903  LEKYIPHDLKKYDDQAIKAANDANDDDWEDVDDVLEYEKLQEYVDDESDLEDDEEGDVIG 962

Query: 971  TSNIEEDATTLLTQFFKEAVARNASGFQEIYSRLTEQEKKSLSACMV 1017
               + +    LL QFF+EA A+N SGFQEIY+ L + EK+ L+  +V
Sbjct: 963  VQELHQSTRELLIQFFREAAAKNVSGFQEIYNHLNDNEKRVLTENLV 1009

>Kwal_47.19258 s47 complement(1156969..1160004) [3036 bp, 1011 aa]
            {ON} YGL241W (KAP114) - Kap114p [contig 344] FULL
          Length = 1011

 Score =  742 bits (1915), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/1008 (39%), Positives = 596/1008 (59%), Gaps = 20/1008 (1%)

Query: 21   LRQLVLAAQSAGKIERESAEQSLLEACRADPAAVCVGLVKMATQENTELASRQFCLYTLR 80
            L + + +AQS  K  RE  E  + + C  DP+  C  LV++A +++  + +R F L +LR
Sbjct: 5    LEEAIASAQSPDKQTREQGEACIWKLCSEDPSFSCACLVQLACRQDYRIENRLFSLLSLR 64

Query: 81   KLITMYWNAGFESYCGPPGVREDAKETVRDALLRMAVSRTQDSKIISASAYCVVQIAAFD 140
            KLITMYW+AGFESY GPPGV ED KE +R++LL + +   QD++I   S+YC+VQIAA D
Sbjct: 65   KLITMYWSAGFESYRGPPGVNEDCKELIRNSLLELGLDDAQDTRIQKGSSYCIVQIAAVD 124

Query: 141  FPDEWPGLLKSVYESITGERSLAALGLLHEIFDDVVSEEMFFQGGVGWQTIRIIFELLGD 200
            FPDEWPGL++ VY +I    S++AL +L+EIFDDVVSEEMFF  GVGWQTI++I  +L D
Sbjct: 125  FPDEWPGLIEIVYNAILRSHSVSALYVLNEIFDDVVSEEMFFNQGVGWQTIQLISNILND 184

Query: 201  DG-PVALKDAAMKLYHSCXXXXXXXXXXXXXDTRAAVGAHVHEALELFAQLLEHCRSLEP 259
             G  +  K +A KLY +C             + R+A+  H+ E+ ++   LL+   +++ 
Sbjct: 185  PGCSILAKHSAAKLYQACLLQLQSPAASSTPELRSALTNHIQESTKMLLNLLQAYSNIQD 244

Query: 260  HA-DLLQFQAHTYENLVLIKTQLPKRFFPGAXXXXXXXXXXXXXXXXGAYYEQHLAEGDE 318
             A DLL+      + L  I+T  PK+                      A    +    +E
Sbjct: 245  EAIDLLRLHQTVLKCLTTIRTGFPKKLSSDTIGRELTTVLIENFTRVAALSNDN---TEE 301

Query: 319  ELLKAVAESAIHMVIFLSSVHECKLNTERMCMLLGSLARLSCLSAIQTEAWDVDYNSFIS 378
            E    + E  I MV  L+++ +  L    +  ++      SCL   + EAW+ D+N F+S
Sbjct: 302  EKSSEINEVGIQMVSLLATIPDRYLGGPALSKVVEDFVLASCLGTEEEEAWESDFNHFVS 361

Query: 379  KETGLTSSYTPRDEIFQYLSDLGGHNYREFLRVLFEQLLQVESMAWRSQESLLFLLQSCQ 438
            KE GL SSY  RDE  Q+L ++ G  Y+    +L   L +V+ + WR +E++ +L+QS  
Sbjct: 362  KEVGLASSYYIRDECSQFLQEISGARYQSIFEILVSALSKVDPLEWRLKEAVFYLIQSLC 421

Query: 439  LN-SEGPQFDEQTVAGLLEKSQRLLRSGDVHPLVRCRVAMTVPRLLEKYMDSLPNVKDLV 497
            +N  E   F+   V  LL + ++ +   ++   VR R  + +P+++EK+MD L NVKD+V
Sbjct: 422  INEDEVTVFNNNEVFDLLNELRQNMEGQNLQLHVRTRAILALPKVVEKFMDRLENVKDIV 481

Query: 498  REFVFLTFNTTVTSENQLLSASALIAFTYYSSFVDFGSVLGVQTAEELEKLVLSTIKNIL 557
            +E +F T N      +  L ASALIAF+ Y+SF +  SVLG++  +E   LVL+ I+++L
Sbjct: 482  KELLFATLNGACEDNDPTLKASALIAFSSYASFAELDSVLGLEAFQEARCLVLNLIQDVL 541

Query: 558  DGIDEDTPGFLLEVLSGVTGCNKESRNRELKLY---ELQLVQNVATADPSNIQVVVEAQE 614
            +  ++DTP  LLE L+      K+S   +  L+    L LV  ++  DPSN+QVV+EAQ+
Sbjct: 542  EDSEDDTPAVLLEALNPALA--KQSNTTKDTLFYQQALNLVLKISAKDPSNLQVVLEAQD 599

Query: 615  CLKNLLQYDP-ENYLQYAELCIPSFLEVLRADSSHGYAYTPXXXXXXXXXXXFMRKKPVD 673
            C+  LL  +  E+Y++ ++ CIP F+ +L    ++ Y Y P           FM+KKP D
Sbjct: 600  CISALLSGESTESYVELSKSCIPLFVNILGTMKANNYIYAPIVSLSLELLTVFMKKKPSD 659

Query: 674  SALPRSMVDYIFDPLSSMLLNAEDDELLQLSTEAFXXXXXXXXXXXXXGRIPVIITILEK 733
              LP ++  Y+F+PLS +L+N+ DDE+LQ++++A                +P +++ILEK
Sbjct: 660  GFLPSNISSYVFEPLSDILINSSDDEILQVASDALTYLMSNSQASDLEPLLPTVLSILEK 719

Query: 734  LLSARTSHSAAINAGTLLIAVLTKFANQIQDIMPKILEAAAKRLVQIKNLHTAENLLFVF 793
            LLS  TS S A+N G+L++  L K++ Q+Q++ PKILEAA KR V  KN+ T ENL+FVF
Sbjct: 720  LLSVNTSDSGAMNVGSLVVITLEKYSYQLQEVYPKILEAATKRFVSAKNVATTENLVFVF 779

Query: 794  CYLTSIDARQTVDFLSSTIIDEGGRTALQAIVPRWLEAFEVLRGEHKIKENILSLSKLFF 853
            CYLTSI+  + ++FLSS  I+E    +L  ++P+WLE+FEVLRGE +IKENI++LSK+FF
Sbjct: 780  CYLTSINPAEAINFLSSFTINEKEGNSLNYVLPKWLESFEVLRGERRIKENIVALSKIFF 839

Query: 854  LEDPRIAGITVNGDLIPHDGDIIITRSMAKKMPDKYTQISAAEKIVKLFVAELAFQQNQP 913
              DPR+  + VNGD +P+ GDII+TRSMAKKMP +YT+I+A EKIVKLFVAEL FQ +QP
Sbjct: 840  QSDPRVGSVIVNGDPLPYKGDIIVTRSMAKKMPIEYTRITAHEKIVKLFVAELEFQSSQP 899

Query: 914  D-----PGRYPKDGSGPADPHDSEGXXXXXXXXXXXXXXXXXKLQEYAX---XXXXXXXX 965
                  P    K  +  +  +++E                  +LQ++             
Sbjct: 900  SLDKFLPVNARKFDTSSSFNNNAEDEQDDGEWEDVDDVLEYDQLQQFVVEDGERNDSDDE 959

Query: 966  XSLLFTSNIEEDATTLLTQFFKEAVARNASGFQEIYSRLTEQEKKSLS 1013
             SL    +I++    LL  FFKEA A+N +  +++Y  L+E EKK LS
Sbjct: 960  DSLANIQDIQQSTKELLIDFFKEAAAKNINNLRDLYENLSEHEKKILS 1007

>TDEL0D06320 Chr4 complement(1134120..1137176) [3057 bp, 1018 aa] {ON}
            Anc_3.564 YGL241W
          Length = 1018

 Score =  691 bits (1782), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/1020 (39%), Positives = 587/1020 (57%), Gaps = 31/1020 (3%)

Query: 20   DLRQLVLAAQSAGKIERESAEQSLLEACRADPAAVCVGLVKMATQENTELASRQFCLYTL 79
            D +QL+  AQSA  + R SAE  LLE    D + V +  +K+A+     L+SRQF L +L
Sbjct: 8    DSQQLIKEAQSADDVVRRSAEAQLLELSDRDASLVFLSFMKVASDSQELLSSRQFALVSL 67

Query: 80   RKLITMYWNAGFESYCGPPGVREDAKETVRDALLRMAVSRTQDSKIISASAYCVVQIAAF 139
            RKLITMYW+ GFESY     ++E+AKETVRD LL++ ++  + SK+ISA+AYCVVQI+A 
Sbjct: 68   RKLITMYWSPGFESYRSCSNLKEEAKETVRDYLLKLCLNDQEISKVISAAAYCVVQISAV 127

Query: 140  DFPDEWPGLLKSVYESITGERSLAALGLLHEIFDDVVSEEMFFQGGVGWQTIRIIFELLG 199
            DFPD+WP LL  +Y+ I  + SL+A+ LL EI+DDV+SEEMFF+ G+G +TIRI+F+++ 
Sbjct: 128  DFPDQWPKLLTVLYDGILNKHSLSAMSLLTEIYDDVMSEEMFFEEGIGLETIRIVFQIVR 187

Query: 200  D-DGPVALKDAAMKLYHSCXXXXXXXXXXXXXDTRAAVGAHVHEALELFAQLLEHCRSLE 258
            D +  +  K A   L+H+C               +        EAL ++ + L+   S+ 
Sbjct: 188  DPNTNLEAKLAGFNLFHACLQQILTVDLNSAPKRKEMTVECAKEALTVWGEHLQ-SHSIT 246

Query: 259  PHADLLQFQAHTYENLVLIKTQLPKRFFPGAXXXXXXXXXXXXXXXXGAYY---EQHLAE 315
             H+  LQ +   YE+L L+K +L K+  P A                G  Y    Q   E
Sbjct: 247  EHSLQLQIKGRIYEDLSLMKNELSKKLIPDALYVPFKELVLIDLETAGKVYLSISQGFVE 306

Query: 316  GDEELLKAVAESAIHMVIFLSSVHECKLNTERMCMLLGSLARLSCLSAIQTEAWDVDYNS 375
            G    L  + E AIH++ FL++     +++  +  ++ +L  L CL       W  D+NS
Sbjct: 307  GYR--LDDLNECAIHIIEFLTATCHFTMDSAEVERIITALGELCCLDNDTVTLWLEDFNS 364

Query: 376  FISKETGLTSSYTPRDEIFQYLSDLGGHNYREFLRVLFEQL--LQVESMAWRSQESLLFL 433
            +IS E+GLT+SY+ RD+  + L+ + G NY    + +  ++  L      W+ QES LFL
Sbjct: 365  YISMESGLTASYSVRDQASELLTSMDGRNYSLVCQHILYKVSHLNEWKQEWKFQESFLFL 424

Query: 434  LQSCQLNSEGPQFD-EQTVAGLLEKSQRLLRSGDVHPLVRCRVAMTVPRLLEKYMDSLPN 492
            +Q+  LN   P  +    +  +L     +L S DV   V  R+ + +P++LEKYMD L +
Sbjct: 425  VQAAALNESLPSGNFINEIREVLSFLGSMLCSEDVVSFVSSRIILLLPKILEKYMDLLDD 484

Query: 493  VKDLVREFVFLTFNTTVTSENQLLSASALIAFTYYSSFVDFGSVLGVQTAEELEKLVLST 552
            V+ L    +  +    + + + ++ AS LIAFTY S+F +  SVLG +  E  +K VL  
Sbjct: 485  VRILTSHLLTKSAELALATNDDIIKASVLIAFTYCSNFAELSSVLGQEVCEITQKRVLGL 544

Query: 553  IKNILDGIDEDTPGFLLEVLSGVTGCNKES-RNRELKLYELQLVQNVATADPSNIQVVVE 611
            I  I +  ++DT G L+EVL+ V  CN     N E+   E  LV  ++  DP+NIQ+VVE
Sbjct: 545  IARISEDAEDDTDGVLMEVLNNVIDCNTPGVPNNEIVQTEFSLVLKISAKDPANIQIVVE 604

Query: 612  AQECLKNLLQ-YDPENYLQYAELCIPSFLEVLRADSSHGYAYTPXXXXXXXXXXXFMRKK 670
            +QECL+ LL+  D ++Y  Y E  +PSF++ +   +   YAY+P           F+ KK
Sbjct: 605  SQECLEKLLENLDIDHYKNYVETWLPSFMKSIEGSAQTKYAYSPLLSLVLQFLTTFL-KK 663

Query: 671  PVDSALPRSMVDYIFDPLSSMLLNAEDDELLQLSTEAFXXXXXXXXXXXXXGRIPVIITI 730
            P D  LP  M +  F+PL  +LLN+EDDE +QL+TEAF               +  I+ I
Sbjct: 664  PTDYQLPTVMCNLTFEPLRQILLNSEDDETIQLATEAFSYFLYNTDPTVVAPHLEAIVAI 723

Query: 731  LEKLLSARTSHSAAINAGTLLIAVLTKFANQIQDIMPKILEAAAKRLVQIKNLHTAENLL 790
            L++LLS   S +AA+  G+L++ V T+F+ +I+++MP IL AAA RL+Q K+L T++NLL
Sbjct: 724  LDRLLSFDVSDAAAMYVGSLIVTVFTRFSTEIENMMPIILRAAANRLIQAKHLSTSQNLL 783

Query: 791  FVFCYLTSIDARQTVDFLSSTIIDEGGRTALQAIVPRWLEAFEVLRGEHKIKENILSLSK 850
             VFC+LTS+D RQTVDFL    +D     AL +IV  WLE+FE +RGE + KEN+++L K
Sbjct: 784  SVFCFLTSVDPRQTVDFLFGLHLDNTEHNALYSIVSIWLESFESIRGERRTKENVIALIK 843

Query: 851  LFFLEDPRIAGITVNGDLIPHDGDIIITRSMAKKMPDKYTQISAAEKIVKLFVAELAFQQ 910
            L+ L D R+  + VN ++IP++G+ IITRSMAKKMPD+Y+Q+S   KI+KLFVAEL FQ 
Sbjct: 844  LYLLHDKRLMEMQVNDEIIPYEGEQIITRSMAKKMPDRYSQVSVYTKIIKLFVAELNFQD 903

Query: 911  NQPDPGRY-----PKDG-SGPADPH-DSEGXXXXXXXXXXXXXXXXXKLQEYAXXXXX-- 961
             QPDP R+      K+G +G +D   DS+G                 KLQEY        
Sbjct: 904  KQPDPERFITSDMAKEGNNGNSDNDTDSDG-----EWEDVEDVLNYEKLQEYVDESDQDG 958

Query: 962  XXXXXSLLFTSNIEEDATT----LLTQFFKEAVARNASGFQEIYSRLTEQEKKSLSACMV 1017
                    F S I+E +      +L  FFKE  A N  GF++IY+ LTE EKK LS  +V
Sbjct: 959  EGSDSDDFFASAIDEYSNASVRDILVSFFKEVAANNTGGFRDIYNSLTEVEKKILSENLV 1018

>KLTH0G00792g Chr7 (53588..56653) [3066 bp, 1021 aa] {ON} similar to
            uniprot|P53067 Saccharomyces cerevisiae YGL241W
          Length = 1021

 Score =  676 bits (1744), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/1012 (37%), Positives = 574/1012 (56%), Gaps = 15/1012 (1%)

Query: 18   KMDLRQLVLAAQSAGKIERESAEQSLLEACRADPAAVCVGLVKMATQENTELASRQFCLY 77
            K  L++ ++ AQS     RE++E +L   C  +P+A C  L+++A      +  R F L 
Sbjct: 13   KEKLKEAIVGAQSTNGQVRENSENALWSLCSENPSATCTSLMQLACGIENAVEDRIFSLL 72

Query: 78   TLRKLITMYWNAGFESYCGPPGVREDAKETVRDALLRMAVSRTQDSKIISASAYCVVQIA 137
            +LRKLITMYW+AGFESY GPPG+ ++ K  +R++LL + +  +QD+++ + S+YC+VQIA
Sbjct: 73   SLRKLITMYWSAGFESYRGPPGIGDEGKRMIRESLLNLGLDDSQDTRLKNCSSYCIVQIA 132

Query: 138  AFDFPDEWPGLLKSVYESITGERSLAALGLLHEIFDDVVSEEMFFQGGVGWQTIRIIFEL 197
            A DFPDEWP L+ S++++I   +SL+AL +L+EIFDDVVSEEMFF  G+GWQTI++IF +
Sbjct: 133  AVDFPDEWPTLVDSIFDAILQRQSLSALYVLNEIFDDVVSEEMFFHRGIGWQTIQLIFRI 192

Query: 198  LGD-DGPVALKDAAMKLYHSCXXXXXXXXXXXXXDTRAAVGAHVHEALELFAQLL-EHCR 255
            L + D     K A+ KLY +C             D + A+  H+ E++ L  ++L EH  
Sbjct: 193  LSNSDSSTQAKTASAKLYQACLLQLQSPMATSTQDYKYALSNHIQESVLLLIKVLKEHHI 252

Query: 256  SLEPHADLLQFQAHTYENLVLIKTQLPKRFFPGAXXXXXXXXXXXXXXXXGAYYEQHLAE 315
            +   +   L  Q      L  IKT   K+ F                            +
Sbjct: 253  AKGINTSALNLQQVLLSCLNTIKTGFSKKLFTIESAQELIEFLFENFRKIAELCIDVTID 312

Query: 316  GDEELLKAVAESAIHMVIFLSSVHECKLNTERMCMLLGSLARLSCLSAIQTEAWDVDYNS 375
             D +L  A  E  I MV   +++ +     +    ++ S      +S    E WD D+N 
Sbjct: 313  PDMKL--AANEVGIQMVSLFATLMDTLTENQNWNFIVESFVIAGMISDEDAECWDNDFNV 370

Query: 376  FISKETGLTSSYTPRDEIFQYLSDLGGHNYREFLRVLFEQLLQVESMAWRSQESLLFLLQ 435
            F SKETGL++S+T RDE  Q++  L G  Y      L   L+  ES  W+ QES+LF +Q
Sbjct: 371  FASKETGLSTSFTVRDECEQFMQGLSGFAYNSVFNALTSALIYNESPNWKVQESILFFIQ 430

Query: 436  S-CQLNSEGPQFDEQTVAGLLEKSQRLLRSGDVHPLVRCRVAMTVPRLLEKYMDSLPNVK 494
            + C    +   F+ +    LL   +++L   D H LV+ R  + +P+++E++M++L +VK
Sbjct: 431  ALCGNEDDEVSFNFEKTQSLLNTLRQILELEDSHILVKTRSLIALPKVIERFMETLESVK 490

Query: 495  DLVREFVFLTFNTTVTSENQLLSASALIAFTYYSSFVDFGSVLGVQTAEELEKLVLSTIK 554
             LV++ +F +F+    + +  +    LI+FTYY+SF +  SVLG     E ++ V + I+
Sbjct: 491  ALVKDSLFHSFSLARQTPSYTVKIGCLISFTYYASFAELDSVLGPGFYGEAQRSVSAIIQ 550

Query: 555  NILDGIDEDTPGFLLEVLSGVTGCNKESRNRELKLYE--LQLVQNVATADPSNIQVVVEA 612
             +L+  +EDTP  LLE L+     N ++    +  Y+  LQL+  +++  PSNIQV +EA
Sbjct: 551  ELLEEAEEDTPSILLEALAPTLSSNHKT-TETISFYQLALQLILKISSKHPSNIQVGLEA 609

Query: 613  QECLKNLLQ-YDPENYLQYAELCIPSFLEVLRADSSHGYAYTPXXXXXXXXXXXFMRKKP 671
            Q+CL NLL+    E Y+ Y++ CIP F  VL     + +AY P           F+++KP
Sbjct: 610  QDCLSNLLKSTSTEEYVTYSKTCIPLFANVLNGMIENKFAYAPIVCLSLEMLTVFIKRKP 669

Query: 672  VDSALPRSMVDYIFDPLSSMLLNAEDDELLQLSTEAFXXXXXXXXXXXXXGRIPVIITIL 731
             D  LP  +  Y+F+PLS +L+N+ DDE++QL+++A                + V++  L
Sbjct: 670  RDGCLPSDITSYVFNPLSDILINSSDDEIMQLTSDALVYLISNSEPHQLFPHLNVVLCDL 729

