Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AFR265C3.568ON59159129360.0
Ecym_25983.568ON60260121210.0
SAKL0F00770g3.568ON63662917810.0
KLTH0G00704g3.568ON61560417550.0
Kwal_47.192683.568ON61661417470.0
TDEL0D063603.568ON58558817160.0
KLLA0A00715g3.568ON59157816990.0
ZYRO0E09548g3.568ON59258516850.0
Kpol_507.93.568ON60358416540.0
NCAS0F039703.568ON59760516460.0
CAGL0C01969g3.568ON61958316250.0
NDAI0B062803.568ON60560716220.0
TBLA0E002103.568ON63161116090.0
Smik_7.3683.568ON65962415540.0
KAFR0J001703.568ON60758815120.0
KNAG0D029603.568ON65162115110.0
TPHA0A060103.568ON62356715050.0
Suva_12.93.568ON65928610351e-132
YFR048W (RMD8)3.568ON66221110221e-130
Skud_6.1393.568ON66121110161e-129
CAGL0M10483g3.209ON4321984401e-47
Suva_4.2523.209ON4302024331e-46
YDL001W (RMD1)3.209ON4302024321e-46
Smik_4.2353.209ON4312034322e-46
Skud_4.2533.209ON4302024312e-46
NCAS0A101203.209ON4231984285e-46
SAKL0C11286g3.209ON4281984279e-46
TDEL0D041303.209ON4381984252e-45
TBLA0A001703.209ON5051984255e-45
NDAI0A073503.209ON5221974257e-45
KLLA0E17381g3.209ON4441984217e-45
KNAG0K014903.209ON4052154187e-45
Kwal_27.110013.209ON4081984171e-44
KLTH0G16544g3.209ON4081984152e-44
ZYRO0A04400g3.209ON4581984182e-44
Kpol_1045.583.209ON4471994173e-44
KAFR0F025003.209ON4661984174e-44
TPHA0P005503.209ON4461914156e-44
AEL004W3.209ON4751984113e-43
Ecym_52933.209ON4771984105e-43
YDR282C5.291ON4142131847e-14
Skud_4.5455.291ON4132131822e-13
KLLA0C11165g5.291ON3562371783e-13
KLTH0G06622g5.291ON3922481713e-12
Ecym_47435.291ON3662571713e-12
SAKL0G10582g5.291ON3832381713e-12
Suva_2.4485.291ON4172241687e-12
Smik_4.5315.291ON4142131671e-11
Kwal_23.56435.291ON3742491651e-11
CAGL0H01045g5.291ON3611841606e-11
TPHA0D017105.291ON3862401581e-10
Kpol_1033.65.291ON4031931581e-10
AAL122C5.291ON3662531552e-10
ZYRO0G16478g5.291ON4011991535e-10
KAFR0E015305.291ON3632191501e-09
TDEL0E033605.291ON4051701482e-09
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR265C
         (591 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR265C Chr6 complement(910790..912565) [1776 bp, 591 aa] {ON} S...  1135   0.0  
Ecym_2598 Chr2 (1162883..1164691) [1809 bp, 602 aa] {ON} similar...   821   0.0  
SAKL0F00770g Chr6 complement(66976..68886) [1911 bp, 636 aa] {ON...   690   0.0  
KLTH0G00704g Chr7 complement(47865..49712) [1848 bp, 615 aa] {ON...   680   0.0  
Kwal_47.19268 s47 (1163922..1165772) [1851 bp, 616 aa] {ON} YFR0...   677   0.0  
TDEL0D06360 Chr4 (1142081..1143838) [1758 bp, 585 aa] {ON} Anc_3...   665   0.0  
KLLA0A00715g Chr1 complement(69861..71636) [1776 bp, 591 aa] {ON...   659   0.0  
ZYRO0E09548g Chr5 (760326..762104) [1779 bp, 592 aa] {ON} simila...   653   0.0  
Kpol_507.9 s507 complement(53819..55630) [1812 bp, 603 aa] {ON} ...   641   0.0  
NCAS0F03970 Chr6 (796049..797842) [1794 bp, 597 aa] {ON} Anc_3.5...   638   0.0  
CAGL0C01969g Chr3 complement(206652..208511) [1860 bp, 619 aa] {...   630   0.0  
NDAI0B06280 Chr2 (1519871..1521688) [1818 bp, 605 aa] {ON} Anc_3...   629   0.0  
TBLA0E00210 Chr5 complement(29729..31624) [1896 bp, 631 aa] {ON}...   624   0.0  
Smik_7.368 Chr7 (606969..608948) [1980 bp, 659 aa] {ON} YFR048W ...   603   0.0  
KAFR0J00170 Chr10 complement(27714..29537) [1824 bp, 607 aa] {ON...   587   0.0  
KNAG0D02960 Chr4 (533165..535120) [1956 bp, 651 aa] {ON} Anc_3.5...   586   0.0  
TPHA0A06010 Chr1 (1359051..1360922) [1872 bp, 623 aa] {ON} Anc_3...   584   0.0  
Suva_12.9 Chr12 complement(11366..13345) [1980 bp, 659 aa] {ON} ...   403   e-132
YFR048W Chr6 (246146..248134) [1989 bp, 662 aa] {ON}  RMD8Cytoso...   398   e-130
Skud_6.139 Chr6 (241140..243125) [1986 bp, 661 aa] {ON} YFR048W ...   395   e-129
CAGL0M10483g Chr13 complement(1049771..1051069) [1299 bp, 432 aa...   174   1e-47
Suva_4.252 Chr4 (445183..446475) [1293 bp, 430 aa] {ON} YDL001W ...   171   1e-46
YDL001W Chr4 (447984..449276) [1293 bp, 430 aa] {ON}  RMD1Cytopl...   171   1e-46
Smik_4.235 Chr4 (427186..428481) [1296 bp, 431 aa] {ON} YDL001W ...   171   2e-46
Skud_4.253 Chr4 (439498..440790) [1293 bp, 430 aa] {ON} YDL001W ...   170   2e-46
NCAS0A10120 Chr1 (2022090..2023361) [1272 bp, 423 aa] {ON} Anc_3...   169   5e-46
SAKL0C11286g Chr3 complement(1012631..1013917) [1287 bp, 428 aa]...   169   9e-46
TDEL0D04130 Chr4 (760040..761356) [1317 bp, 438 aa] {ON} Anc_3.2...   168   2e-45
TBLA0A00170 Chr1 (16781..18298) [1518 bp, 505 aa] {ON} Anc_3.209...   168   5e-45
NDAI0A07350 Chr1 complement(1671549..1673117) [1569 bp, 522 aa] ...   168   7e-45
KLLA0E17381g Chr5 complement(1540387..1541721) [1335 bp, 444 aa]...   166   7e-45
KNAG0K01490 Chr11 (310336..311553) [1218 bp, 405 aa] {ON} Anc_3....   165   7e-45
Kwal_27.11001 s27 complement(593288..594514) [1227 bp, 408 aa] {...   165   1e-44
KLTH0G16544g Chr7 complement(1435479..1436705) [1227 bp, 408 aa]...   164   2e-44
ZYRO0A04400g Chr1 (359271..360647) [1377 bp, 458 aa] {ON} simila...   165   2e-44
Kpol_1045.58 s1045 (139327..140670) [1344 bp, 447 aa] {ON} (1393...   165   3e-44
KAFR0F02500 Chr6 complement(484705..486105) [1401 bp, 466 aa] {O...   165   4e-44
TPHA0P00550 Chr16 complement(110346..111686) [1341 bp, 446 aa] {...   164   6e-44
AEL004W Chr5 (630125..631552) [1428 bp, 475 aa] {ON} Syntenic ho...   162   3e-43
Ecym_5293 Chr5 (595331..596764) [1434 bp, 477 aa] {ON} similar t...   162   5e-43
YDR282C Chr4 complement(1023511..1024755) [1245 bp, 414 aa] {ON}...    75   7e-14
Skud_4.545 Chr4 complement(966078..967319) [1242 bp, 413 aa] {ON...    75   2e-13
KLLA0C11165g Chr3 complement(957421..958491) [1071 bp, 356 aa] {...    73   3e-13
KLTH0G06622g Chr7 (527870..529048) [1179 bp, 392 aa] {ON} simila...    70   3e-12
Ecym_4743 Chr4 complement(1450271..1451371) [1101 bp, 366 aa] {O...    70   3e-12
SAKL0G10582g Chr7 (900403..901554) [1152 bp, 383 aa] {ON} simila...    70   3e-12
Suva_2.448 Chr2 complement(788042..789295) [1254 bp, 417 aa] {ON...    69   7e-12
Smik_4.531 Chr4 complement(955033..956277) [1245 bp, 414 aa] {ON...    69   1e-11
Kwal_23.5643 s23 complement(1249364..1250488) [1125 bp, 374 aa] ...    68   1e-11
CAGL0H01045g Chr8 complement(98818..99903) [1086 bp, 361 aa] {ON...    66   6e-11
TPHA0D01710 Chr4 complement(356399..357559) [1161 bp, 386 aa] {O...    65   1e-10
Kpol_1033.6 s1033 complement(11719..12930) [1212 bp, 403 aa] {ON...    65   1e-10
AAL122C Chr1 complement(132431..133531) [1101 bp, 366 aa] {ON} S...    64   2e-10
ZYRO0G16478g Chr7 complement(1349497..1350702) [1206 bp, 401 aa]...    64   5e-10
KAFR0E01530 Chr5 complement(309332..310423) [1092 bp, 363 aa] {O...    62   1e-09
TDEL0E03360 Chr5 (635665..636882) [1218 bp, 405 aa] {ON} Anc_5.2...    62   2e-09