Query: 732  EKLLSARTSHSAAINAGTLLIAVLTKFANQIQDIMPKILEAAAKRLVQIKNLHTAENLLF 791
            EKLLSA TS S AI+ G L++ VL KF+ Q+Q+I P+ILEAA K+ +   N+ T ENL  
Sbjct: 730  EKLLSAETSDSGAIHVGNLVVVVLEKFSKQLQEIYPRILEAATKKFLGAHNVFTTENLAN 789

Query: 792  VFCYLTSIDARQTVDFLSSTIIDEGGRTALQAIVPRWLEAFEVLRGEHKIKENILSLSKL 851
            VFCYL S++  + ++FLSS  ID+  ++ L  ++ +WLE+FEVLRGE +IKENI++LSKL
Sbjct: 790  VFCYLVSLNPAEVINFLSSFSIDQQEQSVLCPVLSKWLESFEVLRGEKRIKENIMALSKL 849

Query: 852  FFLEDPRIAGITVNGDLIPHDGDIIITRSMAKKMPDKYTQISAAEKIVKLFVAELAFQQN 911
            FF  D RI  I VNGD IP+ GD+IITRSMAK MP+KYT+I+A +KIVKLFVAEL FQ +
Sbjct: 850  FFQADSRIDKIYVNGDPIPYSGDMIITRSMAKSMPEKYTRITAYQKIVKLFVAELDFQTS 909

Query: 912  QPDPGRYPKDGSGPADPH---DSEGXXXXXXXXXXXXXXXXXKLQEYAXXXXXXXXXXS- 967
            Q D  +Y    +   +     ++E                  +LQ +             
Sbjct: 910  QTDLEKYIPMSAKKTECSTIANAEAGQEESDWEDVDDVLEYEQLQHFVDQDTFSSDRDEE 969

Query: 968  --LLFTSNIEEDATTLLTQFFKEAVARNASGFQEIYSRLTEQEKKSLSACMV 1017
              +    N+++    LL  FFKEA ++N + F+ IY  L+E EK+ LS  +V
Sbjct: 970  DVIPGIKNVQQSTRELLISFFKEAASQNINDFKTIYDNLSENEKRILSENLV 1021

>NDAI0B06260 Chr2 complement(1515207..1518248) [3042 bp, 1013 aa] {ON}
            Anc_3.564 YGL241W
          Length = 1013

 Score =  674 bits (1738), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/1017 (37%), Positives = 583/1017 (57%), Gaps = 30/1017 (2%)

Query: 19   MDLRQLVLAAQSAGKIERESAEQSLLEACRADPAAVCVGLVKMATQENTELASRQFCLYT 78
            MD+ QL++ AQS+    R++AE  LL+AC  + A +   L+K A   NT++ASRQF L +
Sbjct: 1    MDINQLIVQAQSSDNAVRDAAESQLLQACDTNAAQIFTSLMKGACDGNTDIASRQFALLS 60

Query: 79   LRKLITMYWNAGFESYCGPPGVREDAKETVRDALLRMAVSRTQDSKIISASAYCVVQIAA 138
            LRKLITMYW+ GFESY     + +  KE +R++LL + +   QDSKI  ++AYCVVQI+A
Sbjct: 61   LRKLITMYWSPGFESYRNTSTINDQTKEYIRESLLNICLDDLQDSKITKSAAYCVVQISA 120

Query: 139  FDFPDEWPGLLKSVYESITGERSLAALGLLHEIFDDVVSEEMFFQGGVGWQTIRIIFELL 198
             DFPD+WP LL  +Y++I+   SL A+ LL+EI+DDVVSEEMFF+G +G +T++IIF++L
Sbjct: 121  VDFPDQWPQLLVILYDTISQSHSLNAMSLLNEIYDDVVSEEMFFEGQIGMETLQIIFQVL 180

Query: 199  GDD-GPVALKDAAMKLYHSCXXXXXXXXXXXXXDTRAAVGAHVHEALELFAQLLEHCRSL 257
             ++ G +  K AA KL+++C               +      + +++++  QLLE+  ++
Sbjct: 181  SNNEGKIEAKIAATKLFNACILQMSVLDPSSSLKRKKLAEECIPKSIQVLGQLLEY-YTI 239

Query: 258  EPHAD------LLQFQAHTYENLVLIKTQLPKRFFPGAXXXXXXXXXXXXXXXXGAYYEQ 311
            +   D      +L+ ++  YEN+VLIK +LPKR F                      YE 
Sbjct: 240  DTTVDSKMLTSILELRSKIYENVVLIKNELPKRLFQRNLMASFKFQTLKDLSSSCTLYET 299

Query: 312  HLAEGDE-----ELLKAVAESAIHMVIFLSSVHECKLNTERMCMLLGSLARLSCLSAIQT 366
            +     E      L  A++E +IHM+ FL++    K +   +  ++  L  L CL     
Sbjct: 300  YCLNNIEVVNSDNLHDALSECSIHMLDFLTATCSLKFDNSEVSTIVQDLTVLCCLDNDSQ 359

Query: 367  EAWDVDYNSFISKETGLTSSYTPRDEIFQYLSDLGGHNYREFLRVLFEQLLQVESMAWRS 426
            E    D+N+F+SKETGL  SYT RD+  ++L+ L   NY   L+ +    +   +   R+
Sbjct: 360  EELAADFNAFVSKETGLLPSYTIRDQASEFLNSLSDPNYATILQAIINTFISTMNQPSRN 419

Query: 427  Q---ESLLFLLQSCQLNSEGPQFDEQTVAGLLEKSQRLLRSGDVHPLVRCRVAMTVPRLL 483
                ES+L+LLQS   N +        +  LLE    L      +P +  R+ + +P++L
Sbjct: 420  DRILESILYLLQSLMTNEDDVTNINPNI--LLEPLSSLFDYETENPFLHSRLILLIPKIL 477

Query: 484  EKYMDSLPNVKDLVREFVFLTFNTTVTSENQLLSASALIAFTYYSSFVDFGSVLGVQTAE 543
            EK+MD +PNVK + ++F+  +   ++   + L   SALI +TYY+ F +  SVLG     
Sbjct: 478  EKFMDEIPNVKVVTKDFLTKSLKYSLQMNDGLNKISALIGYTYYAYFAELPSVLGRDVCT 537

Query: 544  ELEKLVLSTIKNILDGIDEDTPGFLLEVLSGVTGCNKESRNRELKL-YELQLVQNVATAD 602
            ++++ +L  I  ++   +EDT G L+EVL+ V  CN E    +  L  E  +V ++++ D
Sbjct: 538  QVQENILLLITQVVHESEEDTHGLLVEVLNHVIDCNPEDIAVQGILETEFYMVLSISSKD 597

Query: 603  PSNIQVVVEAQECLKNLLQ-YDPENYLQYAELCIPSFLEVLRADSSHGYAYTPXXXXXXX 661
            P+NIQV + ++ECL+ LL+  +   Y  Y ++C+PSF+ V++  S   Y Y+P       
Sbjct: 598  PANIQVAIGSEECLEKLLEGVNTRTYTHYIDMCLPSFINVIKGHSVTEYKYSPLLSLILE 657

Query: 662  XXXXFMRKKPVDSALPRSMVDYIFDPLSSMLLNAEDDELLQLSTEAFXXXXXXXXXXXXX 721
                FM+KKP D  LP  + ++IF PL ++L ++ +DE LQL+T+AF             
Sbjct: 658  FVTVFMKKKPTDGPLPAIIFEHIFQPLLNVLNHSTEDETLQLATDAFSYLLYNTDSTLMI 717

Query: 722  GRIPVIITILEKLLSARTSHSAAINAGTLLIAVLTKFANQIQDIMPKILEAAAKRLVQIK 781
              +  I+ +L++LLS   S +AA+N GTL++ + +KF+N++Q ++P IL AA  +LVQ K
Sbjct: 718  PHLEEIVAVLDRLLSINVSDTAAMNVGTLIVTIFSKFSNELQSLIPTILRAAVTKLVQAK 777

Query: 782  NLHTAENLLFVFCYLTSIDARQTVDFLSSTIIDEGGRTALQAIVPRWLEAFEVLRGEHKI 841
            N+ T +NL+ + C+LT  D  QT++FL    +DE   T   A++ +W EAFEV+RGE KI
Sbjct: 778  NISTQQNLISLLCFLTCTDPLQTIEFLYG--LDETHST-FAAVMNKWFEAFEVIRGEKKI 834

Query: 842  KENILSLSKLFFLEDPRIAGITVNGDLIPHDGDIIITRSMAKKMPDKYTQISAAEKIVKL 901
            KENIL+LSKL+F  DPR+  + VNGDLIP++GD+IITRSMAK MPDKYTQI A  KI+KL
Sbjct: 835  KENILALSKLYFTCDPRLGSLLVNGDLIPYEGDLIITRSMAKTMPDKYTQIPAYTKIIKL 894

Query: 902  FVAELAFQQNQP-DPGRYPKDGSGPADPHDSEGXXXXXXXXXXXXXXXXXKLQEYAXXXX 960
            FV+EL+FQ  Q  +P     D  G     + E                  KL+EY     
Sbjct: 895  FVSELSFQTQQTGEPTVLNADLKGIE--KEEEEVGDDDEWEDVDDVLDYDKLKEYVDDED 952

Query: 961  XXX----XXXSLLFTSNIEEDATTLLTQFFKEAVARNASGFQEIYSRLTEQEKKSLS 1013
                       +   ++++E  T LL +FFKE  +++ + F  IY+ L++  KK LS
Sbjct: 953  PAEFGEDDKDEITGLADVKETVTELLLEFFKEVTSKDTNNFHAIYNTLSDNGKKILS 1009

>NCAS0F03950 Chr6 complement(791754..794792) [3039 bp, 1012 aa] {ON}
            Anc_3.564 YGL241W
          Length = 1012

 Score =  664 bits (1713), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/1022 (36%), Positives = 589/1022 (57%), Gaps = 33/1022 (3%)

Query: 19   MDLRQLVLAAQSAGKIERESAEQSLLEACRADPAAVCVGLVKMATQENTELASRQFCLYT 78
            MD+ QL+  AQS+    RE+AE  L  +C  + + +   L+ +A    + L++RQF L T
Sbjct: 1    MDIYQLITQAQSSDTQTREAAENQLSSSCDQNASQIFTSLMSVALDPKSPLSTRQFSLLT 60

Query: 79   LRKLITMYWNAGFESYCGPPGVREDAKETVRDALLRMAVSRTQDSKIISASAYCVVQIAA 138
            +RK ITMYW+ GF+SY     ++E+ KE +R++LL++ +   QD+KI ++++YC+VQI+A
Sbjct: 61   IRKFITMYWSPGFQSYRNTSTIQENTKEYIRNSLLQLCLDDAQDTKIKNSASYCIVQISA 120

Query: 139  FDFPDEWPGLLKSVYESITGERSLAALGLLHEIFDDVVSEEMFFQGGVGWQTIRIIFELL 198
             DFPD+WP LL ++Y +I    SL AL LL+EI+DDV+SEEMFF+G +G +T++IIF+LL
Sbjct: 121  VDFPDQWPQLLSTIYMAIEQNHSLNALSLLNEIYDDVISEEMFFEGQIGMETLQIIFQLL 180

Query: 199  -GDDGPVALKDAAMKLYHSCXXXXXXXXXXXXXDTRAAVGAHVHEALELFAQLLEHCRSL 257
              ++  +  K A  KL+++C             + +  V   + +ALE+  QLLE    L
Sbjct: 181  TNNNANLKAKIAGTKLFNACLLQMSVVDSSSKHNRKEFVKECIFKALEVLGQLLE----L 236

Query: 258  EPHAD---LLQFQAHTYENLVLIKTQLPKRF----FPGAXXXXXXXXXXXXXXXXGAYYE 310
             P ++   +L  +   YEN+VLI  +  ++     F G                  A+ E
Sbjct: 237  YPVSNDSLILNLRTKIYENVVLISNEFSRKLFTQAFKGLYKLQSFRDLEACSNQFNAFLE 296

Query: 311  QHLAEGDEELLKAVAESAIHMVIFLSSVHECKLNTERMCMLLGSLARLSCLSAIQTEAWD 370
             +L++ D ++L+++ E  IH++ FL+S+ +     + + +++ SL  L CL +   E W 
Sbjct: 297  -NLSQADNDILESMNECVIHVLDFLTSISDSDFTMQEINLIVQSLTFLCCLDSDTLEQWS 355

Query: 371  VDYNSFISKETGLTSSYTPRDEIFQYLSDLGGHNYREFLRVLFEQLLQ--VESMAWRSQE 428
             D+N F+SKETGL +S+T RD+  +++S L   NY  F   ++ Q++      +    +E
Sbjct: 356  EDFNDFVSKETGLLASFTIRDQAAEFMSGLSNPNYSNFFNSIYAQVIYSLTGDVNDNLRE 415

Query: 429  SLLFLLQSCQLNSEGPQFD---EQTVAGLLEKSQRLLRSGDVHPLVRCRVAMTVPRLLEK 485
            SLL+LLQ+   N E    D   E +V  +L++   +  +G     +  R+ +  P+LLEK
Sbjct: 416  SLLYLLQTLLTNEEDNDHDINIEPSV--ILKQFSSVFENGLQKTFLLSRIILLTPKLLEK 473

Query: 486  YMDSLPNVKDLVREFVFLTFNTTVTSENQLLSASALIAFTYYSSFVDFGSVLGVQTAEEL 545
            +MD L +VK L   ++  T +  + + N+++ +S++IAFTYYS F +  SVLG +    +
Sbjct: 474  FMDQLQDVKQLTGNYLRRTLDLALETHNEIIKSSSIIAFTYYSYFAELPSVLGPELCSIV 533

Query: 546  EKLVLSTIKNILDGIDEDTPGFLLEVLSGVTGCN-KESRNRELKLYELQLVQNVATADPS 604
            ++  L  I  +    +EDT G L+E L+ +  CN  E+ + E+   E  LV ++++ DP+
Sbjct: 534  QENTLKIISELSKEAEEDTNGLLMETLNQIISCNVHENLSPEILQTEFNLVLSISSKDPA 593

Query: 605  NIQVVVEAQECLKNLLQ-YDPENYLQYAELCIPSFLEVLRADSSHGYAYTPXXXXXXXXX 663
            N+QV VEAQ+CL++LL+  + E YL Y ++C+PSF+  + A + + Y YTP         
Sbjct: 594  NVQVTVEAQDCLEHLLEGMNTETYLHYVDICLPSFIHTIDASAINQYRYTPVLSLILEFL 653

Query: 664  XXFMRKKPVDSALPRSMVDYIFDPLSSMLLNAEDDELLQLSTEAFXXXXXXXXXXXXXGR 723
              FM+KKPVD  LP S+ D+ F  L ++L  + +DE LQL+T+AF              +
Sbjct: 654  TIFMKKKPVDGFLPTSISDFSFKSLCNLLSLSTEDETLQLATDAFSYMVYNTEPSAMVPK 713

Query: 724  IPVIITILEKLLSARTSHSAAINAGTLLIAVLTKFANQIQDIMPKILEAAAKRLVQIKNL 783
            +  II +L++LLS   S +AA+N GTL++ + +KF+N+IQ ++P IL AA  RL+Q +N+
Sbjct: 714  LQDIINVLDRLLSINVSDTAAMNVGTLVVTLFSKFSNEIQPLIPTILRAAVGRLIQAQNI 773

Query: 784  HTAENLLFVFCYLTSIDARQTVDFLSSTIIDEGGRTALQAIVPRWLEAFEVLRGEHKIKE 843
             T +NL+ + C+LT  D +Q +D L +    +   +    ++ +W E+FE +RGE KIKE
Sbjct: 774  STQQNLVSLLCFLTCSDPKQVIDLLYNF---DSDHSTFTKVMNKWFESFETIRGEKKIKE 830

Query: 844  NILSLSKLFFLEDPRIAGITVNGDLIPHDGDIIITRSMAKKMPDKYTQISAAEKIVKLFV 903
            NI++LSKL+F  D R+  + VNGDLIP+DGD+IITRSMAKKMPDKYTQI A  KIVKLF 
Sbjct: 831  NIVALSKLYFTGDERLGKLIVNGDLIPYDGDLIITRSMAKKMPDKYTQIPAFTKIVKLFT 890

Query: 904  AELAFQQNQPDPGRYPKDGSGPADPHDS----EGXXXXXXXXXXXXXXXXXKLQEYAXXX 959
             EL FQ  QPD     +      D  ++    E                  KL+E+    
Sbjct: 891  TELGFQNKQPDSKILLESDIKNVDTSNNKTSEEAAGDDDEWEDVDDVLDYEKLREFVDDE 950

Query: 960  XXX----XXXXSLLFTSNIEEDATTLLTQFFKEAVARNASGFQEIYSRLTEQEKKSLSAC 1015
                        +     ++E    LL +FFK+  AR+ +GF  IY+ L+E EK+ L+  
Sbjct: 951  DPADFGENDSDEITGLDTLKETIPELLVEFFKDVAARDLNGFHNIYNTLSENEKRILTEN 1010

Query: 1016 MV 1017
            +V
Sbjct: 1011 LV 1012

>Smik_7.20 Chr7 (40260..43274) [3015 bp, 1004 aa] {ON} YGL241W (REAL)
          Length = 1004

 Score =  662 bits (1708), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/1011 (37%), Positives = 594/1011 (58%), Gaps = 19/1011 (1%)

Query: 19   MDLRQLVLAAQSAGKIERESAEQSLLEACRADPAAVCVGLVKMATQENTELASRQFCLYT 78
            M++ +LV  AQSA K+ RE+AE  LL+ C ++ + +   L  +A Q  + L SRQF L +
Sbjct: 1    MNIDELVTRAQSADKLTREAAETQLLQWCDSNASQMFTALANVALQHQSPLESRQFALLS 60

Query: 79   LRKLITMYWNAGFESYCGPPGVREDAKETVRDALLRMAVSRTQDSKIISASAYCVVQIAA 138
            LRKLITMYW+ GFESY     V  + K+ +R+ LL++ ++  +++KII+ ++YC+VQI+A
Sbjct: 61   LRKLITMYWSPGFESYRSTSVVEVNVKDFIREVLLKLCLNDNENTKIINGASYCIVQISA 120

Query: 139  FDFPDEWPGLLKSVYESITGERSLAALGLLHEIFDDVVSEEMFFQGGVGWQTIRIIFELL 198
             DFPD+WP LL  +Y++I+ + SL A+ LL+EI+DDVVSEEMFF+GG+G +T++IIF++L
Sbjct: 121  VDFPDQWPQLLTVIYDAISHQHSLNAMSLLNEIYDDVVSEEMFFEGGIGLETVQIIFKVL 180

Query: 199  GDD-GPVALKDAAMKLYHSCXXXXXXXXXXXXXDTRAAVGAHVHEALELFAQLLEHCRSL 257
              D   +  K AA+KL+ +C               ++ +   +  +L+   QLL      
Sbjct: 181  ATDTSTLVAKFAALKLFKACLLQMSSHNGYDEESRKSFISQCLSTSLQRLGQLLTMGFHS 240

Query: 258  EPHADLLQFQAHTYENLVLIKTQLPKRFFPGAXXXXXXXXXXXXXXXXGAYYEQHLAEGD 317
            E     L+ ++  YENLVLIK    K  F                           +   
Sbjct: 241  ENVVSQLKLKSIIYENLVLIKNDFSKNHFSIDLQKQFKIVTVQDLNNIAHLDTNGNSIEY 300

Query: 318  EELLKAVAESAIHMVIFLSSVHECKLNTERMCMLLGSLARLSCLSAIQTEAWDVDYNSFI 377
            E + +AV + +I++V FL+SV      +E + +++ SL  L  +++   E W  D+N+F+
Sbjct: 301  ESISEAVHDGSIYIVEFLTSVCTVPFGSEEVDIIIRSLTTLCQVNSEIMELWISDFNTFV 360

Query: 378  SKETGLTSSYTPRDEIFQYLSDLGGHNYREFLRVLFEQLLQ-VESMAWRSQ--ESLLFLL 434
            SKETGL +SY  RD+  ++L  L        L ++F  + + +E   + +Q  ESLL+LL
Sbjct: 361  SKETGLAASYNVRDQSSEFLISLSN----PLLSLIFSVISKDIERNTYDNQILESLLYLL 416

Query: 435  QSCQLNSE--GPQFDEQTVAGLLEKSQRLLRSGDVHPLVRCRVAMTVPRLLEKYMDSLPN 492
            QS  LN +    Q  ++++  L++  Q +L S +V  L   R  + +P++L+K++D LP+
Sbjct: 417  QSVLLNDDEITDQNLDESLQTLIKTFQNVLVSPEVKELTLARAILVIPKVLDKFIDVLPD 476