>AFR265C Chr6 complement(910790..912565) [1776 bp, 591 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFR048W
           (RMD8)
          Length = 591

 Score = 1135 bits (2936), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 555/591 (93%), Positives = 555/591 (93%)

Query: 1   MAGDDMVQVGNNRTVPRNMMSRRSPSILVTDARSTKKRSSAPFAGNANTRRDKTGGSMPT 60
           MAGDDMVQVGNNRTVPRNMMSRRSPSILVTDARSTKKRSSAPFAGNANTRRDKTGGSMPT
Sbjct: 1   MAGDDMVQVGNNRTVPRNMMSRRSPSILVTDARSTKKRSSAPFAGNANTRRDKTGGSMPT 60

Query: 61  VIENXXXXXXXXXXXXEFMPKAGSGRTRQGKFSEVSMDNILSEMSDVPSGRRQERLSSSS 120
           VIEN            EFMPKAGSGRTRQGKFSEVSMDNILSEMSDVPSGRRQERLSSSS
Sbjct: 61  VIENRAGRRMGPMGGREFMPKAGSGRTRQGKFSEVSMDNILSEMSDVPSGRRQERLSSSS 120

Query: 121 FEYERRPAHYNKTIRPLPSRTSKTSEKFVLIPDENVKRFAQGFHKRSASRVFSELSYGEH 180
           FEYERRPAHYNKTIRPLPSRTSKTSEKFVLIPDENVKRFAQGFHKRSASRVFSELSYGEH
Sbjct: 121 FEYERRPAHYNKTIRPLPSRTSKTSEKFVLIPDENVKRFAQGFHKRSASRVFSELSYGEH 180

Query: 181 NTAGLPSITAYNVAEGFNLNLASQFLKETHNVSIRRYDEXXXXXXXXXXXXGKDGFRIRS 240
           NTAGLPSITAYNVAEGFNLNLASQFLKETHNVSIRRYDE            GKDGFRIRS
Sbjct: 181 NTAGLPSITAYNVAEGFNLNLASQFLKETHNVSIRRYDECLYVPYCLPLLPGKDGFRIRS 240

Query: 241 NVSKKMVGGKTLIDRLIDTSEQRDHHYEYYSGVETVEDMHNNFEINENGNGRDPDGLRNA 300
           NVSKKMVGGKTLIDRLIDTSEQRDHHYEYYSGVETVEDMHNNFEINENGNGRDPDGLRNA
Sbjct: 241 NVSKKMVGGKTLIDRLIDTSEQRDHHYEYYSGVETVEDMHNNFEINENGNGRDPDGLRNA 300

Query: 301 DHLAPLSSNMQSFDPSEPQFFAEELSEIGLHPIQDSSSEQHEREKVLDAQQHAEIFIFNY 360
           DHLAPLSSNMQSFDPSEPQFFAEELSEIGLHPIQDSSSEQHEREKVLDAQQHAEIFIFNY
Sbjct: 301 DHLAPLSSNMQSFDPSEPQFFAEELSEIGLHPIQDSSSEQHEREKVLDAQQHAEIFIFNY 360

Query: 361 GVIVFWNFTELEEKNILGDIAFSGMKNMVTRPLDEQDIEIEQFHFEYDMDTERPRIFNDI 420
           GVIVFWNFTELEEKNILGDIAFSGMKNMVTRPLDEQDIEIEQFHFEYDMDTERPRIFNDI
Sbjct: 361 GVIVFWNFTELEEKNILGDIAFSGMKNMVTRPLDEQDIEIEQFHFEYDMDTERPRIFNDI 420