Query: 493  VKDLVREFVFLTFNTTVTSENQLLSASALIAFTYYSSFVDFGSVLGVQTAEELEKLVLST 552
            +K L  +F+  + +  +  +N+L+ ++ALIAFTYY  F +  SVLG     E++  V+  
Sbjct: 477  IKSLTSKFLTKSLDLALKHDNELIKSAALIAFTYYCYFAELDSVLGPDVCSEIQGKVIQI 536

Query: 553  IKNILDGIDEDTPGFLLEVLSGVTGCNKESRN--RELKLYELQLVQNVATADPSNIQVVV 610
            I +I    +EDT G ++EVLS V   N +  +   E+   E  LV  +++ DP+N+QVVV
Sbjct: 537  INDINSDSEEDTNGAIMEVLSQVISYNPKGLDSKEEILQAEFHLVFTISSKDPANVQVVV 596

Query: 611  EAQECLKNLL-QYDPENYLQYAELCIPSFLEVLRADSSHGYAYTPXXXXXXXXXXXFMRK 669
            ++QECL+ LL + + +NY  Y ELC+PSF+ VL ++S + Y Y+P           F++K
Sbjct: 597  QSQECLEKLLDEINMDNYKNYIELCLPSFINVLDSNSVNNYRYSPLLSLVLEFITVFLKK 656

Query: 670  KPVDSALPRSMVDYIFDPLSSMLLNAEDDELLQLSTEAFXXXXXXXXXXXXXGRIPVIIT 729
            KP+D  LP  +  Y+F+PL+ +L+ + ++E LQL+TE+F              R+  I+ 
Sbjct: 657  KPIDGFLPDEITQYLFEPLAKVLVYSSEEETLQLATESFSYLIFNTDTQVMEPRLMDIMK 716

Query: 730  ILEKLLSARTSHSAAINAGTLLIAVLTKFANQIQDIMPKILEAAAKRLVQIKNLHTAENL 789
            +LE+LLS   S SAA+N G L++ + TKF+  IQ ++ +ILEA   RLV+ +N+ T +NL
Sbjct: 717  VLERLLSLEVSDSAAMNVGPLVVTIFTKFSKDIQPLVGRILEAVIVRLVKAQNISTQQNL 776

Query: 790  LFVFCYLTSIDARQTVDFLSSTIIDEGGRTALQAIVPRWLEAFEVLRGEHKIKENILSLS 849
            L V C+LT  D+RQTV+FLS+  ID+  + AL  ++ +W+EAFEV+RGE +IKENI++LS
Sbjct: 777  LSVLCFLTCNDSRQTVEFLSNFRIDD--KNALSLVMQKWMEAFEVIRGEKRIKENIVALS 834

Query: 850  KLFFLEDPRIAGITVNGDLIPHDGDIIITRSMAKKMPDKYTQISAAEKIVKLFVAELAFQ 909
             LFFL+D R+  + VNGDLIP++ D+IITRSMAK+MPD+Y Q+    KI+KLFV+EL FQ
Sbjct: 835  NLFFLDDARLRKVMVNGDLIPYESDVIITRSMAKRMPDRYVQVPLYTKIIKLFVSELGFQ 894

Query: 910  QNQPDPGRYPKDGSGPADPHDSEGXXXXXXXXXXXXXXXXXKLQEYAXXXXXXXXXXSLL 969
              QPDP +     +   D  +                    KL+EY              
Sbjct: 895  NKQPDPKQLIT-SNMQHDAANLNNDEDNDDWEDVDDVLDYEKLKEYINDDVDGEDEDDSE 953

Query: 970  FTS---NIEEDATTLLTQFFKEAVARNASGFQEIYSRLTEQEKKSLSACMV 1017
              +   +++E    +L +FFKE   ++ SGF  IY  L++ ++K LS  ++
Sbjct: 954  DITGLMDVKESVVQILVRFFKEVATKDVSGFNRIYETLSDSDRKVLSEALL 1004

>Kpol_380.6 s380 complement(8594..11602) [3009 bp, 1002 aa] {ON}
            complement(8594..11602) [3009 nt, 1003 aa]
          Length = 1002

 Score =  659 bits (1700), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/1003 (36%), Positives = 574/1003 (57%), Gaps = 24/1003 (2%)

Query: 20   DLRQLVLAAQSAGKIERESAEQSLLEACRADPAAVCVGLVKMATQENTELASRQFCLYTL 79
            D+ QL+  AQS     RE AE  LL AC  D   V   ++++ +    EL+SR F L TL
Sbjct: 3    DIHQLINLAQSPDNSVREKAESELLAACDEDACIVFHSMIQVGSNGFEELSSRLFALLTL 62

Query: 80   RKLITMYWNAGFESYCGPPGVREDAKETVRDALLRMAVSRTQDSKIISASAYCVVQIAAF 139
            RKLITMYW+ GFESY     + E+ K   RD+LL++ +  +QD+KI +ASAYCVVQI+A 
Sbjct: 63   RKLITMYWSPGFESYRLNSTLNEEIKNNFRDSLLKICLDDSQDTKIKNASAYCVVQISAV 122

Query: 140  DFPDEWPGLLKSVYESITGERSLAALGLLHEIFDDVVSEEMFFQGGVGWQTIRIIFELLG 199
            DFPD+WP LL  VY +I    SL+A+ LL+EI+DDV+SEEMFF+ G+G +TIRIIF +L 
Sbjct: 123  DFPDQWPTLLNEVYGAIMERHSLSAISLLNEIYDDVMSEEMFFEEGIGSETIRIIFSVLT 182

Query: 200  DDGP-VALKDAAMKLYHSCXXXXXXXXXXXXXDTRAAVGAHVHEALELFAQLLEHCRSLE 258
            D+   +A K A+ KL+HSC               +  V   + + L +++ LL+     E
Sbjct: 183  DNNTGIAAKIASSKLFHSCLLQMSVLDPQSVHKRKQLVTECISQILTIWSGLLQKQNVTE 242

Query: 259  PHADLLQFQAHTYENLVLIKTQLPKRFFPGAXXXXXXXXXXXXXXXXGAYYEQHLA--EG 316
              ++  + ++  YE+L +IK++ P++ F                      Y   L+    
Sbjct: 243  MSSEF-ELRSKIYEDLAMIKSEFPRKLFSKENIEIFRRLVINDLNIAAKCYNNVLSSENS 301

Query: 317  DEELLKAVAESAIHMVIFLSSVHECKLNTERMCMLLGSLARLSCLSAIQTEAWDVDYNSF 376
            D E++  + E  IH++ FL+++ + K + E +  +  S   LSC+     E+W  D+NSF
Sbjct: 302  DTEMIH-INEFVIHIIEFLTAISDFKFSPEDIGTISKSFVTLSCIDRNTEESWTADFNSF 360

Query: 377  ISKETGLTSSYTPRDEIFQYLSDLGGHNYREFLRVLFEQLLQV--ESMAWRSQESLLFLL 434
            ISKETGL +S+T RD+I  ++S++    Y  F  ++  +  ++   +  WR+QES+L+LL
Sbjct: 361  ISKETGLFASFTIRDQIADFISNVNEGVYSGFYSLILNEFNEIINSNSDWRTQESVLYLL 420

Query: 435  QSCQLNSEGPQFDEQTVAG---LLEKSQRLLRSGDVHPLVRCRVAMTVPRLLEKYMDSLP 491
            Q C   SE  + +E        L+     ++ +      V  R  +T+P+LLEK+M++LP
Sbjct: 421  Q-CIATSET-EINESLQCNTQILVTAIGNIISNPPTQSFVLMRSILTIPKLLEKFMETLP 478

Query: 492  NVKDLVREFVFLTFNTTVTSENQLLSASALIAFTYYSSFVDFGSVLGVQTAEELEKLVLS 551
            +VK+  ++ + ++ +  ++S ++L+ +S LIAFTYY+SF +  SVLG       ++ VL 
Sbjct: 479  DVKEYTKQLLSISLDIALSSSDELVQSSGLIAFTYYTSFAELNSVLGDVACRVEQEKVLK 538

Query: 552  TIKNILDGIDEDTPGFLLEVLSGVTGCNKESRNRELKL-YELQLVQNVATADPSNIQVVV 610
             I+N+ +  +EDT G L+EVL+ V  CN      E  L  E   +  ++  DPSNIQ++V
Sbjct: 539  LIQNLSNDSEEDTNGVLVEVLNNVIDCNSPQHLDETILEVEFDFLLTISVKDPSNIQLIV 598

Query: 611  EAQECLKNLLQ-YDPENYLQYAELCIPSFLEVLRADSSHGYAYTPXXXXXXXXXXXFMRK 669
            EAQECL+ L++  D   Y +YA   +P  + V+   +  GY+Y+P            MR 
Sbjct: 599  EAQECLEKLIESMDINLYNKYAHKLLPFLINVINECNQTGYSYSPLLSLALEFINILMRN 658

Query: 670  KPVDSALPRSMVDYIFDPLSSMLLNAEDDELLQLSTEAFXXXXXXXXXXXXXGRIPVIIT 729
            +P D +LP  + + +F PL  +L+ +++DE LQL+TEAF               +  II 
Sbjct: 659  RPDDISLPTYICEQLFSPLRHILMVSQEDETLQLATEAFSFLLFNSQTDVIFPYLEEIIN 718

Query: 730  ILEKLLSARTSHSAAINAGTLLIAVLTKFANQIQDIMPKILEAAAKRLVQIKNLHTAENL 789
            +L +LLS   S +AA+N G+L++ + TKF+ Q+Q+++P IL A   + +  KN+ T++NL
Sbjct: 719  VLSRLLSMDISDTAAMNVGSLVVTIFTKFSEQVQELIPGILRATTDKFINAKNISTSQNL 778

Query: 790  LFVFCYLTSIDARQTVDFLSSTIIDEGGRTALQAIVPRWLEAFEVLRGEHKIKENILSLS 849
            + VFC L   D  +T+DFL +  I    +++L  ++ +WLE+FE++RGE KIKENIL+LS
Sbjct: 779  VSVFCLLVCTDPARTIDFLYNLEIGTPPQSSLPLVLTKWLESFEIIRGEKKIKENILALS 838

Query: 850  KLFFLEDPRIAGITVNGDLIPHDGDIIITRSMAKKMPDKYTQISAAEKIVKLFVAELAFQ 909
            K++FL+D R++ I VNGD+IP+ GD+IITRSMAK MPDKYT++S  +KIVKLFVAEL FQ
Sbjct: 839  KIYFLKDSRVSSIEVNGDIIPYTGDLIITRSMAKSMPDKYTRVSVYQKIVKLFVAELGFQ 898

Query: 910  QNQPDP-----GRYPKDGSGPADPHDSEGXXXXXXXXXXXXXXXXXKLQEYAXXXXXXXX 964
              + DP      +  ++   P     + G                 KLQEY         
Sbjct: 899  TKEQDPSDLVDSKLKQELGIPQQMGAAHGDDDDDDWEDVDDVLDYEKLQEYIDDDDEEEY 958

Query: 965  -----XXSLLFTSNIEEDATTLLTQFFKEAVARNASGFQEIYS 1002
                    +     + +    LL +FFKEA +++ + FQEIY+
Sbjct: 959  VGGPESQEITGIEEVTQTTKELLIEFFKEAASKDINSFQEIYN 1001

>YGL241W Chr7 (45445..48459) [3015 bp, 1004 aa] {ON}
            KAP114Karyopherin, responsible for nuclear import of
            specific proteins; cargoes include Spt15p, Sua7p,
            histones H2A and H2B, and Nap1p; amino terminus shows
            similarity to those of other importins, particularly
            Cse1p; localization is primarily nuclear; function is
            regulated by sumoylation
          Length = 1004

 Score =  654 bits (1688), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/1009 (37%), Positives = 580/1009 (57%), Gaps = 15/1009 (1%)

Query: 19   MDLRQLVLAAQSAGKIERESAEQSLLEACRADPAAVCVGLVKMATQENTELASRQFCLYT 78
            MD+ +L++ AQSA K  RE AE  LL+ C +D + V   L  +A Q    L SRQF L +
Sbjct: 1    MDINELIIGAQSADKHTREVAETQLLQWCDSDASQVFKALANVALQHEASLESRQFALLS 60

Query: 79   LRKLITMYWNAGFESYCGPPGVREDAKETVRDALLRMAVSRTQDSKIISASAYCVVQIAA 138
            LRKLITMYW+ GFESY     V  D K+ +R+ LL++ ++  +++KI + ++YC+VQI+A
Sbjct: 61   LRKLITMYWSPGFESYRSTSNVEIDVKDFIREVLLKLCLNDNENTKIKNGASYCIVQISA 120

Query: 139  FDFPDEWPGLLKSVYESITGERSLAALGLLHEIFDDVVSEEMFFQGGVGWQTIRIIFELL 198
             DFPD+WP LL  +Y++I+ + SL A+ LL+EI+DDVVSEEMFF+GG+G  T+ I+F++L
Sbjct: 121  VDFPDQWPQLLTVIYDAISHQHSLNAMSLLNEIYDDVVSEEMFFEGGIGLATMEIVFKVL 180

Query: 199  GDDGPVALKDAAMKLYHSCXXXXXXXXXXXXXDTRAA-VGAHVHEALELFAQLLEHCRSL 257
              +    +   A                     +R + V   +  +L++  QLL      
Sbjct: 181  NTETSTLIAKIAALKLLKACLLQMSSHNEYDEASRKSFVSQCLATSLQILGQLLTLNFGN 240

Query: 258  EPHADLLQFQAHTYENLVLIKTQLPKRFFPGAXXXXXXXXXXXXXXXXGAYYEQHLAEGD 317
                  L+F++  YENLV IK    ++ F                               
Sbjct: 241  VDVISQLKFKSIIYENLVFIKNDFSRKHFSSELQKQFKIMAIQDLENVTHINANVETTES 300

Query: 318  EELLKAVAESAIHMVIFLSSVHECKLNTERMCMLLGSLARLSCLSAIQTEAWDVDYNSFI 377
            E LL+ V + +I++V FL+SV   + + E M  ++ SL  L  LS+   E W  D+N+F+
Sbjct: 301  EPLLETVHDCSIYIVEFLTSVCTLQFSVEEMNKIITSLTILCQLSSETREIWTSDFNTFV 360

Query: 378  SKETGLTSSYTPRDEIFQYLSDLGGHNYREFLRVLFEQLLQVESMAWRSQESLLFLLQSC 437
            SKETGL +SY  RD+  ++ + L         +V+    ++  +  + + ESLL+LLQ  
Sbjct: 361  SKETGLAASYNVRDQANEFFTSLPNPQLSLIFKVVSND-IEHSTCNYSTLESLLYLLQCI 419

Query: 438  QLNSE---GPQFDEQTVAGLLEKSQRLLRSGDVHPLVRCRVAMTVPRLLEKYMDSLPNVK 494
             LN +   G   D Q++  L++  + +L S ++  L+  R  +T+PR+L+K++D+LP++K
Sbjct: 420  LLNDDEITGENID-QSLQILIKTLENILVSQEIPELILARAILTIPRVLDKFIDALPDIK 478

Query: 495  DLVREFVFLTFNTTVTSENQLLSASALIAFTYYSSFVDFGSVLGVQTAEELEKLVLSTIK 554
             L   F+  + N  + S+ +L+ ++ LIAFTYY  F +  SVLG +   E ++ V+  I 
Sbjct: 479  PLTSAFLAKSLNLALKSDKELIKSATLIAFTYYCYFAELDSVLGPEVCSETQEKVIRIIN 538

Query: 555  NILDGIDEDTPGFLLEVLSGVTGCN-KESRNR-ELKLYELQLVQNVATADPSNIQVVVEA 612
             +    +EDT G L+EVLS V   N KE  +R E+   E  LV  +++ DP+N+QVVV++
Sbjct: 539  QVSSDAEEDTNGALMEVLSQVISYNPKEPHSRKEILQAEFHLVFTISSEDPANVQVVVQS 598

Query: 613  QECLKNLL-QYDPENYLQYAELCIPSFLEVLRADSSHGYAYTPXXXXXXXXXXXFMRKKP 671
            QECL+ LL   + +NY  Y ELC+PSF+ VL +++++ Y Y+P           F++KKP
Sbjct: 599  QECLEKLLDNINMDNYKNYIELCLPSFINVLDSNNANNYRYSPLLSLVLEFITVFLKKKP 658

Query: 672  VDSALPRSMVDYIFDPLSSMLLNAEDDELLQLSTEAFXXXXXXXXXXXXXGRIPVIITIL 731
             D  LP  +  Y+F+PL+ +L  + +DE LQL+TEAF              R+  I+ +L
Sbjct: 659  NDGFLPDEINQYLFEPLAKVLAFSTEDETLQLATEAFSYLIFNTDTRAMEPRLMDIMKVL 718

Query: 732  EKLLSARTSHSAAINAGTLLIAVLTKFANQIQDIMPKILEAAAKRLVQIKNLHTAENLLF 791
            E+LLS   S SAA+N G L++A+ T+F+ +IQ ++ +ILEA   RL++ +N+ T +NLL 
Sbjct: 719  ERLLSLEVSDSAAMNVGPLVVAIFTRFSKEIQPLIGRILEAVVVRLIKTQNISTEQNLLS 778

Query: 792  VFCYLTSIDARQTVDFLSSTIIDEGGRTALQAIVPRWLEAFEVLRGEHKIKENILSLSKL 851
            V C+LT  D +QTVDFLSS  ID     AL  ++ +W+EAFEV+RGE +IKENI++LS L
Sbjct: 779  VLCFLTCNDPKQTVDFLSSFQIDNTD--ALTLVMRKWIEAFEVIRGEKRIKENIVALSNL 836

Query: 852  FFLEDPRIAGITVNGDLIPHDGDIIITRSMAKKMPDKYTQISAAEKIVKLFVAELAFQQN 911
            FFL D R+  + VNG+LIP++GD+IITRSMAKKMPD+Y Q+    KI+KLFV+EL+FQ  
Sbjct: 837  FFLNDKRLQKVVVNGNLIPYEGDLIITRSMAKKMPDRYVQVPLYTKIIKLFVSELSFQSK 896

Query: 912  QPDPGRYPKDGSGPADPHDSEGXXXXXXXXXXXXXXXXXKLQEYAXXXXXXXXXXSLLFT 971
            QP+P +         +  ++                   KL+EY                
Sbjct: 897  QPNPEQLIT-SDIKQEVVNANKDDDNDDWEDVDDVLDYDKLKEYIDDDVDEEADDDSDDI 955

Query: 972  S---NIEEDATTLLTQFFKEAVARNASGFQEIYSRLTEQEKKSLSACMV 1017
            +   +++E    LL +FFKE  +++ SGF  IY  L++ E+K LS  ++
Sbjct: 956  TGLMDVKESVVQLLVRFFKEVASKDVSGFHCIYETLSDSERKVLSEALL 1004

>CAGL0H07777g Chr8 (757134..760199) [3066 bp, 1021 aa] {ON} similar to
            uniprot|P53067 Saccharomyces cerevisiae YGL241w KAP114
          Length = 1021

 Score =  652 bits (1683), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/1011 (36%), Positives = 571/1011 (56%), Gaps = 23/1011 (2%)

Query: 24   LVLAAQSAGKIERESAEQSLLEACRADPAAVCVGLVKMATQENTELASRQFCLYTLRKLI 83
            L+  AQS     RE AE  LL AC  +   V   L+++     T LASR F L +LRK I
Sbjct: 9    LIEQAQSPDNAVREGAETQLLNACDTNADEVFQSLIELGENNQTPLASRLFSLLSLRKFI 68

Query: 84   TMYWNAGFESYCGPPGVREDAKETVRDALLRMAVSRTQDSKIISASAYCVVQIAAFDFPD 143
            TMYW+ GFESY G   V+   KE +RD LL++++   Q +K+ ++S+YCVVQI+A DFPD
Sbjct: 69   TMYWSPGFESYRGTSNVQLGTKERIRDVLLKLSLDDQQSNKVRNSSSYCVVQISAVDFPD 128

Query: 144  EWPGLLKSVYESITGERSLAALGLLHEIFDDVVSEEMFFQGGVGWQTIRIIFELLGD-DG 202
            EWP LL ++Y +IT   SL A+ LL+EI+DDV+SEEMFF+GG+G++T++IIF LL +   
Sbjct: 129  EWPQLLSTLYNAITQNHSLNAMSLLNEIYDDVISEEMFFEGGIGYETLQIIFTLLTNAQV 188

Query: 203  PVALKDAAMKLYHSCXXXXXXXXXXXXXDTRAAVGAHVHEALELFAQLLEHCRSLEPH-- 260
             +A K +A+KL+ +C               +  V   + +AL+    LLE C  ++    
Sbjct: 189  RLASKTSALKLFGACISQMSVLDNNSSQKRKLLVSECLGQALQTIKLLLEQCEIIQSDLT 248

Query: 261  --ADLLQFQAHTYENLVLIKTQLPKRFFPGAXXXXXXXXXXXXXXXXGAYYEQHLAEG-D 317
               + L+F+ + Y+++  IK   P++FFP                     Y++   +  D
Sbjct: 249  SINETLEFKDNLYDDINSIKENFPRKFFPEDVNLYVTNIAVRDLDQLAGLYQESFKDNFD 308

Query: 318  EELLKAVAESAIHMVIFLSSVHECKLNTERMCMLLGSLARLSCLSAIQTEAWDVDYNSFI 377
            E+ +       IH++ FL++     LN E +  +L +   L   SA+  ++W+ D+N F 
Sbjct: 309  EQSMSIFENCVIHLLDFLANPIS-PLNNELISNILTASITLCEQSALTKDSWESDFNEFA 367

Query: 378  SKETGLTSSYTPRDEIFQYLSDLGGHNYREFLRVLFEQLLQVES-MAWRSQESLLFLLQS 436
            SKETGL++S+T RDE+ + ++            ++   L    S ++    ES L+LLQ 
Sbjct: 368  SKETGLSASFTIRDEVAELVNAFEIPQLETSFELIVGYLSNNSSHLSADKIESALYLLQ- 426

Query: 437  CQLNSEGPQFDEQTVAGLLEKSQRLL-RSGDVHPLVRCRVAMTVPRLLEKYMDSLPNVKD 495
            C +N E    +   V  L+E  + +L +  ++  + + R+ + +P+ L K+MD LPNVK 
Sbjct: 427  CLMNVEDDFSNTSLVPSLIEFIKSMLSQQNNLDQMSQIRLLLLIPKTLAKFMDILPNVKQ 486

Query: 496  LVREFVFLTFNTTVTSENQLLSASALIAFTYYSSFVDFGSVLGVQTAEELEKLVLSTIKN 555
            L  E +    +    S + L+  SALI+FTY++S+ +  SVLG      ++   L  I+ 
Sbjct: 487  LTAETLNEILSMATNSNSHLIIISALISFTYFASYAEILSVLGNDQTLLVQNKTLHLIQE 546

Query: 556  ILDGIDEDTPGFLLEVLSGVTGCN-KESRNRELKLYELQLVQNVATADPSNIQVVVEAQE 614
            I +   EDT G L+EVL+ V  CN K   N EL  +E +L+  ++  DP+NIQV +E+QE
Sbjct: 547  ISEESTEDTNGLLMEVLNCVIDCNDKNVANMELFKFEFKLILVISGKDPANIQVSIESQE 606

Query: 615  CL-KNLLQYDPENYLQYAELCIPSFLEVLRADSSHGYAYTPXXXXXXXXXXXFMRKKPVD 673
            CL K LL  +  +YL + ++CIPSF+ ++++     Y+Y+P           FM+ KP +
Sbjct: 607  CLEKLLLNVNTNDYLSFVDICIPSFINIIKSSEVTNYSYSPLLSLVLEFITVFMKNKPQE 666

Query: 674  SALPRSMVDYIFDPLSSMLLNAEDDELLQLSTEAFXXXXXXXXXXXXXGRIPVIITILEK 733
            + LP S+ +Y+FDPL S LL + ++ELLQ++TEAF              ++  I+ IL++
Sbjct: 667  ALLPSSVSEYVFDPLVSCLLKSTEEELLQIATEAFSYMIHNSSKDVITPKLETIVNILDR 726

Query: 734  LLSARTSHSAAINAGTLLIAVLTKFANQIQDIMPKILEAAAKRLVQIKNLHTAENLLFVF 793
            LLS+  S SAA+N GTL++A++T+++  +  ++P I+ AA ++LV   N+ T +NL+ + 
Sbjct: 727  LLSSNISDSAAMNVGTLILALITEYSEPMNPLLPSIISAAVRKLVVSNNITTQQNLVTLL 786

Query: 794  CYLTSIDARQTVDFLSSTII--DEGGRTALQAIVPRWLEAFEVLRGEHKIKENILSLSKL 851
            C+L   D +QTVDFL    I  D+G + AL  I+ +WL+ F V+RGE++IKENI++LS+L
Sbjct: 787  CFLVCHDPKQTVDFLCELTIKNDKGEQVALPVIIQKWLDTFAVVRGENRIKENIVALSQL 846

Query: 852  FFLEDPRIAGITVNGDLIPHDGDIIITRSMAKKMPDKYTQISAAEKIVKLFVAELAFQQN 911
            F L D R+  + VNG++IP+DGD+IITRSMAK MPD+YT +SA EKIVK+F+ EL FQ  
Sbjct: 847  FLLGDDRVNEVKVNGEIIPYDGDLIITRSMAKSMPDRYTTVSAPEKIVKMFLGELGFQGR 906

Query: 912  QPDPGRY----PKDGSGPADPHDSEGXXXXXXXXXXXXXXXXXKLQEYAXXXXXXXXXX- 966
              +P          G G      S                   KLQEY            
Sbjct: 907  NKNPEELLTTDDMKGMGLKPNQQSNNDEGDDDWEDVDDVVDYEKLQEYIDDEDDLDDNSV 966

Query: 967  ----SLLFTSNIEEDATTLLTQFFKEAVARNASGFQEIYSRLTEQEKKSLS 1013
                ++    +I +    LL  FF  A  +N +GFQEIY+ L+E+E+K +S
Sbjct: 967  GELETITGQQHIPQSIPELLKDFFNTAAQKNVAGFQEIYNNLSEEERKCIS 1017

>Skud_7.26 Chr7 (49585..52632) [3048 bp, 1015 aa] {ON} YGL241W (REAL)
          Length = 1015

 Score =  652 bits (1681), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/1015 (37%), Positives = 584/1015 (57%), Gaps = 26/1015 (2%)

Query: 19   MDLRQLVLAAQSAGKIERESAEQSLLEACRADPAAVCVGLVKMATQENTELASRQFCLYT 78
            MD+ QL++ AQSA    RE AE  LL+ C +D + +   LV  A Q+ + L SRQF L +
Sbjct: 11   MDINQLIIQAQSADNHTREVAEAQLLQWCDSDASQMFTALVNAALQQQSALQSRQFALLS 70

Query: 79   LRKLITMYWNAGFESYCGPPGVREDAKETVRDALLRMAVSRTQDSKIISASAYCVVQIAA 138
            LRKLITMYW+ GFESY     V    KE +R+ALL++ ++  ++++I + ++YC+VQI+A
Sbjct: 71   LRKLITMYWSPGFESYRSTSNVDVKVKEFIREALLKLCLNDNENTRIKNGASYCIVQISA 130

Query: 139  FDFPDEWPGLLKSVYESITGERSLAALGLLHEIFDDVVSEEMFFQGGVGWQTIRIIFELL 198
             DFPD+WP LL  +Y+ I+ + SL A+ LL+EI+DDVVSEEMFF+GG+G +T  IIF++L
Sbjct: 131  VDFPDQWPQLLSVIYDGISRQHSLNAMFLLNEIYDDVVSEEMFFEGGIGLETAEIIFKVL 190

Query: 199  -GDDGPVALKDAAMKLYHSCXXXXXXXXXXXXXDTRAAVGAHVHEALELFAQLLEHCRSL 257
              +   +  K AA+KL  +C               +  V   +  +L+   QLL      
Sbjct: 191  VAETSSLVAKIAALKLLKACLLQMSSHNGHYEESRKDFVSQCISTSLQRLGQLLTLNFDN 250

Query: 258  EPHADLLQFQAHTYENLVLIKTQLPKRFFPGAXXXXXXXXXXXXXXXXGAYYEQHLAEGD 317
            E     L+ ++  YENLV IK    K+ F  A                         +GD
Sbjct: 251  EDVISQLKLKSIIYENLVFIKNDFSKKHF--AEKLQDHFKLVAIRDLKNISLIDTNDDGD 308

Query: 318  ----EELLKAVAESAIHMVIFLSSVHECKLNTERMCMLLGSLARLSCLSAIQTEAWDVDY 373
                E  +K V + ++++V FL+SV       E + +++G+L  L  + +  +E W  D+
Sbjct: 309  YPESENFVKTVHDCSVYIVEFLTSVCTISFTIEEISVIIGALTTLCKVGSDASELWISDF 368

Query: 374  NSFISKETGLTSSYTPRDEIFQYLSDLGGHNYREFLRVLFEQLLQVESMAWRSQESLLFL 433
            N F+SKETGL +SY  RD+  ++ + L          V+ + +  + +   ++ ESLL+L
Sbjct: 369  NEFVSKETGLAASYNIRDQACEFFTSLSNPQLSLIFGVVSKNI-DLNTSNHQTFESLLYL 427

Query: 434  LQSCQLNSE--GPQFDEQTVAGLLEKSQRLLRSGDVHPLVRCRVAMTVPRLLEKYMDSLP 491
            LQ   LN +    Q   Q++  LL   Q  L S ++H L   RV + +P+LL+K++D LP
Sbjct: 428  LQCILLNDDEISSQNINQSLQNLLGILQNALTSSEIHELTLARVILVIPKLLDKFIDVLP 487

Query: 492  NVKDLVREFVFLTFNTTVTSENQLLSASALIAFTYYSSFVDFGSVLGVQTAEELEKLVLS 551
            ++K +   F+  + +  +  + +L+ ++ALIAF YY  F +  SVLG Q   EL++ V+ 
Sbjct: 488  DIKSVTSRFLAKSLDLALKCDQELIKSAALIAFPYYCYFAELDSVLGPQLCTELQEKVIQ 547

Query: 552  TIKNILDGIDEDTPGFLLEVLSGVTGCNKES--RNRELKLYELQLVQNVATADPSNIQVV 609
             I  I +  +EDT G ++EVL+ V   N +     +E+   E+ LV  +++ DP+N+QVV
Sbjct: 548  IINEISNDAEEDTNGTIMEVLNQVISYNSKGPYSKKEVLQAEVHLVFTISSKDPANVQVV 607

Query: 610  VEAQECLKNLLQ-YDPENYLQYAELCIPSFLEVLRADSSHGYAYTPXXXXXXXXXXXFMR 668
            V++QECL+ LL   + +NY  Y ELC+PSF+ VL A+  + Y Y+P           F++
Sbjct: 608  VQSQECLEKLLDDINMDNYKNYIELCLPSFINVLNANDENNYKYSPLLSLVLEFIAVFLK 667

Query: 669  KKPVDSALPRSMVDYIFDPLSSMLLNAEDDELLQLSTEAFXXXXXXXXXXXXXGRIPVII 728
            K+P D  LP  +  Y+F+PL+ +L+ + +DE LQL+TEAF              R+  I+
Sbjct: 668  KRPNDGYLPDEINQYLFEPLAKVLVYSTEDETLQLATEAFSYLIFNTDTQTMQTRLMDIM 727

Query: 729  TILEKLLSARTSHSAAINAGTLLIAVLTKFANQIQDIMPKILEAAAKRLVQIKNLHTAEN 788
             ILE+LLS   S SAA+N G+L++A+ T+F+ ++Q ++ +IL+A   RLV+ +N+ T +N
Sbjct: 728  KILERLLSLEVSDSAAMNVGSLVVAIFTRFSKEVQPLVGRILQAVVVRLVKAQNISTQQN 787

Query: 789  LLFVFCYLTSIDARQTVDFLSSTIIDEGGRTALQAIVPRWLEAFEVLRGEHKIKENILSL 848
            LL V C+LT  D +QTVDFLSS  ID+  + AL  ++ +W+EAFEV+RGE KIKE+I++L
Sbjct: 788  LLSVLCFLTCNDTKQTVDFLSSFRIDD--KEALSLVMSKWMEAFEVIRGERKIKESIVAL 845

Query: 849  SKLFFLEDPRIAGITVNGDLIPHDGDIIITRSMAKKMPDKYTQISAAEKIVKLFVAELAF 908
            SK FFL DPR+  + VNGD+IP++GD+IITRSMAKKMPDKY Q+    KI+KLF++EL F
Sbjct: 846  SKFFFLNDPRLHKLMVNGDMIPYEGDLIITRSMAKKMPDKYVQVPLYTKIIKLFISELGF 905

Query: 909  QQNQPDPGRYPKDG---SGPADPHDSEGXXXXXXXXXXXXXXXXXKLQEY---AXXXXXX 962
            Q  Q DP +        S  A+  D  G                 KL+EY          
Sbjct: 906  QAKQLDPEQLVASSIQESANANNDDETG-----DWEDVDDVLDYEKLKEYIDDDVDGEEE 960

Query: 963  XXXXSLLFTSNIEEDATTLLTQFFKEAVARNASGFQEIYSRLTEQEKKSLSACMV 1017
                 +   ++++E    +L  FF+E   +N S F  IY  L++ E+K+LS  ++
Sbjct: 961  DDRDDITGLTDVKESVVQILVSFFREVATKNVSDFHLIYETLSDSERKTLSEALL 1015

>TPHA0G03630 Chr7 complement(770678..773746) [3069 bp, 1022 aa] {ON}
            Anc_3.564 YGL241W
          Length = 1022

 Score =  647 bits (1668), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/1033 (36%), Positives = 581/1033 (56%), Gaps = 48/1033 (4%)

Query: 20   DLRQLVLAAQSAGKIERESAEQSLLEACRADPAAVCVGLVKMATQENTELASRQFCLYTL 79
            D+  L+  AQSA    RE+AE  LL+ C  + + V   L+++A   N  L+SRQFC+ +L
Sbjct: 3    DVHLLIAHAQSADNNVRENAESELLQKCDENASVVFNSLIELANNINEPLSSRQFCILSL 62

Query: 80   RKLITMYWNAGFESYCGPPGVREDAKETVRDALLRMAVSRTQDSKIISASAYCVVQIAAF 139
            +KLITMYW+ GF+SY G   V+E+ KE +RD+LL++ ++  QDSKI S+S+YC+VQI+A 
Sbjct: 63   KKLITMYWSPGFDSYRGTSNVQEETKEFLRDSLLKLCLNTEQDSKIKSSSSYCIVQISAI 122

Query: 140  DFPDEWPGLLKSVYESITGERSLAALGLLHEIFDDVVSEEMFFQGGVGWQTIRIIFELLG 199
            DFPD WP LL  +Y +I  + S+ A+ LL+EI+DDV+SEEMFF+GGVG +TI+ IF +  
Sbjct: 123  DFPDLWPNLLVVIYNAILKDHSIEAMSLLNEIYDDVISEEMFFEGGVGEETIKTIFAIFT 182

Query: 200  D-DGPVALKDAAMKLYHSCXXXXXXXXXXXXXDTRAAVGAHVHEALELFAQLLEHCRSLE 258
              +  +  K AA KL HS                +  V   + + L++   +L H   + 
Sbjct: 183  SPETNIKAKVAASKLLHSTVLQMSILDNSMSFKRKDFVSQCITKLLDILLTILPHL-DVN 241

Query: 259  PHADLLQFQAHTYENLVLIKTQLPKRFFPGAXXXXXXXXXXXXXXXXGAYYEQHL---AE 315
               D LQ + + YE L  IKT+ PK+ F  +                G+ Y Q +   A 
Sbjct: 242  QSEDALQLKTNFYEELTTIKTEFPKKLFHNSLVTNFKAISLKDLEIIGSSYLQFIDSDAS 301

Query: 316  GDEELLKAVAESAIHMVIFLSSVHECKLNTERMCMLLGSLARLSCLSAIQTEAWDVDYNS 375
            G +  L+ + E  +H++ F+SS+     +   +  ++ SL  L CL     E+W+ D+N+
Sbjct: 302  GSQ--LQLINEYGVHLIDFISSLSVQGFDKVDLTRIVSSLVMLCCLDNNTYESWESDFNT 359

Query: 376  FISKETGLTSSYTPRDEIFQYLSDLGGHNYREFLRVLFEQLLQVESM----AWRSQESLL 431
            FISKE GL ++YT RD+  Q+ SDL    Y     ++ E+L   +SM     W+ QESLL
Sbjct: 360  FISKEAGLLANYTIRDQTMQFFSDLEKPTYSIAYGIILEEL--NKSMENYNNWKLQESLL 417

Query: 432  FLLQSC-----QLNSEGPQFDEQTVAGLLEKSQRLLRSGDVHPLVRCRVAMTVPRLLEKY 486
            + LQS      + NSE   + E  +  L     +LL     + +V+ R  +  P+ LEK+
Sbjct: 418  YTLQSIISSEEEFNSELLGYTENVLNSL----GKLLMDPSSNIMVKSRCLLLCPKYLEKF 473

Query: 487  MDSLPNVKDLVREFVFLTFNTTVTSENQLLSASALIAFTYYSSFVDFGSVLGVQTAEELE 546
            M+S   VK + +E +  + N ++ + +++L +S LIAF+YY+S+ D  SVLG      ++
Sbjct: 474  MESYTAVKPMTKELLSTSLNLSLNTSSEILKSSMLIAFSYYASYADLSSVLGSADCISIQ 533

Query: 547  KLVLSTIKNILDGIDEDTPGFLLEVLSGVTGCNKE-SRNRELKLYELQLVQNVATADPSN 605
            + +L  IK+I +  +EDT    +E +S V   N   + + E++  E  ++  ++  DP N
Sbjct: 534  QGLLKIIKDIANDAEEDTYAICVETISNVIDNNSSGTGSDEVRDNEFNILLEISFKDPGN 593

Query: 606  IQVVVEAQECLKNLLQ-YDPENYLQYAELCIPSFLEVLRADSSHGYAYTPXXXXXXXXXX 664
            IQ+ VE+QECL+ LL   D   Y+ YAE  IP  ++++   +S  Y Y+P          
Sbjct: 594  IQLSVESQECLEKLLDGMDISLYIYYAEKVIPLLIKIIADHASTNYDYSPLLSLTLDFLM 653

Query: 665  XFMRKKPVDSALPRSMVDYIFDPLSSMLLNAEDDELLQLSTEAFXXXXXXXXXXXXXGRI 724
             FM+KKPVDS LP  +   +F+P+  +LL++ ++E +QL+TEAF               +
Sbjct: 654  TFMKKKPVDSTLPVEISKLVFNPVCEVLLSSNEEETIQLATEAFSFLVFNSDVSLMQTVL 713

Query: 725  PVIITILEKLLSARTSHSAAINAGTLLIAVLTKFANQIQDIMPKILEAAAKRLVQIKNLH 784
              I+ +L KLLS   S +AA+N GTL+I + +KF+ QIQ+++P IL+A  ++ V  KN+ 
Sbjct: 714  ENIVNVLSKLLSLNISDTAAMNVGTLIITIFSKFSQQIQELLPAILQATTQKFVNAKNII 773

Query: 785  TAENLLFVFCYLTSIDARQTVDFLSS-TIIDEGGRTALQAIVPRWLEAFEVLRGEHKIKE 843
            T++NLL VFC+L   D +QTVDFL + ++ D+     L  ++ +WLE F+++RGE +IKE
Sbjct: 774  TSQNLLMVFCFLICSDPQQTVDFLYNLSLEDQQEENTLTLVLKKWLELFDIIRGEKRIKE 833

Query: 844  NILSLSKLFFLEDPRIAGITVNGDLIPHDGDIIITRSMAKKMPDKYTQISAAEKIVKLFV 903
            NI++LSK++ L D RI  + VNGD+IP+ GD IITRSMAK +PD++TQ+   EKIVKLF+
Sbjct: 834  NIIALSKIYLLLDKRIELVIVNGDIIPYSGDKIITRSMAKSIPDQFTQMPIYEKIVKLFL 893

Query: 904  AELAFQ-QNQPDPGRYPKDGSGPADPHDSE-----GXXXXXXXXXXXXXXXXXKLQEYAX 957
             ELA Q +N  D   +  D    A   +++                       KLQEY  
Sbjct: 894  GELASQSKNISDANLHSIDIQKLARAEENQVEQKLDSSEDDDWEDVEDVLDYEKLQEYVD 953

Query: 958  XXXXXXXXXSLLFTSNIEEDATT-------------LLTQFFKEAVARNASGFQEIYSRL 1004
                        +TS+ + D  T             L+  FFKE  ++N + FQ+IYS L
Sbjct: 954  DDDDELAN----YTSDEDNDTPTGQIIGDINQSVSELIINFFKEVTSKNINSFQDIYSSL 1009

Query: 1005 TEQEKKSLSACMV 1017
            +E EKK L+  +V
Sbjct: 1010 SEDEKKLLANALV 1022

>ZYRO0E09460g Chr5 complement(753030..756059) [3030 bp, 1009 aa] {ON}
            similar to uniprot|P53067 Saccharomyces cerevisiae
            YGL241W
          Length = 1009

 Score =  646 bits (1666), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/1005 (36%), Positives = 557/1005 (55%), Gaps = 13/1005 (1%)