Query: 421 ITLRSGDHIIKLTLSHAIAQSTKLSRFEKRITPILGTVSKLPKRLALYGTLGLKREQLLK 480
           ITLRSGDHIIKLTLSHAIAQSTKLSRFEKRITPILGTVSKLPKRLALYGTLGLKREQLLK
Sbjct: 421 ITLRSGDHIIKLTLSHAIAQSTKLSRFEKRITPILGTVSKLPKRLALYGTLGLKREQLLK 480

Query: 481 KSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYTAMREYLEIDPRVQVLNDRCKVFL 540
           KSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYTAMREYLEIDPRVQVLNDRCKVFL
Sbjct: 481 KSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYTAMREYLEIDPRVQVLNDRCKVFL 540

Query: 541 EFFDICVNSIAEKDMARITWWXXXXXXXXXXXXTAEILARIFHYKKTLGTT 591
           EFFDICVNSIAEKDMARITWW            TAEILARIFHYKKTLGTT
Sbjct: 541 EFFDICVNSIAEKDMARITWWLVIVIFISVLVSTAEILARIFHYKKTLGTT 591

>Ecym_2598 Chr2 (1162883..1164691) [1809 bp, 602 aa] {ON} similar to
           Ashbya gossypii AFR265C
          Length = 602

 Score =  821 bits (2121), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/601 (70%), Positives = 473/601 (78%), Gaps = 29/601 (4%)

Query: 7   VQVGNNRTVPRNMMSRRSPSILVTDARSTKKRSSAPFAGNANTRRDKTGGSMPTVIENXX 66
           + +G++R   RNMMSRRSPSILVTD+RSTKKR SAPFAGNANTRRDK G   PTVIEN  
Sbjct: 1   MNIGSSRPQSRNMMSRRSPSILVTDSRSTKKRPSAPFAGNANTRRDKVGNIFPTVIENHS 60

Query: 67  XXXXXXXXXXEFMPKAGSGRTRQGKFSEVSMDNILSEMSDVPSGRRQERLSSSSFEYERR 126
                     +++PK  + R RQGKFS+VSMD+ILSEMSDVPSGRR+ERLSSSS++   R
Sbjct: 61  GKRIASLSGRDYIPKHSTRRARQGKFSDVSMDSILSEMSDVPSGRREERLSSSSYDSYDR 120

Query: 127 --PAHYNKTIRPLPSRTSKTSEKFVLIPDENVKRFAQGFHKRSASRVFSELSYGEHNTAG 184
             P  YNK I PLPSRTSKTSEKFVLIP+E  K+FAQGF+KRS     S+  + E  + G
Sbjct: 121 LRPLQYNKMINPLPSRTSKTSEKFVLIPEEGSKKFAQGFNKRSIYNADSDGIFKEARSHG 180

Query: 185 LPSITAYNVAEGFNLNLASQFLKETHNVSIRRYDEXXXXXXXXXXXXGKDGFRIRSNVSK 244
           LPS+ AYNVAEGFNL LAS+FLKETH+VS RRYDE            GK+GFR+RSN+SK
Sbjct: 181 LPSLMAYNVAEGFNLKLASKFLKETHDVSPRRYDECLYVPYCLPLLPGKNGFRLRSNISK 240

Query: 245 KMVGGKTLIDRLIDTSEQRDHHYEYYSGVETVEDMHNNFEINENGNGRDPDGLRNADHLA 304
           + +GGKTL+DRLIDTSEQRDHHYEYYSGVETVEDM NNFEI+E  N RD +GLR+ DHL+
Sbjct: 241 QTIGGKTLMDRLIDTSEQRDHHYEYYSGVETVEDMRNNFEISEISNSRDAEGLRSPDHLS 300

Query: 305 PLSSNMQSFDPSEPQFFAEELSEIGLHPIQDSSSEQHEREKVLDAQ-------------- 350
            +S N ++F+P EPQ+FAEE+S   +    DSSSE     K+  ++              
Sbjct: 301 GIS-NSEAFNPGEPQYFAEEMS---MEANSDSSSELALGNKIFKSKPADQHHQQQQQQQQ 356

Query: 351 ---------QHAEIFIFNYGVIVFWNFTELEEKNILGDIAFSGMKNMVTRPLDEQDIEIE 401
                    QHAEIFIFNYGV+VFWNFTE++EKNILGDIAFS MKNMV RPLDEQDIEIE
Sbjct: 357 QQQQQQQQQQHAEIFIFNYGVVVFWNFTEIQEKNILGDIAFSDMKNMVIRPLDEQDIEIE 416

Query: 402 QFHFEYDMDTERPRIFNDIITLRSGDHIIKLTLSHAIAQSTKLSRFEKRITPILGTVSKL 461
           QFHFEYDM+TERPRIFNDIITLRSGDHIIKLTLSHAIAQSTKLSRFEKRI+PILGTVSKL
Sbjct: 417 QFHFEYDMETERPRIFNDIITLRSGDHIIKLTLSHAIAQSTKLSRFEKRISPILGTVSKL 476

Query: 462 PKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYTAMRE 521
           PKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYTAMRE
Sbjct: 477 PKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYTAMRE 536

Query: 522 YLEIDPRVQVLNDRCKVFLEFFDICVNSIAEKDMARITWWXXXXXXXXXXXXTAEILARI 581
           YLEID RVQVLN+RCKVFLEFFDICVNSIAE+DMARITWW             AEIL R 
Sbjct: 537 YLEIDTRVQVLNERCKVFLEFFDICVNSIAERDMARITWWLVTVIFLSVLVSIAEILVRY 596

Query: 582 F 582
           F
Sbjct: 597 F 597

>SAKL0F00770g Chr6 complement(66976..68886) [1911 bp, 636 aa] {ON}
           similar to uniprot|P43620 Saccharomyces cerevisiae
           YFR048W RMD8 Cytosolic protein required for sporulation
          Length = 636

 Score =  690 bits (1781), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/629 (60%), Positives = 434/629 (68%), Gaps = 63/629 (10%)

Query: 12  NRTVPRNMMSRRSPSILVTDARSTKKRSSAPFAGNA---NTRRDKTG----------GSM 58
           N +  +  +SRRSPSILVTD+RS+K R SAPFAG+A      R  +G          GS 
Sbjct: 10  NESNVKGKLSRRSPSILVTDSRSSKNRMSAPFAGHAAGLKGGRSDSGNGGQGSSYARGST 69

Query: 59  PTVIENXXXXXXXXXXXXEF---MPKAGSGRTRQ--GKFSEVSMDNILSEMSDVPSGRRQ 113
           P   ++            +      +A S R+++  GKFS++S+DNILS+MSDVPSGRR+
Sbjct: 70  PNAKDSRSTRRLSFSISGDHSFSQQQALSKRSKKQHGKFSDISLDNILSDMSDVPSGRRE 129