Query: 20   DLRQLVLAAQSAGKIERESAEQSLLEACRADPAAVCVGLVKMATQENTELASRQFCLYTL 79
            D   L+L AQS     R+S+E+ LL+ C  D + V V  V++A     EL SRQF L TL
Sbjct: 3    DAPSLILEAQSPLDNVRKSSEERLLQMCDEDSSQVFVQFVQVAADTQQELPSRQFALLTL 62

Query: 80   RKLITMYWNAGFESYCGPPGVREDAKETVRDALLRMAVSRTQDSKIISASAYCVVQIAAF 139
            RKL+TMYW  GFES+ G   V+ +A+  +RD LL++ +   Q SKI + ++Y VVQI+A 
Sbjct: 63   RKLVTMYWTPGFESFRGTSTVKLEARGMIRDVLLQLCLDEHQPSKIRNGASYAVVQISAV 122

Query: 140  DFPDEWPGLLKSVYESITGERSLAALGLLHEIFDDVVSEEMFFQGGVGWQTIRIIFELLG 199
            DFPD+WP LL  VY +I    SLAA+ LL+EI+DDV+SEEMFF+ G+G++T++I+F ++ 
Sbjct: 123  DFPDQWPELLNIVYNAIMKSHSLAAMKLLNEIYDDVISEEMFFEEGIGFETLKIVFHVMN 182

Query: 200  D-DGPVALKDAAMKLYHSCXXXXXXXXXXXXXDTRAAVGAHVHEALELFAQLLEHCRSLE 258
              D     K AA+ L H C               +        E L+++   L       
Sbjct: 183  SYDANWEAKVAALNLLHCCILQMSTVNGSSTTKRKELTVEACKEILQMWVNFLTTQNKTI 242

Query: 259  PHADLLQFQAHTYENLVLIKTQLPKRFFPGAXXXXXXXXXXXXXXXXGAYYEQHLAEGDE 318
                 L   A  Y+ L L+K +  K+                        Y Q +    +
Sbjct: 243  SETLQLMAGAKIYQGLTLLKNEFSKKIVAPDMYHQFRTIVMRDLENASQIYMQMVENSSQ 302

Query: 319  ELLKAVAESAIHMVIFLSSVHECKLNTERMCMLLGSLARLSCLSAIQTEAWDVDYNSFIS 378
            + L A+ E A++++ FLSS+ + +   E +  +L  L+RL CL+    ++W  D+NSF+S
Sbjct: 303  DQLDAINEYAVNILEFLSSLCDVRFTEEELQTVLRCLSRLCCLNQDTVDSWQTDFNSFVS 362

Query: 379  KETGLTSSYTPRDEIFQYLSDLGGHNYREFLRVLFEQLLQVE--SMAWRSQESLLFLLQS 436
            KETGL +S+T RD+  + LS     +Y   L +L  ++ Q+   S  W   ESLL+LLQS
Sbjct: 363  KETGLVASFTIRDQAAELLSSFDSQDYATVLVLLVHEISQISDFSDGWIFNESLLYLLQS 422

Query: 437  CQLNSEGPQFDEQTVAGLLEKSQRLLRSGDVHPLVRCRVAMTVPRLLEKYMDSLPNVKDL 496
              LN          V  +  K Q +L        V CR+ + +P+LLEK MDS PNV+DL
Sbjct: 423  LLLNEANSLEFMDAVTRIFTKLQSILEKSLSCVFVNCRIILLIPKLLEKIMDSFPNVRDL 482

Query: 497  VREFVFLTFNTTVTSENQLLSASALIAFTYYSSFVDFGSVLGVQTAEELEKLVLSTIKNI 556
            V+ F+FL+ +  ++ +N+L+ ++ LI+FTYYS F +  SVLG     ++++  L  I  +
Sbjct: 483  VQNFLFLSLDFALSQDNELIKSATLISFTYYSYFAELPSVLGPDNCIQVQQKTLKLIAQL 542

Query: 557  LDGIDEDTPGFLLEVLSGVTGCNKESRNRELKLY--ELQLVQNVATADPSNIQVVVEAQE 614
                ++DT G L+EVL  V  CN E+ +    +   E  LV  +++ DPSNIQ  +E QE
Sbjct: 543  YPEAEDDTDGVLMEVLDNVIDCNSENVDDTSSIIQTEFHLVFTISSKDPSNIQTTIELQE 602

Query: 615  CLKNLLQ-YDPENYLQYAELCIPSFLEVLRADSSHGYAYTPXXXXXXXXXXXFMRKKPVD 673
            CL  LL+  D + ++ + E+C P  + V+   +   + Y+P            M++KP+D
Sbjct: 603  CLGKLLKNVDVKTFITFWEICFPPMVNVMIGSAHSSFEYSPLLSLTLQVLGVLMKRKPLD 662

Query: 674  SALPRSMVDYIFDPLSSMLLNAEDDELLQLSTEAFXXXXXXXXXXXXXGRIPVIITILEK 733
              L  ++ + +F+PL ++L  ++D+E+LQ +TEA                +  I+ IL+ 
Sbjct: 663  PTLSITICNDVFEPLQNILNQSKDEEILQYATEALGYLIYNTEAEVILPHLKSIVNILDA 722

Query: 734  LLSARTSHSAAINAGTLLIAVLTKFANQIQDIMPKILEAAAKRLVQIKNLHTAENLLFVF 793
            LLS      AA + G+L + + +KF+N+IQ+++P IL+AAA RL Q  N+ T +NLL VF
Sbjct: 723  LLSPGVPDQAATHVGSLTVTIFSKFSNEIQNLIPMILQAAAARLGQATNITTTQNLLSVF 782

Query: 794  CYLTSIDARQTVDFLSSTIIDEGGRTALQAIVPRWLEAFEVLRGEHKIKENILSLSKLFF 853
            C++TS DA+QTVDFL +T I    +  L  ++ +WLE+F+V+RGE + KENI++LSKLFF
Sbjct: 783  CFVTSADAQQTVDFLFNTTI--SNQNGLNLVMSKWLESFDVVRGEKRTKENIITLSKLFF 840

Query: 854  LEDPRIAGITVNGDLIPHDGDIIITRSMAKKMPDKYTQISAAEKIVKLFVAELAFQQNQP 913
            L D R+  + VNGDLIP++ DIIITRSMAK+MPD+YTQ+S   KI+KLF +EL FQ    
Sbjct: 841  LNDQRLNSMQVNGDLIPYESDIIITRSMAKEMPDRYTQVSVYHKIIKLFTSELEFQGKHQ 900

Query: 914  DPGRYPKDGSG-PADPHDSEGXXXXXXXXXXXXXXXXXKLQEYAXXXXXXXXXXSL---L 969
            DP        G   +  +++                  +LQ Y            L    
Sbjct: 901  DPQLLMAGTYGIETNTEENQDDDDNDDWEDVEGPLEYERLQHYVEEDETDDRGEELDEQC 960

Query: 970  FTSNIEEDAT-TLLTQFFKEAVARNASGFQEIYSRLTEQEKKSLS 1013
               N++  +   LL  FFKE  A+N SGFQ IY +L++ EK+ LS
Sbjct: 961  LADNLDSRSVHQLLVDFFKEVAAKNISGFQSIYEQLSDNEKQILS 1005

>Suva_7.20 Chr7 (40012..43038) [3027 bp, 1008 aa] {ON} YGL241W (REAL)
          Length = 1008

 Score =  640 bits (1651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/1031 (36%), Positives = 577/1031 (55%), Gaps = 55/1031 (5%)

Query: 19   MDLRQLVLAAQSAGKIERESAEQSLLEACRADPAAVCVGLVKMATQENTELASRQFCLYT 78
            MD+  L+  AQSA    RE+AE  LL+ C +D + V   L  +A    T L SRQF L +
Sbjct: 1    MDISHLITGAQSADNHTREAAEAQLLQWCDSDASQVFTSLASVALHHQTSLQSRQFALLS 60

Query: 79   LRKLITMYWNAGFESYCGPPGVREDAKETVRDALLRMAVSRTQDSKIISASAYCVVQIAA 138
            LRKLITMYW+ GFESY     V  + KE++R+ALL + ++  +++KI + ++YC+VQI+A
Sbjct: 61   LRKLITMYWSPGFESYRSTSNVDLNVKESIREALLNLCLNANENTKIKNGASYCIVQISA 120

Query: 139  FDFPDEWPGLLKSVYESITGERSLAALGLLHEIFDDVVSEEMFFQGGVGWQTIRIIFELL 198
             DFPD+WP LL  +Y++I+   S+ A+ LL+EI+DDVVSEEMFF+GG+G +T+ IIF++L
Sbjct: 121  VDFPDQWPQLLTVIYDAISQHHSINAMSLLNEIYDDVVSEEMFFEGGIGLETVEIIFKVL 180

Query: 199  GDDGP-VALKDAAMKLYHSCXXXXXXXXXXXXXDTRAAVGAHVHEALELFAQLLEHCRSL 257
              +   +  K AA+KL+ +C                + + +H     E     +  C S 
Sbjct: 181  TTEASNLVAKIAALKLFKACL---------------SQMSSHDKHNDESRNNFINQCLST 225

Query: 258  E-------PHADLL--------QFQAHTYENLVLIKTQLPKRFFPGAXXXXXXXXXXXXX 302
                       DL+        +F++  YENLV IK    K+ FP               
Sbjct: 226  SLQTLGQLLTLDLVNEDVTCQSKFRSIIYENLVFIKNNFSKKHFPKEFQVQFKLVAIKDL 285

Query: 303  XXXGAYYEQHLAEGDEELLKAVAESAIHMVIFLSSVHECKLNTERMCMLLGSLARLSCLS 362
                +         +E+ L+ V   ++++V FL++V       E M M++ SL  L  + 
Sbjct: 286  KNIASMNVNDGPTENEDSLETVQTCSVYIVEFLTTVCSIPFTIEEMKMIIQSLTALCRVD 345

Query: 363  AIQTEAWDVDYNSFISKETGLTSSYTPRDEIFQYLSDLGGHNYREFLRVLFEQLLQVESM 422
            +  T+ W  D+N F+SKETGL +SY  RD++ ++ + L   N      ++ + ++Q  S 
Sbjct: 346  SDTTQLWIGDFNYFVSKETGLAASYNVRDQVSEFFTSLSDPNLSLMFDIVSQDIVQNTS- 404

Query: 423  AWRSQESLLFLLQSCQLNSEGPQFDEQTVAGLLEKSQRL-------LRSGDVHPLVRCRV 475
              ++ ESLL+LLQ   LN      DE T   +++ SQ L       L S +++ +   R+
Sbjct: 405  NHQTLESLLYLLQCILLND-----DEITGQNIIQSSQSLIENLRSELVSSELNEVTLARL 459

Query: 476  AMTVPRLLEKYMDSLPNVKDLVREFVFLTFNTTVTSENQLLSASALIAFTYYSSFVDFGS 535
             + +P++L+K++D LP++K L   F+  + +  +    +L+ ++ LIAFTYY  F +  S
Sbjct: 460  ILIIPKVLDKFIDVLPDIKSLTSSFLKASLDLALKYHQELVESAVLIAFTYYCYFAELDS 519

Query: 536  VLGVQTAEELEKLVLSTIKNILDGIDEDTPGFLLEVLSGVTGCNKES--RNRELKLYELQ 593
            VLG +   E+++ ++  I  I D  +EDT G ++EVL+ V  CN +    + E+   E  
Sbjct: 520  VLGPEACTEVQQNIIQIINEISDDAEEDTNGTIMEVLNEVISCNTKGPHHSEEVLQAEFH 579

Query: 594  LVQNVATADPSNIQVVVEAQECLKNLL-QYDPENYLQYAELCIPSFLEVLRADSSHGYAY 652
            LV ++++ DP+N+QVVV++QECL+ LL      NY+ Y ELC+PSF+ VL A+  + Y Y
Sbjct: 580  LVFSISSKDPANVQVVVQSQECLEKLLDNITMGNYMSYIELCLPSFINVLEANRPNNYKY 639

Query: 653  TPXXXXXXXXXXXFMRKKPVDSALPRSMVDYIFDPLSSMLLNAEDDELLQLSTEAFXXXX 712
            TP           F++KKP    LP  +  ++F+PL+ +L  + +DE LQL+TEAF    
Sbjct: 640  TPLLSLVLEFITVFLKKKPSSEFLPSEIDQHLFEPLAKVLAYSTEDETLQLATEAFSYLI 699

Query: 713  XXXXXXXXXGRIPVIITILEKLLSARTSHSAAINAGTLLIAVLTKFANQIQDIMPKILEA 772
                      R+  I+ +LE+LLS   S SAA+N G+L++ + T+F+ +IQ ++ +IL+A
Sbjct: 700  FNTDTQVMEPRLMDIMKVLERLLSLEVSDSAAMNVGSLVVTIFTRFSGEIQPLVERILQA 759

Query: 773  AAKRLVQIKNLHTAENLLFVFCYLTSIDARQTVDFLSSTIIDEGGRTALQAIVPRWLEAF 832
               RLV+ +N+ T +NL  V C+LT  D +QTVDFL S  ID     AL  ++P+W+E+F
Sbjct: 760  VVIRLVKAQNISTQQNLFSVLCFLTCNDPKQTVDFLCSFQID--NMDALSLVMPKWMESF 817

Query: 833  EVLRGEHKIKENILSLSKLFFLEDPRIAGITVNGDLIPHDGDIIITRSMAKKMPDKYTQI 892
            EV+RGE +IKENI++L KLF L+D R+  + VNGDLIP+DGD+IITRSMAKKMPDKY Q+
Sbjct: 818  EVVRGERRIKENIIALIKLFLLDDARLHKLMVNGDLIPYDGDLIITRSMAKKMPDKYVQV 877

Query: 893  SAAEKIVKLFVAELAFQQNQPDPGRYPKDGSGPADPHDSEGXXXXXXXXXXXXXXXXX-- 950
                KI+KLFV+EL FQ  QP+P +           ++                      
Sbjct: 878  PLYTKIIKLFVSELGFQNKQPNPEQLITTDIAKDAANNDNDDDNDADNDDWEDVDDVLDY 937

Query: 951  -KLQEY---AXXXXXXXXXXSLLFTSNIEEDATTLLTQFFKEAVARNASGFQEIYSRLTE 1006
             KL++Y               +    +++E    +L  FFKE  +++ SGF  IY  L+E
Sbjct: 938  EKLKDYIGDDVDGGEEDDSEDITGLMDVKESVVQILVGFFKEVASKDVSGFHRIYESLSE 997

Query: 1007 QEKKSLSACMV 1017
             E+K LS  ++
Sbjct: 998  NERKVLSEALL 1008

>KAFR0J00190 Chr10 (30537..33575) [3039 bp, 1012 aa] {ON} Anc_3.564
            YGL241W
          Length = 1012

 Score =  625 bits (1611), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/1022 (35%), Positives = 573/1022 (56%), Gaps = 37/1022 (3%)

Query: 20   DLRQLVLAAQSAGKIERESAEQSLLEACRADPAAVCVGLVKMATQENTELASRQFCLYTL 79
            D+ QL+  AQS     RE AEQ LL++C ++ + +   L  +A   + +LA+RQF L +L
Sbjct: 4    DISQLISQAQSPDNSLREHAEQQLLQSCDSNASLIFQALTDVAINNSNKLAARQFALLSL 63

Query: 80   RKLITMYWNAGFESYCGPPGVREDAKETVRDALLRMAVSRTQDSKIISASAYCVVQIAAF 139
            RKLIT YW+ GFESY     +  D K ++R+ L+++A+   QDSKI S+++YCV QI+A 
Sbjct: 64   RKLITFYWSPGFESYRNTSQIDLDTKSSLRNYLIQLALDDNQDSKIKSSASYCVTQISAV 123

Query: 140  DFPDEWPGLLKSVYESITGERSLAALGLLHEIFDDVVSEEMFFQGGVGWQTIRIIFELL- 198
            DFPD+WP LL  +Y  IT   SL+A+ LL+EI+DD+VSEEMFF+G +G +T+ I+++LL 
Sbjct: 124  DFPDQWPELLSILYGCITQHYSLSAIKLLNEIYDDIVSEEMFFEGNIGLETLSIVYQLLE 183

Query: 199  -GDDGPVALKDAAMKLYHSCXXXXXXXXXXXXXDTRAAVGAHVHEALELFAQLLEHCRSL 257
             GD+  +  + A + L ++                +  +   +  AL L + +LE     
Sbjct: 184  SGDNVSIQARIALVDLLNATITQMTNVDSNLTEKRKQLLSESIPRALGLLSNILEMSHR- 242

Query: 258  EPHADLLQFQAHTYENLVLIKTQLPKRFFPGAXXXXXXXXXXXXXXXXGAYYEQHLAEGD 317
            +   D L F    YE LVLIK +LPK+FF                      Y   + E  
Sbjct: 243  DISTDSLTFIGKIYEILVLIKNELPKKFFSAQTRDAYKRITLNTLSLLQNKY-ASMTEPA 301

Query: 318  EELLKAVAESAIHMVIFLSSV-HECKLNTERMCMLLGSLARLSCLSAIQTEAWDVDYNSF 376
            E  L++ +E AIH + FL+S+ +      E   ++L SL  L  L  +  E W  D+N F
Sbjct: 302  ETELESFSECAIHTLEFLTSLSYNTNFTEEERTIILNSLLVLCSLDPVTKETWLADFNHF 361

Query: 377  ISKETGLTSSYTPRDEIFQYLSDLGGHNYREFLRVLFEQLLQV-----ESMAWRSQESLL 431
            +SKETGL  SYT RD+ F++L+ L   N++  L+ +F+    +      S+     E+  
Sbjct: 362  VSKETGLLPSYTIRDQSFEFLTSLIDQNFQLILKSIFQYFFTLISSSSPSVDPSQLETTF 421

Query: 432  FLLQSCQLNSEGPQ-FDEQTVAGLLEKSQRLLRSGDVH-PLVRCRVAMTVPRLLEKYMDS 489
            +LLQS   N +  +  + + +  +L     LL   +VH  L+  R+ + +P++LEK+MD 
Sbjct: 422  YLLQSILSNDDDIENVNNEEITSVLRVLPSLL--TNVHDSLMVSRIILALPKILEKFMDD 479

Query: 490  LPNVKDLVREFVFLTFNTTV-TSENQLLSASALIAFTYYSSFVDFGSVLGVQTAEELEKL 548
            LP+VK +V+ F+  +    +  S + ++ +S LI+FT Y  F +  SVLG +    ++K 
Sbjct: 480  LPDVKAMVQTFLVQSTELALRLSGDYIIKSSVLISFTSYCYFAELPSVLGPELCASIQKS 539

Query: 549  VLSTIKNILDGIDEDTPGFLLEVLSGVTGCNKESRNRELKLYELQLVQNVATADPSNIQV 608
            +L+ +K + +  ++DT G L EVL+ +  CN  + ++E+   E  L+ ++++ DPSN+Q+
Sbjct: 540  ILTLMKQVSNESEDDTNGLLTEVLNNIIECNSTNTSQEILQTEFSLLFSISSKDPSNVQI 599

Query: 609  VVEAQECLKNLLQYDPEN-YLQYAELCIPSFLEVLRADSSHGYAYTPXXXXXXXXXXXFM 667
            VVE+QE L+ LL    E  YL+Y ++ +P F+ ++ A+S+  Y Y+P           FM
Sbjct: 600  VVESQESLEKLLTNVTEKVYLEYIQIYLPPFINIIHANSTTSYRYSPLLSLVLEFITIFM 659

Query: 668  RKKPVDSA-LPRSMVDYIFDPLSSMLLNAEDDELLQLSTEAFXXXXXXXXXXXXXGRIPV 726
            +KKP DS  LP S++  +F PL  +L  + +DE LQL+T+AF               +  
Sbjct: 660  KKKPSDSKILPESIIANLFQPLVDILTTSTEDETLQLTTDAFTYIIYNTDSEKVMPYLET 719

Query: 727  IITILEKLLSARTSHSAAINAGTLLIAVLTKFANQIQDIMPKILEAAAKRLVQIKNLHTA 786
            ++ IL++LLS   + +AA+N GTL++ + TKF+ QI  ++P IL AA  RL+  KN+ T 
Sbjct: 720  VVNILDRLLSLDVTDTAAMNVGTLIVTIFTKFSAQISSLIPTILNAAVNRLIDCKNISTQ 779

Query: 787  ENLLFVFCYLTSIDARQTVDFLSSTIIDEGGRTALQAIVPRWLEAFEVLRGEHKIKENIL 846
            +NL+ + C+L   + ++TVDFL     +   +  ++ ++ +W E+FE++RGE KIKENI+
Sbjct: 780  QNLVSLLCFLFYSNTQETVDFL----FNLPQQNIVRDVLIKWFESFEIIRGEKKIKENII 835

Query: 847  SLSKLFFLEDPRIAGITVNGDLIPHDGDIIITRSMAKKMPDKYTQISAAEKIVKLFVAEL 906
            +L KL+ L D ++  I VNGD+IP++GD+IITRS AK +PDKYTQI+  EKI+KLF+AEL
Sbjct: 836  ALGKLYCLHDEKLFSIKVNGDIIPYEGDLIITRSRAKSLPDKYTQITIFEKIIKLFIAEL 895

Query: 907  AFQQNQPD-PGRYPKDGSGPADPHDSEGXXXXXXXXXXXXXXXXXKLQEYAXXXXXXXXX 965
             FQ  QP        + +   D ++++                  KL+EY          
Sbjct: 896  GFQNKQPAIENLMTNETTALGDSNENDD-----EWEDVDDVLDYDKLKEYVNDEDELDGE 950

Query: 966  XSLLFTSNIEED----------ATTLLTQFFKEAVARNASGFQEIYSRLTEQEKKSLSAC 1015
             S  +    EE+           T L+  FFK+  ++N + FQ IY  L+E EK  L+  
Sbjct: 951  DSREYGEGDEEEITGLGDVSQTVTELIIGFFKDVTSKNVNNFQSIYDTLSENEKMILTQY 1010

Query: 1016 MV 1017
            +V
Sbjct: 1011 LV 1012

>KNAG0D02940 Chr4 complement(529102..532131) [3030 bp, 1009 aa] {ON}
            Anc_3.564 YGL241W
          Length = 1009

 Score =  620 bits (1599), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/1022 (36%), Positives = 567/1022 (55%), Gaps = 36/1022 (3%)

Query: 19   MDLRQLVLAAQSAGKIERESAEQSLLEACRADPAAVCVGLVKMATQENTE-LASRQFCLY 77
            M++ +L+   QS     R  AE +L+     D + V   L+ +A     + L  RQF L 
Sbjct: 1    MNMDELIALLQSPDNSVRTQAESNLMTVSDEDASHVLQSLINVALNSAEKPLTERQFALL 60

Query: 78   TLRKLITMYWNAGFESYCGPPGVREDAKETVRDALLRMAVSRTQDSKIISASAYCVVQIA 137
            ++RKLIT YW+  FESY     +    K+ VRD+LL+++++ +QD+KI  +++YC+VQI+
Sbjct: 61   SMRKLITFYWSPAFESYRNTATLDLLTKQYVRDSLLQLSLNDSQDTKIKKSASYCIVQIS 120

Query: 138  AFDFPDEWPGLLKSVYESITGERSLAALGLLHEIFDDVVSEEMFFQGGVGWQTIRIIFEL 197
            A DFPDEWP LL+ +Y +IT   SL+A+ LL+EI+DDV+SEEMFF+GG+G +T++IIF+L
Sbjct: 121  AVDFPDEWPKLLEELYGAITNFHSLSAISLLNEIYDDVISEEMFFEGGIGLETLQIIFQL 180

Query: 198  LGDDGP-VALKDAAMKLYHSCXXXXXXXXXXXXXDTRA-AVGAHVHEALELFAQLLEHCR 255
            L  D   +  K AA+ L+H+              + R   V   V   L+    LLE   
Sbjct: 181  LSSDASTIEAKLAAINLFHATLLQMSTVDSHTTQEKRKEMVRNCVPICLDTLRTLLEGLA 240

Query: 256  SLEPHADLLQFQAHTYENLVLIKTQLPKRFFPGAXXXXXXXXXXXXXXXXGAYYEQHLAE 315
             +   A  LQ +   Y++L  IK + P + FP                      +     
Sbjct: 241  DIN-SALPLQLKGSIYKSLEFIKNKFPTQLFPSQFVEYFKIQAVRDLVALQINQDSF--- 296

Query: 316  GDEELLKAVAESAIHMVIFLSSVHECKLNTERMCMLLGSLARLSCLSAIQTEAWDVDYNS 375
             D+ +++A  E AIH++  +SS+   +  TE    +L +L  LS L A   E+W  D+N 
Sbjct: 297  ADDTVVEAFNECAIHVIELISSIEITEYGTEDQHAILKALLSLSRLDANTKESWTTDFND 356

Query: 376  FISKETGLTSSYTPRDEIFQYLSDLGGHNYREFLRVLFEQLLQVESMAWRSQ------ES 429
            F+SKETGL +S+T RD++  YL    G       + +FE +LQ+ S    S       ES
Sbjct: 357  FVSKETGLAASFTIRDQVADYLGTPTGAQS----QTMFENILQLVSDILSSNADPTTIES 412

Query: 430  LLFLLQSC-----QLNSEGPQFDEQTVAGLLEKSQRLLRSGDVHPLVRCRVAMTVPRLLE 484
             LFLLQS        +   PQ   Q ++ L+   Q +    D   ++R R+ +T+P++L+
Sbjct: 413  SLFLLQSVLAEDTDFSVSSPQTLVQLISALI-GPQTINTHND--SILRSRIILTIPKILD 469

Query: 485  KYMDSLPNVKDLVREFVFLTFNTTVTSENQLLSASALIAFTYYSSFVDFGSVLGVQTAEE 544
             +MDSLPN+K L ++ +  T    ++S ++L+  S LIAFTYY  F +  SVLG ++  E
Sbjct: 470  VFMDSLPNIKQLTKDLLLKTLQDALSSTDELIFCSTLIAFTYYVYFAELPSVLGSESCRE 529

Query: 545  LEKLVLSTIKNILDGIDEDTPGFLLEVLSGVTGCNKESRNRELKLYELQLVQNVATADPS 604
            L++ VL  + ++    +EDT G L+EVL+ V  CN  S + +L   EL  + ++++ DPS
Sbjct: 530  LQEAVLGIVNHVASEAEEDTNGLLIEVLNHVISCNVASTDFKLLQKELTAMLSISSKDPS 589

Query: 605  NIQVVVEAQECLKNLL-QYDPENYLQYAELCIPSFLEVLRADSSHGYAYTPXXXXXXXXX 663
            NI+V VE+QECL+ LL   + E Y ++  +C+PSF+ +++ +    Y Y P         
Sbjct: 590  NIEVSVESQECLEKLLDNINTERYNKFISICLPSFVNIIKGNQPLKYKYNPLLSLILEFV 649

Query: 664  XXFMRKKPVDSALPRSMVDYIFDPLSSMLLNAEDDELLQLSTEAFXXXXXXXXXXXXXGR 723
              FM+KKP +  LPR+  + I   L  +L  +E+DE LQL+T AF               
Sbjct: 650  RIFMKKKPTNGMLPRNFSEGIIALLVDILERSEEDETLQLATAAFSHLLNNTDPTIVIQH 709

Query: 724  IPVIITILEKLLSARTSHSAAINAGTLLIAVLTKFANQIQDIMPKILEAAAKRLVQIKNL 783
            + V+I +L++LLS   S +AA N GTL++ +  K++ ++ +++P ILE+A  RL+  KN+
Sbjct: 710  LTVVIKVLKRLLSMFVSDTAAQNVGTLIVTLFNKYSKELTNLIPDILESAIYRLIDAKNV 769

Query: 784  HTAENLLFVFCYLTSIDARQTVDFLSSTIIDEGGRTALQAIV-PRWLEAFEVLRGEHKIK 842
             T ENL+ + CY+T  D  Q V+FL      E  R  + +++  +W E FE++RGE KIK
Sbjct: 770  TTQENLISLICYVTCCDPLQMVNFLFK--FSESERRDIPSLMFNKWFETFEIVRGERKIK 827

Query: 843  ENILSLSKLFFLEDPRIAGITVNGDLIPHDGDIIITRSMAKKMPDKYTQISAAEKIVKLF 902
            +NI++LSK+FFL D R+  + VNGDL+P++GD IITRSMAK+MPD+YTQI    KIVK+F
Sbjct: 828  DNIIALSKIFFLSDFRLTYVKVNGDLLPYEGDRIITRSMAKEMPDRYTQIDVYSKIVKVF 887

Query: 903  VAELAFQQNQPDPGRYPKDGSGPADPHDSEGXXXXXXXXXXXXXXXXXKLQEYAXXXXXX 962
            V EL F+  QPD  R        +D   +                   KL+E+       
Sbjct: 888  VTELQFRNKQPDAERLITSDIKHSDELAAAEGNDDDGWEDVDDVLDYEKLKEFVDDDDDR 947

Query: 963  XXXXSLLFTSN-------IEEDATTLLTQFFKEAVARNASGFQEIYSRLTEQEKKSLSAC 1015
                 L   ++       + + AT LLT FFKEA+  N +GFQE+Y+ L+E E+  LS C
Sbjct: 948  EDSVGLGNDADEITGIDAVPQSATQLLTAFFKEAMTNNVNGFQEMYNALSESERTILSQC 1007

Query: 1016 MV 1017
            ++
Sbjct: 1008 LL 1009

>TBLA0E00240 Chr5 (36791..39823) [3033 bp, 1010 aa] {ON} Anc_3.564
            YGL241W
          Length = 1010

 Score =  601 bits (1550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/1018 (34%), Positives = 547/1018 (53%), Gaps = 27/1018 (2%)

Query: 18   KMDLRQLVLAAQSAGKIERESAEQSLLEACRADPAAVCVGLVKMATQENTELASRQFCLY 77
             +D+  L+  AQS     RE AE SLLE C  D  +    L  +A      L+SRQ+ L 
Sbjct: 2    NIDIDSLIKQAQSPETSLREHAENSLLEWCEHDACSAFAALANVAANNTEILSSRQYSLL 61

Query: 78   TLRKLITMYWNAGFESYCGPPGVREDAKETVRDALLRMAVSRTQDSKIISASAYCVVQIA 137
             LRKLITMYW+ GFESY     + E  K  VR  +L++A+ + QDSKI  + +YC+VQ++
Sbjct: 62   ALRKLITMYWSPGFESYHLTSNLNETVKAHVRHTILQLALDKNQDSKIRKSGSYCIVQVS 121

Query: 138  AFDFPDEWPGLLKSVYESITGERSLAALGLLHEIFDDVVSEEMFFQGGVGWQTIRIIFEL 197
            A DFPD WP LL ++Y+SI    SL AL +L+EI+DD++SEEMFF+ G+G +T+R+IF +
Sbjct: 122  AVDFPDLWPELLVTLYKSILETHSLEALSILNEIYDDIISEEMFFEEGIGLETMRVIFNI 181

Query: 198  LGDD-GPVALKDAAMKLYHSCXXXXXXXXXXXXXDTRAAVGAHVHEALELFAQL----LE 252
            L D   PV  K AA KL++ C                  V   + E +  + Q+    LE
Sbjct: 182  LDDKTAPVETKIAAAKLFYPCLMQMSVVSPTSSLKRMNLVIDSLKEIISKWEQILQFPLE 241

Query: 253  HCRSLEPHADLLQ--FQAHTYENLVLIKTQLPKRFFPGAXXXXXXXXXXXXXXXXGAYYE 310
                + P   +L+  F+   YE L  + +   K+  P                     Y 
Sbjct: 242  DALLISPEEAILEWKFRGSIYEGLAFVHSNFSKKILPMNFLNVFRKCSLQDLTPASTLY- 300

Query: 311  QHLAEGDEELLKAVAESAIHMVIFLSSVHECKLNTERMCMLLGSLARLSCLSAIQTEAWD 370
             ++  GD     A+ +  IH+  +LS++       E + ++L S+ +L CL  +  E W+
Sbjct: 301  INMISGDNIAFNALNKYIIHIFEYLSNISRANYEREELILILESIYKLCCLDNLIVETWN 360

Query: 371  VDYNSFISKETGLTSSYTPRDEIFQYLSDLGGHN----YREFLRVLFEQLLQVESMAWRS 426
             ++N F+SKE GL +SY+ RD+I  +L  L  +N    ++EF+  L    L +E   WR 
Sbjct: 361  SNFNEFVSKEFGLMASYSLRDQISDFLISLSSNNFNIIFKEFITNL-NNCLIIED--WRQ 417

Query: 427  QESLLFLLQSCQLNSEGP-QFDEQTVAGLLEKSQRLLRSGDVHPLVRCRVAMTVPRLLEK 485
             ES+L++ QS  +N E         +  LL    +       + ++  R+ + +P++LEK
Sbjct: 418  LESMLYIFQSLLINDEDILNVANLNIENLLSSLAKNFHHYITNTILFSRLILLIPKILEK 477

Query: 486  YMDSLPNVKDLVREFVFLTFNTTVTSENQLLSASALIAFTYYSSFVDFGSVLGVQTAEEL 545
            +MD + N+K +  EF+  +    + + N L+ +S L+    Y SF +  +VLG +T +E+
Sbjct: 478  FMDDIENIKLITCEFLKQSLAIGLDNYNALIKSSCLLMVNSYCSFAELLTVLGDKTCQEV 537

Query: 546  EKLVLSTIKNILDGIDEDTPGFLLEVLSGVTGCN-KESRNRELKLYELQLVQNVATADPS 604
            +++ L  I  ILD  ++DT G ++EV++ +  CN    +  E+   E  L+ ++ + DPS
Sbjct: 538  QQITLKIILQILDDSEDDTYGMIMEVINNLIDCNLPNDKLGEIPQQEFNLILSITSRDPS 597

Query: 605  NIQVVVEAQECLKNLLQ-YDPENYLQYAELCIPSFLEVLRADSSHGYAYTPXXXXXXXXX 663
            N+Q+ VE+QECLK LL+  +   Y  Y E+C PS ++VL   S   Y Y+          
Sbjct: 598  NVQMTVESQECLKKLLEGLNTFEYSHYIEMCFPSMVKVLIGSSVTQYKYSALLSLALEFI 657

Query: 664  XXFMRKKPVDSALPRSMVDYIFDPLSSMLLNAEDDELLQLSTEAFXXXXXXXXXXXXXGR 723
              FM+KKP D  LP  +  +IF+PL  +LL + +DE LQLS++AF               
Sbjct: 658  TIFMKKKPNDGYLPLEICKFIFNPLKDVLLVSNEDETLQLSSDAFSYLIYNTDPIVMVES 717

Query: 724  IPVIITILEKLLSARTSHSAAINAGTLLIAVLTKFANQIQDIMPKILEAAAKRLVQIKNL 783
            +P I+ ++++LLS   + SAA+NAG+L++ V T F N+I+  M +IL    KRL+Q KN+
Sbjct: 718  LPGILEVMDRLLSLDVTDSAAMNAGSLVVTVFTHFENEIKPYMKQILSGTTKRLIQAKNI 777

Query: 784  HTAENLLFVFCYLTSIDARQTVDFLSSTIIDEGGRTALQAIVPRWLEAFEVLRGEHKIKE 843
             T +NL+ V CYL   +   T++ LS  +  EG    L+ ++ +W+  FE++RGE +IK+
Sbjct: 778  STIQNLISVICYLICSNTEDTINLLSR-LGTEGD--ILKLVLNKWISNFEIIRGERRIKQ 834

Query: 844  NILSLSKLFFLEDPRIAGITVNGDLIPHDGDIIITRSMAKKMPDKYTQISAAEKIVKLFV 903
            NIL+L+KL+ L +  I  I V+ +LIP+DGD IITRSMAK+MPD+YTQI    KI+KLF+
Sbjct: 835  NILALNKLYCLNNSNIKHIMVDDELIPYDGDRIITRSMAKEMPDRYTQIPVYSKIIKLFI 894

Query: 904  AELAFQQNQPDPGRYPKDGSGPADPHDSEGXXXXXXXXXXXXXXXXXKLQEYAXXXXXXX 963
             EL+ Q  QP+     K         D                    KLQEY        
Sbjct: 895  QELSEQMKQPEHNL--KIEETVETIGDGNAAAADDDWEDVEDVLDYEKLQEYVDDEDDEL 952

Query: 964  X----XXSLLFTSNIEEDATTLLTQFFKEAVARNASGFQEIYSRLTEQEKKSLSACMV 1017
                    +L T +IE D   LL +  KE  ++N S F +IY+ L+E EK+ LS C+V
Sbjct: 953  HFGEDEDDILGTMDIEIDVKELLIRILKENASKNVSDFDKIYTTLSEDEKRILSECLV 1010

>KLLA0A00803g Chr1 (76350..79208) [2859 bp, 952 aa] {ON} similar to
            uniprot|P53067 Saccharomyces cerevisiae YGL241W KAP114
            Karyopherin, responsible for nuclear import of Spt15p,
            histones H2A and H2B, and Nap1p; amino terminus shows
            similarity to those of other importins, particularly
            Cse1p; localization is primarily nuclear
          Length = 952

 Score =  338 bits (867), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 268/1011 (26%), Positives = 444/1011 (43%), Gaps = 77/1011 (7%)

Query: 19   MDLRQLVLAAQSAGKIERESAEQSLLEACRADPAAVCVGLVKMATQENTELASRQFCLYT 78
            M +  L+   QS  K ERE AE SLLE C  DP    + L+  AT  N   ++RQ  L  
Sbjct: 1    MSIPYLLEGIQSPQKEEREDAENSLLERCATDPPDTFIELIDTATNNNASASTRQLALLC 60

Query: 79   LRKLITMYWNAGFESYCGPPGVREDAKETVRDALLRMAVSRTQDSKIISASAYCVVQIAA 138
            LRK  TMYW+AGF S+ GPPGV E  K+ VR  LL +  +   + K+IS   YC+VQI A
Sbjct: 61   LRKFTTMYWSAGFPSFVGPPGVGEQGKDLVRRGLLSLLANEDTEKKVISTVTYCIVQICA 120

Query: 139  FDFPDEWPGLLKSVYESITGERSLAALGLLHEIFDDVVSEEMFFQGGVGWQTIRIIFELL 198
             DFPDEWPGLL  + E+I    S  A+ LL E+  D+++ EMFF    G + +  +   L
Sbjct: 121  VDFPDEWPGLLDYLNENILNYHSENAISLLTELVQDIITNEMFFDNHSGAKIVNTVLLAL 180

Query: 199  GDDG-PVALKDAAMKLYHSCXXXXXXXXXXXXXDTRAA-VGAHVHEALELFAQLLE-HCR 255
             DD   +  K   ++LYH C             +  +  +  H+    +   +LLE +  
Sbjct: 181  NDDTLRLQAKSKLLQLYHHCISQLRNVSMFVTSELMSEWLIPHLKAMNDCIDKLLESYGN 240

Query: 256  SLEPHADLLQFQAHTYENLVLIKTQLPKRFFPGAXXXXXXXXXXXXXXXXGAYYEQHLAE 315
            ++E  ++++  +   +  L  +                               Y + L  
Sbjct: 241  NME--SEVIGLKGELFMALSKLFDLNQSILGSNGDLSYRLRITLDAIKSNANSYARALTN 298

Query: 316  GDEELLKAVAESAIHMVIFLSSVHECKLNTE----------RMCMLLGSLARLSCLSAIQ 365
             DE  L+ +  S I+ V +L+ +    +             ++C+L     +LS      
Sbjct: 299  NDELRLEIINSSCINTVQYLAYIPSDLIENPTLPDFTEDFIKLCLLPEDYFKLS------ 352

Query: 366  TEAWDVDYNSFISKETGLTSSYTPRDEIFQYLSDLGGHNYREFLRVLFEQLLQVESMAWR 425
                  D+N FISKETGL++SY  RDEI QY+S      YR     + ++ LQV S   +
Sbjct: 353  ------DFNEFISKETGLSASYNARDEIGQYVSSCSDEIYRHITDSVLQKCLQVTSNEAQ 406

Query: 426  SQESLLFLLQSCQLNSEGPQFDEQTVAGLLEKSQRLLRSGDVHPLVRCRVAMTVPRLLEK 485
             QE+ LFL Q  +L S     +       L  +  +L        V+ R  +T+P+  E 
Sbjct: 407  YQEACLFLFQ--ELCSNETSMNVPRYQDFLSLAVMILDDDACPTFVKSRTILTIPKFFEN 464

Query: 486  YMDSLPNVKDLVREFVFLTFNTTVTSENQLLSASALIAFTYYSSFVDFGSVLGVQTAEEL 545
             M++LP +K LV++F+  T N T+++E+  L AS +I+FTYY+SF + GS+L  QT+  L
Sbjct: 465  NMETLPEIKQLVQQFLVKTVNCTISAEDDFLLASLVISFTYYTSFAELGSILDYQTSMIL 524

Query: 546  EKLVLSTIKNILDGIDEDTPGFLLEVLSGVTGCNKESRNRELKLYELQLVQNVATADPSN 605
            ++ +L  IK +    +ED+ G LLE +  +       ++   K   L L+  +++++PSN
Sbjct: 525  QQSLLKAIKTLYVDSEEDSLGLLLEAMHEIVKTWHFQQDLHTKQEILNLLLKLSSSEPSN 584