Query: 114 ERLSSSSFEY-----ERRPAHYNKTIRPLPSRTSKTSEKFVLIPDENVKRFAQGF----- 163
           ERLS  S+E+       R   + K I PLP RTSKTSEK VLIPDE  K   Q F     
Sbjct: 130 ERLSLPSYEHLSAHGRPRVRQHTKMINPLPPRTSKTSEKLVLIPDEQEK---QNFLLQND 186

Query: 164 --HKRSASRVFSELSYGEHNTAGLPSITAYNVAEGFNLNLASQFLKETHNVSIRRYDEXX 221
                S++R + E    EH    L  ITAYNVA+G +L L SQFL+ETH+VS R YDE  
Sbjct: 187 KRRSSSSARSYGEKMSKEHRDRILSRITAYNVADGLSLKLVSQFLRETHDVSPRLYDECL 246

Query: 222 XXXXXXXXXXGKDGFRIRSNVSKKMVGGKTLIDRLIDTSEQRDHHYEYYSGVETVEDMHN 281
                     GKDGFRI+SN+SKK VGGKTLIDRLIDTSEQRDHHYEYYSGVET+EDMHN
Sbjct: 247 YVPYCLPLLPGKDGFRIKSNISKKTVGGKTLIDRLIDTSEQRDHHYEYYSGVETMEDMHN 306

Query: 282 NFEINENG-NGRD-PDGLRNADHLAPLSSNMQSFDPSEPQFFAEEL-------------- 325
           N+EI+E G N  D  D     DHL   S++  SFDPSEPQ+FAEE               
Sbjct: 307 NYEIDEGGANDADRVDSTSVPDHLPNPSTSTASFDPSEPQYFAEETPLEQERREREEHLQ 366

Query: 326 --------SEIGLHPIQDSSSEQHEREKVLDAQQHAEIFIFNYGVIVFWNFTELEEKNIL 377
                   +  G  P +D+ S        L  QQHAEIFIF YGVIVFWNFTE++EKNIL
Sbjct: 367 IISTNSSTAPSGKQPTKDTKSRD------LSKQQHAEIFIFGYGVIVFWNFTEIQEKNIL 420

Query: 378 GDIAFSGMKNMVTRPLDEQDIEIEQFHFEYDMDTERPRIFNDIITLRSGDHIIKLTLSHA 437
           GDIAF+  K++V RPLDEQDIE EQFHFEYDMDTERPRIFNDIITLRSGDHIIKLTLSHA
Sbjct: 421 GDIAFADYKSLVIRPLDEQDIETEQFHFEYDMDTERPRIFNDIITLRSGDHIIKLTLSHA 480

Query: 438 IAQSTKLSRFEKRITPILGTVSKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSS 497
           IAQSTKLSRFE RI+PILGTVSKLPKRLAL+GTLGLKREQLLKKSGKLFKLRVDVNLSSS
Sbjct: 481 IAQSTKLSRFESRISPILGTVSKLPKRLALHGTLGLKREQLLKKSGKLFKLRVDVNLSSS 540

Query: 498 VLDTPEFFWSFEPSLHPLYTAMREYLEIDPRVQVLNDRCKVFLEFFDICVNSIAEKDMAR 557
           +LDTP+FFWS EPSLHPLY AMREYLEID RVQVLNDRCKVFLEFFDICV+S+AE++MAR
Sbjct: 541 ILDTPDFFWSLEPSLHPLYLAMREYLEIDQRVQVLNDRCKVFLEFFDICVDSVAERNMAR 600

Query: 558 ITWWXXXXXXXXXXXXTAEILARIFHYKK 586
           ITWW             AEIL R F  KK
Sbjct: 601 ITWWFIAVIFVSVLVSIAEILVRYFIIKK 629

>KLTH0G00704g Chr7 complement(47865..49712) [1848 bp, 615 aa] {ON}
           similar to uniprot|P43620 Saccharomyces cerevisiae
           YFR048W RMD8 Cytosolic protein required for sporulation
          Length = 615

 Score =  680 bits (1755), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/604 (61%), Positives = 425/604 (70%), Gaps = 49/604 (8%)

Query: 17  RNMMSRRSPSILVTDARSTKKRSSAPFAGNA------NTRRDKTGGSMPTVIENXXXXXX 70
           R  MSRRSPSILVTDARS+KKR  APFAG+A         R+K+         +      
Sbjct: 14  RTSMSRRSPSILVTDARSSKKRIGAPFAGHAAGLRGGRAAREKSDTYQGFSASSRGSMRG 73

Query: 71  XXXXXXEFMP--KAGSGRTRQGKFSEVSMDNILSEMSDVPSGRRQERLSSSS-----FEY 123
                 +  P  ++ +   +QGKFS++S+DNILS++SDVPSGRR+ERLS SS     F +
Sbjct: 74  NSASGSDLGPMRRSRAKLRQQGKFSDISIDNILSDVSDVPSGRREERLSISSHEMAPFAH 133

Query: 124 ERRPAHYNKTIRPLPSRTSKTSEKFVLIP-DENVKRFAQGFHKRSASRVFSELSYGEHNT 182
              P  Y K I PLP RTSKTS+K VLIP D + K  A    +R        L Y  H+ 
Sbjct: 134 HSSPGQYTKLINPLPPRTSKTSKKLVLIPEDSDRKNNALQMERRRP------LKYNRHDP 187

Query: 183 AG-------LPSITAYNVAEGFNLNLASQFLKETHNVSIRRYDEXXXXXXXXXXXXGKDG 235
            G       +  ITAYNVAEGF ++  S FL+ TH+VS R YDE            GKDG
Sbjct: 188 DGQENYDEEMSRITAYNVAEGFEMSSTSDFLRYTHDVSPRLYDECLYVPYCLPLLPGKDG 247

Query: 236 FRIRSNVSKKMVGGKTLIDRLIDTSEQRDHHYEYYSGVETVEDMHNNFEINENGNGRDP- 294
           FRI+SNVSKK +GGKTLIDRLID SEQRDHHYEYYSGVETVEDM+NNFE+++   G+D  
Sbjct: 248 FRIKSNVSKKTIGGKTLIDRLIDKSEQRDHHYEYYSGVETVEDMNNNFELSDTA-GKDNE 306

Query: 295 --DGLRNADHLAPLSSN-MQSFDPSEPQFFAEE---------LSEIG---LHPIQDSSS- 338
             D L   DHL   SSN   SFDPSEPQFFAEE         +S +G    +P  +S S 
Sbjct: 307 RNDSLPTPDHLPNNSSNNTASFDPSEPQFFAEEGRDTDQSKNISAVGNRSQNPYMESQSL 366