Query: 606  IQVVVEAQECLKNLLQ-YDPENYLQYAELCIPSFLEVLRADSSHGYAYTPXXXXXXXXXX 664
            +++V E+   L  LL+  +  +Y +  E C PSF+E +         Y+P          
Sbjct: 585  VRIVFESVRSLPYLLRDINCTDYTRLCESCFPSFIEAMSTFLQSQQTYSPLVVLALEFLS 644

Query: 665  XFMRKKPVDSALPRSMVDYIFDPLSSMLLNAEDDELLQLSTEAFXXXXXXXXXXXXXGRI 724
             F++  PV + +   + +Y+ +P+   +    D+ + + + +AF               +
Sbjct: 645  VFLKNPPVGNHISDEVAEYVLNPIVQFIKQCPDENIAETALQAFVYLACNSNPKFWKDSM 704

Query: 725  PVIITILEKLLSARTSHSAAINAGTLLIAVLTKFANQIQDIMPKILEAAAKRLVQIKNLH 784
              + ++   +     S    I+   +++  L          + +I+E    +LV    LH
Sbjct: 705  FDLCSL---VFDPERSLYKTIDVAPIMLLSLRVTQPHENRFIGQIMEYTISKLVDPNKLH 761

Query: 785  TAENLLFVFCYLTSIDARQTVDFLSSTIIDEGGRTALQAIVPRWLEAFEVLRGEHKIKEN 844
              ++ + + C +   D +  + ++ S  I     +    ++    + FE  R ++ +KE 
Sbjct: 762  PVDSFIIISCEVILKDIQSFLAYIFSIPI-SAEESIPNKLIRELFDCFEENRSKNMLKEV 820

Query: 845  ILSLSKLFFLEDPRIAGITVNGDLIPHDGDIIITRSMAKKMPDKYTQISAAEKIVKLFVA 904
             LSLS+LFF  D R+   +       HD    + R                E IVK+F  
Sbjct: 821  ALSLSELFFSNDQRLTRSSY------HDESDGVVRPF-------------KEYIVKMFAD 861

Query: 905  ELAFQQNQPDPGRYPKDGSGPADPHDSEGXXXXXXXXXXXXXXXXXKLQEYAXXXXXXXX 964
            EL  Q +  +     ++      P D E                    ++Y         
Sbjct: 862  ELTRQTDIEEEEEEEEEEENDITPKDYE--------------------EDYVSQLNDDVV 901

Query: 965  XXSLLFTSNIEEDATTLLTQFFKEAVARNASGFQEIYSRLTEQEK-KSLSA 1014
               LL    I+ +   +L QFFK     N +    +   L EQE+ K LSA
Sbjct: 902  ---LLTGRVIDMELKEILVQFFKSTQQSNDNSLGRVLKNLDEQERLKILSA 949

>SAKL0H07876g Chr8 (674192..677290) [3099 bp, 1032 aa] {ON} highly
           similar to uniprot|Q02932 Saccharomyces cerevisiae
           YPL125W KAP120 Karyopherin with a role in the assembly
           or export of 60S ribosomal subunits
          Length = 1032

 Score = 39.3 bits (90), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 37/79 (46%), Gaps = 5/79 (6%)

Query: 75  CLYTLRKLITMYWNAGFESYCGPP---GVREDAKETVRDALLRMAVSRTQDSKIISASAY 131
           C   +R L  + +  G E Y        + +D K ++R  L  M     Q++++   +A 
Sbjct: 60  CSLQIRWLAIIQFKNGIERYWRSTRVNAISKDEKASIRSRLFDMI--DEQNNQLCIQNAQ 117

Query: 132 CVVQIAAFDFPDEWPGLLK 150
              +IA  DFP+EWP L +
Sbjct: 118 ASARIARLDFPNEWPNLFE 136

>Skud_7.555 Chr7 (907277..910531) [3255 bp, 1084 aa] {ON} YGR218W
           (REAL)
          Length = 1084

 Score = 37.0 bits (84), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 55/129 (42%), Gaps = 22/129 (17%)

Query: 64  QENTELASRQFCLYTLRKLITMYWNAGFESYCGPPGVREDAKETVRDALLRMAVSRTQDS 123
           Q +T   S+   L  L KLIT  W            +  D +  +R+ L+ M +S  QD 
Sbjct: 56  QFSTNPQSKFIALSILDKLITRKWKL----------LPNDHRIGIRNFLVGMIISMCQDD 105

Query: 124 KI-------ISASAYCVVQIAAFDFPDEWPGLLKSVYESITG-----ERSLAALGLLHEI 171
           ++       I+ S   +VQI   ++P  WP  +  +  S +      E ++  L LL E 
Sbjct: 106 EVFKTQKNLINKSDLTLVQILKQEWPQNWPEFIPELIGSSSSSVNVCENNMIVLKLLSEE 165

Query: 172 FDDVVSEEM 180
             D  +E+M
Sbjct: 166 VFDFSAEQM 174

>CAGL0J06776g Chr10 (651309..654392) [3084 bp, 1027 aa] {ON} highly
           similar to uniprot|Q02932 Saccharomyces cerevisiae
           YPL125w KAP120 nuclear transport factor
          Length = 1027

 Score = 36.6 bits (83), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 29/118 (24%), Positives = 51/118 (43%), Gaps = 8/118 (6%)

Query: 35  ERESAEQSLLEACRADPAAVCVGLVKMATQENTELASRQFCLYTLRKLITMYWNAGFESY 94
           ER+   +S L+A    P    + L  +    +  L  R   +   +  +  YW A   + 
Sbjct: 27  ERQRMAESQLKAWETQPGFHFL-LQSIYLDLSNGLHVRWLAVIQFKNGVEKYWRATRINS 85

Query: 95  CGPPGVREDAKETVRDALLRMAVSRTQDSKIISASAYCVVQIAAFDFPDEWPGLLKSV 152
            G     +D K ++R  L    V   Q++++   +A    +I+  DFP EWP L +S+
Sbjct: 86  IG-----KDEKASIRKRLFD--VVDEQNNQLCIQNAQATARISRIDFPVEWPNLFESI 136

>Smik_16.86 Chr16 complement(160938..164192) [3255 bp, 1084 aa] {ON}
           YGR218W (REAL)
          Length = 1084

 Score = 36.2 bits (82), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 55/129 (42%), Gaps = 22/129 (17%)

Query: 64  QENTELASRQFCLYTLRKLITMYWNAGFESYCGPPGVREDAKETVRDALLRMAVSRTQDS 123
           Q +T   S+   L  L KLIT  W            +  D +  +R+ ++ M +S  QD 
Sbjct: 56  QFSTNPQSKFIALSILDKLITRKWKL----------LPNDHRIGIRNFIVGMIISMCQDE 105

Query: 124 KI-------ISASAYCVVQIAAFDFPDEWPGLLKSVYESITG-----ERSLAALGLLHEI 171
           ++       I+ S   +VQI   ++P  WP  +  +  S +      E ++  L LL E 
Sbjct: 106 EVFKTQKNLINKSDLTLVQILKQEWPQNWPEFIPELIGSSSSSVNVCENNMIVLKLLSEE 165

Query: 172 FDDVVSEEM 180
             D  +E+M
Sbjct: 166 VFDFSAEQM 174

>Skud_16.155 Chr16 (284989..288087) [3099 bp, 1032 aa] {ON} YPL125W
           (REAL)
          Length = 1032

 Score = 36.2 bits (82), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 38/84 (45%), Gaps = 5/84 (5%)

Query: 79  LRKLITMYWNAGFESYCGPP---GVREDAKETVRDALLRMAVSRTQDSKIISASAYCVVQ 135
           +R L  + +  G + Y        + +D K ++R  L  M     Q++++   +A    +
Sbjct: 61  IRWLAVIQFKNGVDKYWRSTRINAISKDEKASIRGRLFEMI--DEQNNQLCIQNAQAAAR 118

Query: 136 IAAFDFPDEWPGLLKSVYESITGE 159
           IA  DFP EWP L + +   +  E
Sbjct: 119 IARLDFPVEWPNLFEDLENLLNNE 142

>YGR218W Chr7 (932541..935795) [3255 bp, 1084 aa] {ON}  CRM1Major
           karyopherin, involved in export of proteins, RNAs, and
           ribosomal subunits from the nucleus; exportin
          Length = 1084

 Score = 35.8 bits (81), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 55/129 (42%), Gaps = 22/129 (17%)

Query: 64  QENTELASRQFCLYTLRKLITMYWNAGFESYCGPPGVREDAKETVRDALLRMAVSRTQDS 123
           Q +T   S+   L  L KLIT  W            +  D +  +R+ ++ M +S  QD 
Sbjct: 56  QFSTNPQSKFIALSILDKLITRKWKL----------LPNDHRIGIRNFVVGMIISMCQDD 105

Query: 124 KI-------ISASAYCVVQIAAFDFPDEWPGLLKSVYESITG-----ERSLAALGLLHEI 171
           ++       I+ S   +VQI   ++P  WP  +  +  S +      E ++  L LL E 
Sbjct: 106 EVFKTQKNLINKSDLTLVQILKQEWPQNWPEFIPELIGSSSSSVNVCENNMIVLKLLSEE 165

Query: 172 FDDVVSEEM 180
             D  +E+M
Sbjct: 166 VFDFSAEQM 174

>Kpol_1050.49 s1050 (111270..114521) [3252 bp, 1083 aa] {ON}
           (111270..114521) [3252 nt, 1084 aa]
          Length = 1083

 Score = 35.8 bits (81), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 50/117 (42%), Gaps = 22/117 (18%)

Query: 76  LYTLRKLITMYWNAGFESYCGPPGVREDAKETVRDALLRMAVSRTQDSKI-------ISA 128
           L  L KLIT  W            +  + +  +RD ++ M +S  QD  +       I+ 
Sbjct: 68  LTILDKLITTKWKL----------LPNEQRVGIRDFIVGMIISMCQDDNVFQNQKNLINK 117

Query: 129 SAYCVVQIAAFDFPDEWPG----LLKSVYESIT-GERSLAALGLLHEIFDDVVSEEM 180
           S   +VQI   ++P  WP     L+ S   SI   E ++  L LL E   D  +E+M
Sbjct: 118 SDLTLVQILKQEWPQNWPNFIPELIGSSASSINVCENNMVILKLLSEEVFDFSAEQM 174

>NCAS0C01430 Chr3 complement(262823..265912) [3090 bp, 1029 aa] {ON}
           Anc_8.624 YPL125W
          Length = 1029

 Score = 35.8 bits (81), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 42/90 (46%), Gaps = 10/90 (11%)

Query: 69  LASRQFCLYTLRKLITMYWNAGFESYCGPPGVREDAKETVRDALLRMAVSRTQDSKIISA 128
           L +R   +   +  +  YW +    +C    + +D K ++R  L  M     Q++++   
Sbjct: 61  LQTRWLAVIQFKNGVDKYWRST-RVHC----INKDEKASIRTRLFDMI--DEQNNQLGIQ 113

Query: 129 SAYCVVQIAAFDFPDEWPGL---LKSVYES 155
            A    +IA  DFP EWP L   LKS+ E+
Sbjct: 114 YAQATARIARLDFPVEWPNLFETLKSLLEN 143

>KLLA0E16061g Chr5 complement(1428731..1431991) [3261 bp, 1086 aa]
           {ON} highly similar to uniprot|P30822 Saccharomyces
           cerevisiae YGR218W CRM1 Major karyopherin involved in
           export of proteins RNAs and ribosomal subunits from the
           nucleus
          Length = 1086

 Score = 35.4 bits (80), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 50/117 (42%), Gaps = 22/117 (18%)

Query: 76  LYTLRKLITMYWNAGFESYCGPPGVREDAKETVRDALLRMAVSRTQDSKI-------ISA 128
           L  L KLIT  W            + ++ +  +R+ ++ M +S  QD ++       I  
Sbjct: 68  LSILDKLITTKWKM----------LPQEHRLGIRNFIVGMIISMCQDDQVFQTQKNLIHK 117

Query: 129 SAYCVVQIAAFDFPDEWPGLLKSVYESITG-----ERSLAALGLLHEIFDDVVSEEM 180
           S   +VQI   D+P+ WP  +  +  S        E ++  L LL E   D  +E+M
Sbjct: 118 SDLTLVQILKQDWPENWPDFIPELVLSSQASVNVCENNMVMLKLLSEEVFDFSAEQM 174

>ACR159C Chr3 complement(631643..634720) [3078 bp, 1025 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL125W
           (KAP120)
          Length = 1025

 Score = 35.4 bits (80), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 42/88 (47%), Gaps = 6/88 (6%)

Query: 75  CLYTLRKLITMYWNAGFESYCGPP---GVREDAKETVRDALLRMAVSRTQDSKIISASAY 131
           C   +R L  + +  G + Y        + +D K+++R  L  M     Q++++   +A+
Sbjct: 57  CSLQIRWLAIIQFKNGLDKYWRATRVNAISKDEKQSIRARLFEMV--DEQNNQLCIQNAH 114

Query: 132 CVVQIAAFDFPDEWPGLLKSVYESITGE 159
              +IA  D+P +WP L +  +E   G+
Sbjct: 115 ACARIARSDYPHDWPDLFE-YFEKALGD 141

>Smik_6.324 Chr6 complement(507726..510824) [3099 bp, 1032 aa] {ON}
           YPL125W (REAL)
          Length = 1032

 Score = 35.4 bits (80), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 38/84 (45%), Gaps = 5/84 (5%)

Query: 79  LRKLITMYWNAGFESYCGPPGVR---EDAKETVRDALLRMAVSRTQDSKIISASAYCVVQ 135
           +R L  + +  G + Y     V    +D K ++R  L  M     Q++++   +A    +
Sbjct: 61  IRWLAVIQFKNGVDKYWRSSRVNAIPKDEKASIRGRLFEMI--DEQNNQLCIQNAQAAAR 118

Query: 136 IAAFDFPDEWPGLLKSVYESITGE 159
           IA  DFP EWP L + +   +  E
Sbjct: 119 IARLDFPVEWPNLFEDLENLLNDE 142

>Ecym_2068 Chr2 (114936..118184) [3249 bp, 1082 aa] {ON} similar to
           Ashbya gossypii ADL128C
          Length = 1082

 Score = 35.4 bits (80), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 48/117 (41%), Gaps = 22/117 (18%)

Query: 76  LYTLRKLITMYWNAGFESYCGPPGVREDAKETVRDALLRMAVSRTQDSKI-------ISA 128
           L  L KLIT  W            +  D +  +R+ ++ M +S  QD  +       I+ 
Sbjct: 68  LSILDKLITTKWKM----------LPRDHRVGIRNFIVGMIISMCQDDAVFQTQKNLINK 117

Query: 129 SAYCVVQIAAFDFPDEWPGLLKSVYESITG-----ERSLAALGLLHEIFDDVVSEEM 180
           S   +VQI   ++P  WP  +  +  S        E ++  L LL E   D  +E+M
Sbjct: 118 SDLTLVQILKQEWPQNWPDFIPELVSSSQSSINVCENNMVILKLLSEEVFDFSTEQM 174

>NDAI0E02170 Chr5 complement(445219..448308) [3090 bp, 1029 aa] {ON}
           Anc_8.624 YPL125W
          Length = 1029

 Score = 35.4 bits (80), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 32/134 (23%), Positives = 57/134 (42%), Gaps = 10/134 (7%)

Query: 29  QSAGKIERESAEQSLLEACRADPAAVCVGLVKMATQENTELASRQFCLYTLRKLITMYWN 88
           Q AG   ++SAEQ L +     P      L  +    +  L SR       +  +  YW 
Sbjct: 23  QQAGSQVQKSAEQQL-KQWEIQPG-YHYYLQSIYLDLSNTLQSRWLAAIQFKNGVDRYWR 80

Query: 89  AGFESYCGPPGVREDAKETVRDALLRMAVSRTQDSKIISASAYCVVQIAAFDFPDEWPGL 148
           +          + +D K ++R  L  +     Q++++    A  + +IA  DFP EWP L
Sbjct: 81  SS-----RVHAINKDEKASIRARLFELI--DEQNNQLGIQYAQAIAKIARLDFPAEWPDL 133

Query: 149 LKSVYESITGERSL 162
            + + ES+  + ++
Sbjct: 134 FEHL-ESLLSDHNV 146

>TPHA0K01210 Chr11 (251767..254361) [2595 bp, 864 aa] {ON} Anc_4.180
           YLR347C
          Length = 864

 Score = 35.0 bits (79), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 32/55 (58%), Gaps = 3/55 (5%)

Query: 109 RDALLRMAVSRTQDS--KIISASAYCVVQIAAFDFP-DEWPGLLKSVYESITGER 160
           R+A+   A+S   D   +I +++A  V  IA  + P +EWPGL+K V E+   E+
Sbjct: 96  RNAIKERAISALIDPEIRIANSAAQLVAAIANIELPINEWPGLMKVVVENTAPEK 150

>KLLA0E11375g Chr5 (999242..1000111) [870 bp, 289 aa] {ON} similar
           to uniprot|P38260 Saccharomyces cerevisiae YBR101C FES1
           Hsp70 (Ssa1p) nucleotide exchange factor cytosolic
           homolog of Sls1p which is the nucleotide exchange factor
           for BiP (Kar2p) in the endoplasmic reticulum
          Length = 289

 Score = 34.7 bits (78), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 39/165 (23%), Positives = 72/165 (43%), Gaps = 15/165 (9%)

Query: 472 RCRVAMTVPRLLEKYMDSLPNVKDLVREFVFLTFNTTVTSENQLLSASALIAFTYYSSFV 531
           + R     P+LLE+     P+   L++  + +  N   T EN+      L+AF  +   +
Sbjct: 19  KARAGQPDPKLLEQLFGGGPDEPTLMKHAMAVISNPEATLENK------LVAFDNFEMLI 72

Query: 532 DFGSVLGVQTAEELEKLVL-STIKNILDGIDEDTPGFLLEVLSGVTGCNKESRNRELKLY 590
           +      +  A  +E + L   +  +LD  + +   F L V       N +S+N   K Y
Sbjct: 73  E-----NLDNANNIENMKLWEPLITVLDDPEPELRAFALSVTGTAVQNNDQSQNNFAK-Y 126

Query: 591 E--LQLVQNVATADPSNIQVVVEAQECLKNLLQYDPENYLQYAEL 633
           +  L  V  +A+    + QV  +A   L NL++++   Y Q+ +L
Sbjct: 127 DGALAKVIKLASGRAEDAQVRTKAFYTLSNLIRHNKLIYDQFNQL 171

>Ecym_8309 Chr8 complement(629689..632772) [3084 bp, 1027 aa] {ON}
           similar to Ashbya gossypii ACR159C
          Length = 1027

 Score = 35.0 bits (79), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 13/51 (25%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 100 VREDAKETVRDALLRMAVSRTQDSKIISASAYCVVQIAAFDFPDEWPGLLK 150
           + +D K ++RD L  M     +++++   +A+   +IA  D+P  WP + +
Sbjct: 85  ISKDEKSSIRDRLFHMV--NEENNQLAIQNAHATAKIARLDYPQNWPNMFE 133

>Suva_7.513 Chr7 (888432..891683) [3252 bp, 1084 aa] {ON} YGR218W
           (REAL)
          Length = 1084

 Score = 35.0 bits (79), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 55/129 (42%), Gaps = 22/129 (17%)

Query: 64  QENTELASRQFCLYTLRKLITMYWNAGFESYCGPPGVREDAKETVRDALLRMAVSRTQDS 123
           Q +T   S+   L  L KLIT  W            +  D +  +R+ ++ M +S  QD 
Sbjct: 56  QFSTNPQSKFIALTILDKLITRKWKL----------LPNDHRIGIRNFVVGMIISMCQDD 105

Query: 124 K-------IISASAYCVVQIAAFDFPDEWPGLLKSVYESITG-----ERSLAALGLLHEI 171
           +       +I+ S   +VQI   ++P  WP  +  +  S +      E ++  L LL E 
Sbjct: 106 EAFKTQKNLINKSDLTLVQILKQEWPQNWPEFIPELIGSSSSSVNVCENNMIILKLLSEE 165

Query: 172 FDDVVSEEM 180
             D  +E+M
Sbjct: 166 VFDFSAEQM 174

>TPHA0C01000 Chr3 (214320..229025) [14706 bp, 4901 aa] {ON}
           Anc_8.295 YLR106C
          Length = 4901

 Score = 35.0 bits (79), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 70/152 (46%), Gaps = 25/152 (16%)

Query: 486 YMDSLPNVKDLVREFVFLTFNTTVTSENQLLSASAL-------IAFTYYSSFVDFGSVLG 538
           Y+ + P++K  +  F F+  N  VT     ++ SAL         F YY  F+D  S   
Sbjct: 21  YVSTFPDLK--LNSFYFIEENLPVTENLNNIAKSALQEENTVASMFVYYPIFLDIASRWL 78

Query: 539 VQTAEELEKLVLSTIKNILDGIDEDTPGFLLEVLSGVTGCNKESRNRELKLYELQLVQNV 598
            +  ++ + L+L    NI+  +   TP  L E L         S+N E   + + ++QN 
Sbjct: 79  SEAFKDDKTLILGAYANIVTSLTLITP-LLDEFL---------SKNNE---HFVIILQNP 125

Query: 599 ATADPSNIQVVVEAQECLKNLLQYDPENYLQY 630
           ++ DP  IQ ++ A      +L YD + +++Y
Sbjct: 126 SSQDPQIIQDILLA---YYRILYYDRDTFIKY 154

>Kwal_26.8595 s26 complement(855035..858139) [3105 bp, 1034 aa] {ON}
           YPL125W (KAP120) - karyopherin [contig 67] FULL
          Length = 1034

 Score = 35.0 bits (79), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/78 (24%), Positives = 37/78 (47%), Gaps = 5/78 (6%)

Query: 75  CLYTLRKLITMYWNAGFESYCGPP---GVREDAKETVRDALLRMAVSRTQDSKIISASAY 131
           C   +R L  + +  G E +        +R++ K ++R  L  +   +  ++++   ++ 
Sbjct: 59  CPLNVRWLAIIQFKNGVEKFWRSTRVNAIRKEEKVSIRTRLFDLIDEK--NNQLCIQNSQ 116

Query: 132 CVVQIAAFDFPDEWPGLL 149
              +IA  DFP EWPGL 
Sbjct: 117 ATARIARLDFPGEWPGLF 134

>NDAI0A01540 Chr1 (344002..347346) [3345 bp, 1114 aa] {ON} Anc_7.408
           YER110C
          Length = 1114

 Score = 35.0 bits (79), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 73/142 (51%), Gaps = 21/142 (14%)

Query: 23  QLVLAA--QSAGKIERESAEQSLLEACRADPAAVCVGLVKMATQENTELASRQFCLYTLR 80
           Q +LAA  QS G   +E A ++L       PA+V   +  + TQ   ++  RQ     +R
Sbjct: 11  QRILAAITQSTGAGLKE-ATKTLQTVYYPQPASVPALVNILQTQ--PDVGVRQLAGIEVR 67

Query: 81  KLITMYWNAGFESYCGPPGVREDAKET-VRDALLRMAVSRTQDSKIIS-ASAYCVVQIAA 138
           KLI  +WN+            +DA +T ++ +LL+ A   T++ +II  A+A+ +  I+ 
Sbjct: 68  KLIPKHWNS-----------LDDATKTQIKTSLLQNAF--TEEKQIIRHANAHVIAAISI 114

Query: 139 FDF-PDEWPGLLKSVYESITGE 159
            +   ++WP L+ ++ ++ + E
Sbjct: 115 EELEANKWPDLIPNLIQAASNE 136

>ADL128C Chr4 complement(464142..467390) [3249 bp, 1082 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR218W
           (CRM1)
          Length = 1082

 Score = 34.7 bits (78), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 29/117 (24%), Positives = 49/117 (41%), Gaps = 22/117 (18%)

Query: 76  LYTLRKLITMYWNAGFESYCGPPGVREDAKETVRDALLRMAVSRTQDSKI-------ISA 128
           L  L +LIT  W            + +D +  +R+ ++ M +S  QD  +       I+ 
Sbjct: 68  LSILDRLITTKWKM----------LPQDHRVGIRNFIVGMIISLCQDDAVFQSQKNLINK 117

Query: 129 SAYCVVQIAAFDFPDEWPGLLKSVYESITG-----ERSLAALGLLHEIFDDVVSEEM 180
           S   +VQI   ++P  WP  +  +  S        E ++  L LL E   D  +E+M
Sbjct: 118 SDLTLVQILKQEWPQNWPDFIPELVSSSQSSINVCENNMVILKLLSEEVFDFSTEQM 174

>TPHA0F03160 Chr6 complement(690476..693571) [3096 bp, 1031 aa] {ON}
           Anc_8.624 YPL125W
          Length = 1031

 Score = 34.7 bits (78), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 20/87 (22%), Positives = 37/87 (42%), Gaps = 7/87 (8%)

Query: 66  NTELASRQFCLYTLRKLITMYWNAGFESYCGPPGVREDAKETVRDALLRMAVSRTQDSKI 125
           +  L  R   +   +  I  YW +   +      + ++ K  +R+ L  +   +     I
Sbjct: 55  DNSLQIRWISIIQFKNGIEKYWRSTRSN-----AINKNEKLKIRERLFNLVNEKNNQLSI 109

Query: 126 ISASAYCVVQIAAFDFPDEWPGLLKSV 152
            +A A    +IA FDFP  WP L +++
Sbjct: 110 QNAQA--TAKIARFDFPGHWPDLFENL 134

>KNAG0J01420 Chr10 complement(260385..263546) [3162 bp, 1053 aa]
           {ON} Anc_8.624 YPL125W
          Length = 1053

 Score = 34.7 bits (78), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 34/72 (47%), Gaps = 5/72 (6%)

Query: 79  LRKLITMYWNAGFESYCGPP---GVREDAKETVRDALLRMAVSRTQDSKIISASAYCVVQ 135
           +R L  + +  G E Y        +R+D K ++R  L  +     Q++++   +A    +
Sbjct: 64  VRWLAVIQFKNGIERYWRSTRVNAIRKDEKASIRARLFDLI--DEQNNQLCIQNAQATSK 121

Query: 136 IAAFDFPDEWPG 147
           IA  DFP EWP 
Sbjct: 122 IARLDFPAEWPN 133

>NCAS0A07450 Chr1 (1477489..1480743) [3255 bp, 1084 aa] {ON}
           Anc_5.111 YGR218W
          Length = 1084

 Score = 34.3 bits (77), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 49/117 (41%), Gaps = 22/117 (18%)

Query: 76  LYTLRKLITMYWNAGFESYCGPPGVREDAKETVRDALLRMAVSRTQDSKI-------ISA 128
           L  L KLI   W            + ED +  +R+ ++ M ++  QD  +       I+ 
Sbjct: 68  LTILDKLINTKWKL----------LPEDQRIGIRNFVVGMIITLCQDDTVFQTQKNLINK 117

Query: 129 SAYCVVQIAAFDFPDEWPGLLKSVYESITG-----ERSLAALGLLHEIFDDVVSEEM 180
           S   +VQI   ++P  WP  +  +  S T      E ++  L LL E   D  +E+M
Sbjct: 118 SDLTLVQILKQEWPQNWPEFIPELIGSSTSSVNVCENNMVILKLLSEEVFDFSAEQM 174

>TDEL0A05700 Chr1 complement(1003650..1006745) [3096 bp, 1031 aa]
           {ON} Anc_8.624 YPL125W
          Length = 1031

 Score = 33.9 bits (76), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 20/85 (23%), Positives = 40/85 (47%), Gaps = 5/85 (5%)

Query: 79  LRKLITMYWNAGFESYCGPP---GVREDAKETVRDALLRMAVSRTQDSKIISASAYCVVQ 135
           +R L  + +  G E Y        + +D K ++R  L  +     Q++++   +A    +
Sbjct: 63  IRWLAVIQFKNGVEKYWRSTRINAINKDEKISIRGRLFDLI--DEQNNQLSIQNAQAAAK 120

Query: 136 IAAFDFPDEWPGLLKSVYESITGER 160
           IA  DFP EWP L + + + ++ + 
Sbjct: 121 IARLDFPVEWPNLFEQLEQLLSNDH 145

>YER110C Chr5 complement(378762..382103) [3342 bp, 1113 aa] {ON}
           KAP123Karyopherin beta, mediates nuclear import of
           ribosomal proteins prior to assembly into ribosomes and
           import of histones H3 and H4; localizes to the nuclear
           pore, nucleus, and cytoplasm; exhibits genetic
           interactions with RAI1
          Length = 1113

 Score = 33.9 bits (76), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 20/97 (20%), Positives = 50/97 (51%), Gaps = 12/97 (12%)

Query: 64  QENTELASRQFCLYTLRKLITMYWNAGFESYCGPPGVREDAKETVRDALLRMAVSRTQDS 123
           Q  ++ + +Q      RKL++ +WNA          + E  + +++ +LL+ A S  +++
Sbjct: 48  QNGSDDSLKQLAGVEARKLVSKHWNA----------IDESTRASIKTSLLQTAFSEPKEN 97

Query: 124 KIISASAYCVVQIAAFDFP-DEWPGLLKSVYESITGE 159
            +  ++A  +  I   +   ++WP L+ ++ ++ +GE
Sbjct: 98  -VRHSNARVIASIGTEELDGNKWPDLVPNLIQTASGE 133

>TPHA0A04970 Chr1 (1123879..1127136) [3258 bp, 1085 aa] {ON}
           Anc_5.111 YGR218W
          Length = 1085

 Score = 33.9 bits (76), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 29/117 (24%), Positives = 49/117 (41%), Gaps = 22/117 (18%)

Query: 76  LYTLRKLITMYWNAGFESYCGPPGVREDAKETVRDALLRMAVSRTQDSKI-------ISA 128
           L  L KLIT  W            + ++ +  +RD ++ M +S  QD  +       I+ 
Sbjct: 68  LSILDKLITTKWKL----------LPQEQRVGIRDFVVGMVISLCQDDNVFKNEKNLINK 117

Query: 129 SAYCVVQIAAFDFPDEWPGLLKSVYESITG-----ERSLAALGLLHEIFDDVVSEEM 180
               +VQI   ++P  WP  +  +  S +      E ++  L LL E   D  +E+M
Sbjct: 118 CDLTLVQILKQEWPQNWPNFIPELIGSSSSSVNVCENNMIILKLLSEEVFDFSAEQM 174

>NCAS0A14490 Chr1 complement(2852114..2855455) [3342 bp, 1113 aa]
           {ON} Anc_7.408 YER110C
          Length = 1113

 Score = 33.9 bits (76), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 27/115 (23%), Positives = 57/115 (49%), Gaps = 15/115 (13%)

Query: 64  QENTELASRQFCLYTLRKLITMYWNAGFESYCGPPGVREDAKETVRDALLRMAVSRTQDS 123
           Q N + A +Q      RKLI+ +W+A          + E  K  ++ +LL+ A S  ++ 
Sbjct: 50  QNNPDDALKQLAGVESRKLISKHWDA----------LDETIKAQIKSSLLQTAFSEPKEI 99

Query: 124 KIISASAYCVVQIAAFDF-PDEWPGLLKSVYESITGERSL---AALGLLHEIFDD 174
            I  A+A  +  I + +   ++WP L+ ++ ++ +G+ +     A+ +L  + +D
Sbjct: 100 -IRHANARVIAAIGSQELETNKWPDLIPNLIQAASGDDATTRQTAIFILFSVLED 153

>TBLA0B07490 Chr2 complement(1779793..1783068) [3276 bp, 1091 aa]
           {ON} Anc_5.111 YGR218W
          Length = 1091

 Score = 33.9 bits (76), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 45/107 (42%), Gaps = 22/107 (20%)

Query: 76  LYTLRKLITMYWNAGFESYCGPPGVREDAKETVRDALLRMAVSRTQDS-------KIISA 128
           L  + KLIT  W            +  D +  +R+ ++ M +S  QD+        +I+ 
Sbjct: 68  LSIMDKLITTKWKL----------LPADQRIGIRNFIVGMIISMCQDNTLFRSQKNLINK 117

Query: 129 SAYCVVQIAAFDFPDEWPGLLKSVYESITG-----ERSLAALGLLHE 170
           S   +VQI   ++P  WP  +  +  S T      E ++  L LL E
Sbjct: 118 SDLTLVQILKQEWPQNWPNFIPELISSSTSSPNVCENNMIILKLLSE 164

>KLLA0D06633g Chr4 complement(568539..571610) [3072 bp, 1023 aa]
           {ON} similar to uniprot|Q02932 Saccharomyces cerevisiae
           YPL125W KAP120 Karyopherin with a role in the assembly
           or export of 60S ribosomal subunits
          Length = 1023

 Score = 33.5 bits (75), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 36/77 (46%), Gaps = 5/77 (6%)

Query: 79  LRKLITMYWNAGFESYCGPP---GVREDAKETVRDALLRMAVSRTQDSKIISASAYCVVQ 135
           +R L  + +  G + Y        + +D K+ +R+ L  M +    D K+   +A    +
Sbjct: 61  VRWLAIIQFKNGLDKYWRSTRINAITKDEKQQIRNRLFGM-IDEPND-KLAIQNAQATAR 118

Query: 136 IAAFDFPDEWPGLLKSV 152
           +A  DFP EWP L + V
Sbjct: 119 VARIDFPVEWPHLFEQV 135

>TDEL0G01360 Chr7 complement(270498..273767) [3270 bp, 1089 aa] {ON}
           Anc_5.111 YGR218W
          Length = 1089

 Score = 33.5 bits (75), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 51/122 (41%), Gaps = 22/122 (18%)

Query: 71  SRQFCLYTLRKLITMYWNAGFESYCGPPGVREDAKETVRDALLRMAVSRTQD-------S 123
           S+   L  L KLIT  W            + E+ +  +R+ ++ M ++  QD        
Sbjct: 63  SKFIGLTILDKLITTKWKL----------LPEEQRVGIRNFVVGMIITMCQDDALFHSQK 112

Query: 124 KIISASAYCVVQIAAFDFPDEWPGLLKSVYESITG-----ERSLAALGLLHEIFDDVVSE 178
            +I+ S   +VQI   ++P  WP  +  +  S        E ++  L LL E   D  +E
Sbjct: 113 NLINKSDLTLVQILKQEWPQNWPDFIPELIGSSNSSLNVCENNMIILKLLSEEVFDFSAE 172

Query: 179 EM 180
           +M
Sbjct: 173 QM 174

>Suva_14.259 Chr14 complement(475644..476750) [1107 bp, 368 aa] {ON}
           YNL080C (REAL)
          Length = 368

 Score = 32.7 bits (73), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 35/63 (55%), Gaps = 4/63 (6%)

Query: 78  TLRKLITMYW---NAGFESYCGPPGVRED-AKETVRDALLRMAVSRTQDSKIISASAYCV 133
           +LR   T +W   N+ +++Y    G R++ A    +D+LL  A++  + S+ +  S +CV
Sbjct: 81  SLRDAFTYFWQKLNSAYDNYSSSDGSRQEVASGDSKDSLLLSALTTARASEYLLCSLWCV 140

Query: 134 VQI 136
           V +
Sbjct: 141 VSL 143

>CAGL0B02189g Chr2 complement(202354..205617) [3264 bp, 1087 aa]
           {ON} highly similar to uniprot|P30822 Saccharomyces
           cerevisiae YGR218w CRM1
          Length = 1087

 Score = 33.1 bits (74), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 29/117 (24%), Positives = 50/117 (42%), Gaps = 22/117 (18%)

Query: 76  LYTLRKLITMYWNAGFESYCGPPGVREDAKETVRDALLRMAVSRTQDSKI-------ISA 128
           L  L KLIT  W            + ++ +  +R+ ++ M +S  QD  +       I+ 
Sbjct: 68  LSILDKLITTKWKL----------LPQEHRIGIRNFIVGMIISMCQDDTVFQTQKNLINK 117

Query: 129 SAYCVVQIAAFDFPDEWPGLLKSVYESITG-----ERSLAALGLLHEIFDDVVSEEM 180
           S   +VQI   ++P  WP  +  +  S +      E ++  L LL E   D  +E+M
Sbjct: 118 SDLTLVQILKQEWPQNWPEFIPELIGSSSASVNVCENNMVILKLLSEEVFDFSAEQM 174

>ZYRO0B15466g Chr2 complement(1256964..1260233) [3270 bp, 1089 aa]
           {ON} highly similar to uniprot|P30822 Saccharomyces
           cerevisiae YGR218W CRM1 Major karyopherin involved in
           export of proteins RNAs and ribosomal subunits from the
           nucleus
          Length = 1089

 Score = 33.1 bits (74), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 29/117 (24%), Positives = 50/117 (42%), Gaps = 22/117 (18%)

Query: 76  LYTLRKLITMYWNAGFESYCGPPGVREDAKETVRDALLRMAVSRTQD-------SKIISA 128
           L  L +LIT  W            + ++ +  +R+ ++ M +S  QD         +I+ 
Sbjct: 68  LSILDRLITRKWKL----------LPQEQRVGIRNFVVGMIISICQDDSLFHTQKNLINK 117

Query: 129 SAYCVVQIAAFDFPDEWPGLLKSVYESITG-----ERSLAALGLLHEIFDDVVSEEM 180
           S   +VQI   ++P  WP  +  +  S T      E ++  L LL E   D  +E+M
Sbjct: 118 SDLTLVQILKQEWPQNWPDFIPELIGSSTSSINVCENNMVILKLLSEEVFDFSAEQM 174

>TDEL0D06620 Chr4 (1197405..1199084) [1680 bp, 559 aa] {ON} 
          Length = 559

 Score = 32.3 bits (72), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 50/102 (49%), Gaps = 8/102 (7%)

Query: 432 FLLQSCQL--NSEGPQFDEQTV-AGLLEKSQRLLRSGDVHPLVRCRVAMTVPRLLEKYMD 488
           ++LQ+ +L  NS    F E  V    LE S +L + G    L+   +   V  L E++ D
Sbjct: 118 YILQAMKLVKNSASYSFFEHIVDVNALETSLKLKKGGGFQTLL---LLYAVTILSERFFD 174

Query: 489 SLPNVKDLVREFVFLTFNTTVTSENQLLSASALIAFTYYSSF 530
           S P+V+DL+ E   L  +     E   +S+  L+A  Y+ +F
Sbjct: 175 SPPDVQDLIEELHLLLDDCPDCPEK--VSSYILLADYYHCNF 214

>Kpol_530.12 s530 (33954..37046) [3093 bp, 1030 aa] {ON}
           (33954..37046) [3093 nt, 1031 aa]
          Length = 1030

 Score = 32.7 bits (73), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 15/64 (23%), Positives = 33/64 (51%), Gaps = 2/64 (3%)

Query: 99  GVREDAKETVRDALLRMAVSRTQDSKIISASAYCVVQIAAFDFPDEWPGLLKSVYESITG 158
            +++D K ++R  L  +     Q++++   ++    +IA  DFP +WP L + +   ++ 
Sbjct: 83  AIKKDEKASIRARLFELI--DEQNNQLAIQNSQAAAKIARLDFPVDWPNLFEQLESLLSN 140

Query: 159 ERSL 162
           E  L
Sbjct: 141 ETVL 144

>ZYRO0F06160g Chr6 complement(509916..513005) [3090 bp, 1029 aa]
           {ON} highly similar to uniprot|Q02932 Saccharomyces
           cerevisiae YPL125W KAP120 Karyopherin with a role in the
           assembly or export of 60S ribosomal subunits
          Length = 1029

 Score = 32.7 bits (73), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 19/85 (22%), Positives = 40/85 (47%), Gaps = 5/85 (5%)

Query: 79  LRKLITMYWNAGFESYCGPP---GVREDAKETVRDALLRMAVSRTQDSKIISASAYCVVQ 135
           +R L  + +  G + Y        + ++ K ++R  L  +     Q++++   +A    +
Sbjct: 63  IRWLSVIQFKNGVDKYWRSTRLHAISKEEKSSIRARLFDLI--DEQNNQLCIQNAQATAR 120

Query: 136 IAAFDFPDEWPGLLKSVYESITGER 160
           IA +DFP EWP L + + +    E+
Sbjct: 121 IARYDFPVEWPNLFEQLEQLFANEQ 145

>Skud_5.236 Chr5 complement(374903..378244) [3342 bp, 1113 aa] {ON}
           YER110C (REAL)
          Length = 1113

 Score = 32.7 bits (73), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 23/110 (20%), Positives = 54/110 (49%), Gaps = 15/110 (13%)

Query: 72  RQFCLYTLRKLITMYWNAGFESYCGPPGVREDAKETVRDALLRMAVSRTQDSKIISASAY 131
           +Q      RKL++ +WNA          + E  + +++ +LL+ A S  +++ +  ++A 
Sbjct: 56  KQLAGVEARKLVSKHWNA----------IDEPTRISIKTSLLQTAFSEPKEN-VRHSNAR 104

Query: 132 CVVQIAAFDFP-DEWPGLLKSVYESITGER---SLAALGLLHEIFDDVVS 177
            +  I   +   ++WP L+ ++ ++ +GE       A+ +L  + +D  S
Sbjct: 105 VIASIGTEELDGNKWPDLVPNLIQAASGENVQTRQTAIFILFSLLEDFTS 154

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.134    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 88,796,040
Number of extensions: 3332979
Number of successful extensions: 9214
Number of sequences better than 10.0: 66
Number of HSP's gapped: 9319
Number of HSP's successfully gapped: 74
Length of query: 1017
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 897
Effective length of database: 39,721,479
Effective search space: 35630166663
Effective search space used: 35630166663
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 71 (32.0 bits)