Query: 339 EQHEREKVLDAQQHAEIFIFNYGVIVFWNFTELEEKNILGDIAFSGMKNMVTRPLDEQDI 398
           E +   K    QQHAEIFIF+YGV+VFWNFTE++EKNILGDIAF+   NM+ RPLDEQDI
Sbjct: 367 ENYGSSK----QQHAEIFIFSYGVVVFWNFTEIQEKNILGDIAFAEHDNMIIRPLDEQDI 422

Query: 399 EIEQFHFEYDMDTERPRIFNDIITLRSGDHIIKLTLSHAIAQSTKLSRFEKRITPILGTV 458
           E EQFHFEYDM+ ERPRIFNDI+TLRSGDHIIKLTLSH+IAQSTKLSRFE RI+PILGTV
Sbjct: 423 ETEQFHFEYDMNVERPRIFNDIVTLRSGDHIIKLTLSHSIAQSTKLSRFESRISPILGTV 482

Query: 459 SKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYTA 518
           SKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLY A
Sbjct: 483 SKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYLA 542

Query: 519 MREYLEIDPRVQVLNDRCKVFLEFFDICVNSIAEKDMARITWWXXXXXXXXXXXXTAEIL 578
           MREYLEID RVQVLNDRCKVFLEFFDICV+S+AE++MARITWW              EI+
Sbjct: 543 MREYLEIDQRVQVLNDRCKVFLEFFDICVDSVAERNMARITWWFIAVIFVSVLVSICEII 602

Query: 579 ARIF 582
            R F
Sbjct: 603 VRSF 606

>Kwal_47.19268 s47 (1163922..1165772) [1851 bp, 616 aa] {ON} YFR048W
           - Hypothetical ORF [contig 344] FULL
          Length = 616

 Score =  677 bits (1747), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/614 (61%), Positives = 440/614 (71%), Gaps = 39/614 (6%)

Query: 1   MAGDDMVQVGNNRTVPRNMMSRRSPSILVTDARSTKKRSSAPFAGNA-------NTRRDK 53
           M   + VQ G  R   R +MSRRSPSILVTDARS + R+ APFAG+A       +++  K
Sbjct: 1   MQNPEDVQEGPGR---RTVMSRRSPSILVTDARSNRNRNGAPFAGHAAGLQGGRSSKEGK 57

Query: 54  TGGSMPT--VIENXXXXXXXXXXXXEFMP--KAGSGRTRQGKFSEVSMDNILSEMSDVPS 109
              S  T  V               + MP  ++ +   +QGKFS++S+DNILS++SDVPS
Sbjct: 58  DALSQRTAHVSRTSMRRSSSSGSSSDLMPLRRSKAKLRQQGKFSDISVDNILSDISDVPS 117

Query: 110 GRRQERLSSSSFEYER----RPAHYNKTIRPLPSRTSKTSEKFVLIPDENVKR--FAQGF 163
           GRR+ERLS+SS E+      R A Y K I PLPSRTSKTS+K VLIP+E  ++  F Q  
Sbjct: 118 GRREERLSTSSQEWSSSRFGRSAQYTKLINPLPSRTSKTSKKLVLIPEELDRKNGFVQ-M 176

Query: 164 HKRSASRVFSELSYGEHNTAGLPSITAYNVAEGFNLNLASQFLKETHNVSIRRYDEXXXX 223
            +R   +  ++    E+ +  L  ITAYNVAEGF+L+L S+FL+ TH+VS R YDE    
Sbjct: 177 ERRWPRKNKNDFENRENPSEELSRITAYNVAEGFDLDLVSKFLRNTHDVSPRLYDECLYV 236

Query: 224 XXXXXXXXGKDGFRIRSNVSKKMVGGKTLIDRLIDTSEQRDHHYEYYSGVETVEDMHNNF 283
                   GKDGFR++SNVSKK +GGKTLIDRLID SEQRDHHYEYYSGVETVEDM+NN+
Sbjct: 237 PYCLPLLPGKDGFRLKSNVSKKTIGGKTLIDRLIDKSEQRDHHYEYYSGVETVEDMNNNY 296

Query: 284 EINENGNGRDPDG---LRNADHL-APLSSNMQSFDPSEPQFFAEELSEIGLHPIQDSSSE 339
           E+NE  N +DPD    +   DHL + ++SN  SFDPSEPQFFAE     G HP + S+  
Sbjct: 297 ELNEVTN-KDPDRNDVVPTPDHLPSVINSNTASFDPSEPQFFAE--GAWGEHPAESSNDR 353

Query: 340 Q-HER-----EKVLDA-----QQHAEIFIFNYGVIVFWNFTELEEKNILGDIAFSGMKNM 388
             H R        LD      Q+HAEIFIF YGV+VFWNFTE++EKNILGDIAF+   N+
Sbjct: 354 PPHSRTSSPENNSLDGYESSKQRHAEIFIFRYGVVVFWNFTEIQEKNILGDIAFADYDNL 413

Query: 389 VTRPLDEQDIEIEQFHFEYDMDTERPRIFNDIITLRSGDHIIKLTLSHAIAQSTKLSRFE 448
           V RPLDEQDIE E FHF+YDM+ ERPRIFNDIITLRSGDHIIKLTLSH+IAQSTKLSRFE
Sbjct: 414 VIRPLDEQDIETEHFHFDYDMEVERPRIFNDIITLRSGDHIIKLTLSHSIAQSTKLSRFE 473

Query: 449 KRITPILGTVSKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSF 508
            RI+PILGTVSKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSF
Sbjct: 474 SRISPILGTVSKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSF 533

Query: 509 EPSLHPLYTAMREYLEIDPRVQVLNDRCKVFLEFFDICVNSIAEKDMARITWWXXXXXXX 568
           EPSLHPLY AMREYLEID R QVLNDRCKVFLEFFDICV+S+AE++MARITWW       
Sbjct: 534 EPSLHPLYLAMREYLEIDQRAQVLNDRCKVFLEFFDICVDSVAERNMARITWWFIAVIFV 593

Query: 569 XXXXXTAEILARIF 582
                  EI+ R F
Sbjct: 594 SVLVSIGEIVVRSF 607

>TDEL0D06360 Chr4 (1142081..1143838) [1758 bp, 585 aa] {ON}
           Anc_3.568 YFR048W
          Length = 585

 Score =  665 bits (1716), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/588 (60%), Positives = 417/588 (70%), Gaps = 53/588 (9%)

Query: 20  MSRRSPSILVTDARSTKKRSSAPFAGNANTRRDKTGGSMPTVIENXXXXXXXXXXXXEFM 79
           ++RRSPSILVTD+RS++KR SAPFAG+A   R +    +P +                F 
Sbjct: 18  LARRSPSILVTDSRSSRKRMSAPFAGHAAGVRSR--DELPNM-----------KSSGSFG 64

Query: 80  PKAGSGRTRQGKFSEVSMDNILSEMSDVPSGRRQERLSSSSFEY-----ERRPAHYNKTI 134
            K  + R   G+FSE+S+DNILSEMSDVPSGRR+ERLSSSS +      + R  +Y+K I
Sbjct: 65  NKVSNKRRTSGRFSEISIDNILSEMSDVPSGRREERLSSSSADRHYASDKPRSLNYSKMI 124

Query: 135 RPLPSRTSKTSEKFVLIPDENVKR--FAQGF-HKRSASRV--FSELSYGEHNTAGLPSIT 189
            PLP+RTSKTS+K VLIP+E   R   A  F  KRS + +  + E +        L  IT
Sbjct: 125 NPLPARTSKTSQKLVLIPEEADGRESSANAFSRKRSTTSMKGYGESARHAKKDEKLARIT 184

Query: 190 AYNVAEGFNLNLASQFLKETHNVSIRRYDEXXXXXXXXXXXXGKDGFRIRSNVSKKMVGG 249
           AYNVAEGFNL L S+FLK TH VS R YDE            GKDGFR++SN+SKK+VGG
Sbjct: 185 AYNVAEGFNLKLMSKFLKCTHEVSPRMYDECLYVAYTLPLLLGKDGFRVKSNISKKVVGG 244

Query: 250 KTLIDRLIDTSEQRDHHYEYYSGVETVEDMHNNFEINENGN--GRDPDGLRNADHLAPLS 307
           KTLI++LIDTSEQRDHHYEYYSGVET+ED  N FE++        DP+ + N  HL    
Sbjct: 245 KTLIEKLIDTSEQRDHHYEYYSGVETLEDARNAFELDPTAVLVENDPNIIPN--HLPNPP 302

Query: 308 SNMQSFDPSEPQFFAEELSEIGLHPIQDSSSEQHEREK---------------VLDAQQH 352
            N+ SFDPSEPQFFAEE           + +EQ  RE+                    QH
Sbjct: 303 GNLDSFDPSEPQFFAEE-----------TPTEQKLRERREQFNMPANNKRHGTTSSGDQH 351

Query: 353 AEIFIFNYGVIVFWNFTELEEKNILGDIAFSGMKNMVTRPLDEQDIEIEQFHFEYDMDTE 412
           AEIFIF YGVIVFWNFTE++EKNILGDIAF+  KN+V RPLDEQDIE EQFHF+YD DTE
Sbjct: 352 AEIFIFRYGVIVFWNFTEIQEKNILGDIAFADYKNLVIRPLDEQDIEREQFHFDYDKDTE 411

Query: 413 RPRIFNDIITLRSGDHIIKLTLSHAIAQSTKLSRFEKRITPILGTVSKLPKRLALYGTLG 472
           RPRIFNDI+TLRSGDHII+LTLSHAIAQS+KLSRFE RI+PIL  V+KLPKRLALYGTLG
Sbjct: 412 RPRIFNDIVTLRSGDHIIELTLSHAIAQSSKLSRFESRISPILTAVTKLPKRLALYGTLG 471

Query: 473 LKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYTAMREYLEIDPRVQVL 532
           +KREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLY AMREYLEID RVQVL
Sbjct: 472 MKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYIAMREYLEIDQRVQVL 531

Query: 533 NDRCKVFLEFFDICVNSIAEKDMARITWWXXXXXXXXXXXXTAEILAR 580
           NDRCKVFLEFFDICV+S+A++++AR+TWW             +EIL R
Sbjct: 532 NDRCKVFLEFFDICVDSVADRNIARVTWWFIIAIIVGVVFSLSEILVR 579

>KLLA0A00715g Chr1 complement(69861..71636) [1776 bp, 591 aa] {ON}
           weakly similar to uniprot|P43620 Saccharomyces
           cerevisiae YFR048W RMD8 Cytosolic protein required for
           sporulation
          Length = 591

 Score =  659 bits (1699), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/578 (60%), Positives = 408/578 (70%), Gaps = 24/578 (4%)

Query: 27  ILVTDARSTKKRSSAPFAGNANTRRDKTGGSMPTVIENXXXXXXXXXXXXEFMPKAGSGR 86
           ILVTDARS K R SAPFAG+A   R+ +                            G  +
Sbjct: 24  ILVTDARSNKNRPSAPFAGHAAGMRNVSSVPRSAASSGGKTDSKGSRVRRRGYDMHGDKK 83

Query: 87  TRQGKFSEVSMDNILSEMSDVPSGRRQERLSSSSFEY----ERRPAHYNKTIRPLPSRTS 142
           +   +FS+VSMDN+L ++SDVPSGRRQERLS+SS++      +R  H  K I PLP+RTS
Sbjct: 84  SISSRFSDVSMDNLLLDVSDVPSGRRQERLSTSSYDMFPRNRQRGTHITKMINPLPTRTS 143

Query: 143 KTSEKFVLIPDE-----NVKRFAQGFHKRSASRVFSELSYGEHNTAGLPSITAYNVAEGF 197
           KTS+K VLIPDE     N+ +F +  +K   ++  S+    +     LP ITAYNVAEGF
Sbjct: 144 KTSQKLVLIPDEAHDSRNINQFRKRANKTQRAKSSSKTKMDKE--VDLPRITAYNVAEGF 201

Query: 198 NLNLASQFLKETHNVSIRRYDEXXXXXXXXXXXXGKDGFRIRSNVSKKMVGGKTLIDRLI 257
           NL+L S F+K+TH+V  R YDE            GKDGFRI+SN+SKK  GGK++ID LI
Sbjct: 202 NLSLTSTFMKQTHDVLPRLYDECLYVPYTLPLLPGKDGFRIKSNISKKTQGGKSIIDYLI 261

Query: 258 DTSEQRDHHYEYYSGVETVEDMHNNFEINENGNGRDPDGLRNADHLA-PLSSNMQSFDPS 316
           DTSE+RDHHYEY+SGVET+ED++NN+E++E G   + +     DHL  P  +   SFDPS
Sbjct: 262 DTSERRDHHYEYFSGVETLEDVNNNYELDEGGVTNNLNAENTPDHLPNPPVNTSVSFDPS 321

Query: 317 EPQFFAEELSEIG----LHPIQDSSSEQHEREKVLDAQQHAEIFIFNYGVIVFWNFTELE 372
           EPQ+FAEE +        + I   +S        L  QQHAEIFIF+YGV+VFWNFTE++
Sbjct: 322 EPQYFAEENNAEAELEAFNEINGKTS--------LFQQQHAEIFIFSYGVVVFWNFTEIQ 373

Query: 373 EKNILGDIAFSGMKNMVTRPLDEQDIEIEQFHFEYDMDTERPRIFNDIITLRSGDHIIKL 432
           EKNILGDI+FS  KNMV +PLDEQDIEIE FHFEYDMDTERPRIFNDI+TLRSGDH+  L
Sbjct: 374 EKNILGDISFSSYKNMVLKPLDEQDIEIESFHFEYDMDTERPRIFNDIVTLRSGDHLTAL 433

Query: 433 TLSHAIAQSTKLSRFEKRITPILGTVSKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDV 492
           TLSHAIAQS KLSRFE RI PI G+VSKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDV
Sbjct: 434 TLSHAIAQSVKLSRFEARIVPIFGSVSKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDV 493

Query: 493 NLSSSVLDTPEFFWSFEPSLHPLYTAMREYLEIDPRVQVLNDRCKVFLEFFDICVNSIAE 552
           NLSSSVLDTPEFFWSFEPSLH LY AMREYLEIDPRVQVLNDRCKVFLEFFDICV+SIAE
Sbjct: 494 NLSSSVLDTPEFFWSFEPSLHSLYQAMREYLEIDPRVQVLNDRCKVFLEFFDICVDSIAE 553

Query: 553 KDMARITWWXXXXXXXXXXXXTAEILARIFHYKKTLGT 590
           ++MARITWW              EIL R F  KK  GT
Sbjct: 554 RNMARITWWFITIIFISVLISIVEILVRYFIIKKHTGT 591

>ZYRO0E09548g Chr5 (760326..762104) [1779 bp, 592 aa] {ON} similar
           to uniprot|P43620 Saccharomyces cerevisiae YFR048W RMD8
           Cytosolic protein required for sporulation
          Length = 592

 Score =  653 bits (1685), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/585 (59%), Positives = 408/585 (69%), Gaps = 30/585 (5%)

Query: 20  MSRRSPSILVTDARSTKKRSSAPFAGNANTRRDKTGGSMPTVIENXXXXXXXXXXXXEFM 79
           MS+RSPSILVTD+RS  KR SAPFAG+A   + +         E+               
Sbjct: 20  MSKRSPSILVTDSRSAGKRMSAPFAGHAAGVKSR---------EDHVADRNRLAPYPSNG 70

Query: 80  PKAGSGRTR-QGKFSEVSMDNILSEMSDVPSGRRQERLSSSSFEY-----ERRPAHYNKT 133
            K+ S R R  G+FS++S+DNILS+ SDVPSGRR+ER SSSS +        RP  Y K 
Sbjct: 71  SKSSSVRRRPSGRFSDISIDNILSDASDVPSGRREERQSSSSLDRFFPSGPLRPLSYTKM 130

Query: 134 IRPLPSRTSKTSEKFVLIPDENVKRFAQ--GFHKRSASRVFSELSYGEHNTAG--LPSIT 189
           + PLPSRTSKTS+K VLIP+E   R +   G+  + A+   +          G  L  IT
Sbjct: 131 LNPLPSRTSKTSQKLVLIPEEVAGRESSTTGYGPKRAAASLNATGKRSQGRRGRKLSRIT 190

Query: 190 AYNVAEGFNLNLASQFLKETHNVSIRRYDEXXXXXXXXXXXXGKDGFRIRSNVSKKMVGG 249
           AYNVAEGFNL   + FLK TH VS R YDE            GKDGFR+RSNVSKK++GG
Sbjct: 191 AYNVAEGFNLEYMADFLKATHEVSPRVYDECLYVAYTLPLLLGKDGFRVRSNVSKKVLGG 250

Query: 250 KTLIDRLIDTSEQRDHHYEYYSGVETVEDMHNNFEINENGNGRDPDGLRNADHLAPLSSN 309
           KTLID+LID SEQRDHHYEYYSGVET+ED+ NNFE++ NGN    D     DHL     N
Sbjct: 251 KTLIDKLIDNSEQRDHHYEYYSGVETIEDVDNNFELDSNGNY---DADITPDHLPNAMGN 307

Query: 310 MQSFDPSEPQFFAEELSEIGLHPIQ------DSSSEQHEREKVLDAQQHAEIFIFNYGVI 363
             +F+PSEPQFFAEE         +      DSSS+  +     D+ QHAEIFIF YGVI
Sbjct: 308 QDTFNPSEPQFFAEETPVEQERRERRENFNFDSSSKNDDVGN--DSDQHAEIFIFRYGVI 365

Query: 364 VFWNFTELEEKNILGDIAFSGMKNMVTRPLDEQDIEIEQFHFEYDMDTERPRIFNDIITL 423
           VFWNFTE++EKNILGDIAF+  KN+V RPLDE DIE EQFHF+YD D ERPRIFNDI+TL
Sbjct: 366 VFWNFTEIQEKNILGDIAFADFKNLVIRPLDEHDIEREQFHFDYDKDIERPRIFNDIVTL 425

Query: 424 RSGDHIIKLTLSHAIAQSTKLSRFEKRITPILGTVSKLPKRLALYGTLGLKREQLLKKSG 483
           RSGDHII+LTLSHAIAQS+KLSRFE RITPIL + +KLPKRLAL+GTLG+KREQLLKKSG
Sbjct: 426 RSGDHIIELTLSHAIAQSSKLSRFESRITPILTSATKLPKRLALFGTLGMKREQLLKKSG 485

Query: 484 KLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYTAMREYLEIDPRVQVLNDRCKVFLEFF 543
           KLFKLRVDVNLSSS+LDTPEFFWSFEPSLHPLY AMREYLEID RVQV+NDR KV+LEFF
Sbjct: 486 KLFKLRVDVNLSSSILDTPEFFWSFEPSLHPLYIAMREYLEIDQRVQVINDRAKVYLEFF 545

Query: 544 DICVNSIAEKDMARITWWXXXXXXXXXXXXTAEILARIFHYKKTL 588
           D+CV+S+AE++MAR+TWW             AEIL R    +  L
Sbjct: 546 DVCVDSVAERNMARVTWWFIFVIVLGVLFSVAEILVRYVMIRNRL 590

>Kpol_507.9 s507 complement(53819..55630) [1812 bp, 603 aa] {ON}
           complement(53819..55630) [1812 nt, 604 aa]
          Length = 603

 Score =  641 bits (1654), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/584 (60%), Positives = 419/584 (71%), Gaps = 29/584 (4%)

Query: 20  MSRRSPSILVTDARSTKKRSSAPFAGNANTRRDKTG-GSMPT-VIENXXXXXXXXXXXXE 77
           MS+RSPSILVTD+RS K R SAPFA +A   R +    S+P+  I +            +
Sbjct: 19  MSKRSPSILVTDSRSNKNRLSAPFARHAAGARSRESLSSVPSNSIGSSSYVPYLNSNKNQ 78

Query: 78  FMPKAGSGRTRQGKFSEVSMDNILSEMSDVPSGRRQERLSSSSFE----YER-RPAHYNK 132
                 +   + G+FS++S+DNILS+ SDVPSGRR+ER SSSS++    Y++ R ++Y K
Sbjct: 79  VRSVNRAASPQFGRFSDISIDNILSDSSDVPSGRREERRSSSSWDRFSIYDKLRTSNYGK 138

Query: 133 TIRPLPSRTSKTSEKFVLIPD--ENVKRFAQGFHKRSASRVFSELS---YGEHN-TAGLP 186
            +  +P RTSKTS K VLIP+  E  K +      R+ S  +  L    + +H+    LP
Sbjct: 139 GLSHIPPRTSKTSHKLVLIPENSEIPKDYMPNNFLRNRSSSYKNLQSEQFQQHDRDEILP 198

Query: 187 SITAYNVAEGFNLNLASQFLKETHNVSIRRYDEXXXXXXXXXXXXGKDGFRIRSNVSKKM 246
            ITAYNVAEGFNL+L S+FLK TH VS R+Y E            GKDG+RI+SN+SKK+
Sbjct: 199 RITAYNVAEGFNLDLMSKFLKSTHEVSPRQYAECLYVAYTLPLLPGKDGYRIKSNISKKV 258

Query: 247 VGGKTLIDRLIDTSEQRDHHYEYYSGVETVEDMHNNFEINENGNGRDPDGLRNADHLAPL 306
           VGGKTLID LIDTSEQRDHHYEYYSGVE +ED +NN+E+N     ++P+     DHL   
Sbjct: 259 VGGKTLIDELIDTSEQRDHHYEYYSGVEILEDANNNYELNATTPSQEPEVTVIPDHLPNP 318

Query: 307 SSNMQSFDPSEPQFFAEELSEIGLHPIQDSSSEQHEREK----------VLDAQQHAEIF 356
           ++N  SFDPSEPQFFAEE       PI+    E+ E+ K          + D  QHAEIF
Sbjct: 319 TNNSDSFDPSEPQFFAEET------PIEQKLRERKEQIKMNSDSKPMSLIRDEDQHAEIF 372

Query: 357 IFNYGVIVFWNFTELEEKNILGDIAFSGMKNMVTRPLDEQDIEIEQFHFEYDMDTERPRI 416
           IF+YGVIVFWNFTE +EKNILGDIAFS  KN+V R LDEQDIE EQFHFEYD + ERPRI
Sbjct: 373 IFHYGVIVFWNFTEQQEKNILGDIAFSEYKNLVIRALDEQDIETEQFHFEYDKENERPRI 432

Query: 417 FNDIITLRSGDHIIKLTLSHAIAQSTKLSRFEKRITPILGTVSKLPKRLALYGTLGLKRE 476
           FNDIITLRSGDHII+LTLSHAIAQS+KLSRFE R+TPIL +++KLP+RLALYGTLGLKRE
Sbjct: 433 FNDIITLRSGDHIIELTLSHAIAQSSKLSRFESRVTPILSSITKLPRRLALYGTLGLKRE 492

Query: 477 QLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYTAMREYLEIDPRVQVLNDRC 536
           QLLK+SGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLY AMREYLEID RVQVLNDRC
Sbjct: 493 QLLKRSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYVAMREYLEIDQRVQVLNDRC 552

Query: 537 KVFLEFFDICVNSIAEKDMARITWWXXXXXXXXXXXXTAEILAR 580
           KVFLEFFDICV+S+AE++MAR+TWW             AEIL R
Sbjct: 553 KVFLEFFDICVDSVAERNMARVTWWFIMMIIVSVLFSLAEILIR 596

>NCAS0F03970 Chr6 (796049..797842) [1794 bp, 597 aa] {ON} Anc_3.568
           YFR048W
          Length = 597

 Score =  638 bits (1646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/605 (57%), Positives = 422/605 (69%), Gaps = 58/605 (9%)

Query: 9   VGNNRTVPRNMMSRRSPSILVTDARSTKKRSSAPFAGNANTRRDKTGGSMPTVIENXXXX 68
           +  +RT P   MS+RSPSILVTD+RS+K R SAPFAG+A        GS+          
Sbjct: 10  LSTSRTTP---MSKRSPSILVTDSRSSKHRMSAPFAGHA-------AGSL-------NQP 52

Query: 69  XXXXXXXXEFMPKAGSG------RTRQGKFSEVSMDNILSEMSDVPSGRRQERLSSSS-- 120
                      P + +G      +   G+F +VS+DNIL + SDVPSGRR+ERLS+SS  
Sbjct: 53  KPFNRGIPHHTPYSSTGIHSQLRKKSSGRFGDVSIDNILLDSSDVPSGRREERLSNSSQE 112

Query: 121 ---FEYER-RPAHYNKTIRPLPSRTSKTSEKFVLIPDEN-----------VKRFAQGFHK 165
              F  +R R +++ ++I PLPSRTSKTS+K VLIP++            + R       
Sbjct: 113 RFPFASDRLRSSYFKRSINPLPSRTSKTSQKLVLIPEDEPIGAEVGSSNVLDRKRHATTP 172

Query: 166 RSASRVFSELSYGEHNTAGLPSITAYNVAEGFNLNLASQFLKETHNVSIRRYDEXXXXXX 225
           RS  R   E SY E   + L  ITAYNVA+GFNL L S+FL +TH VS R YDE      
Sbjct: 173 RSPERY--ESSYKE---SKLARITAYNVADGFNLKLLSKFLGDTHEVSPRMYDECLYIAY 227

Query: 226 XXXXXXGKDGFRIRSNVSKKMVGGKTLIDRLIDTSEQRDHHYEYYSGVETVEDMHNNFEI 285
                 GK+GFRI+SN+SKK VGG+TLID+LIDTSEQRDHHYEY+SGVET+ED HNN+E+
Sbjct: 228 TLPLLPGKEGFRIKSNISKKTVGGQTLIDKLIDTSEQRDHHYEYFSGVETLEDAHNNYEL 287

Query: 286 NENG---NGRDPDGLRNADHLAPLSSNMQSFDPSEPQFFAEELSEIGLHPIQDSSSEQHE 342
           + N    +  DP+ +    HL   ++N  SF+PSEPQFFAEE S       +     +++
Sbjct: 288 DSNAIPIDTTDPNLI--PSHLPIPTTNPDSFNPSEPQFFAEE-SHNDQELRKGDGRLKNQ 344

Query: 343 REKVLD-------AQQHAEIFIFNYGVIVFWNFTELEEKNILGDIAFSGMKNMVTRPLDE 395
           + K ++         QHAE+FIF+YGVIVFWNFTE+EEKN+LGDIAFS  KN+V RPLDE
Sbjct: 345 KNKSINLATTIPSEDQHAELFIFHYGVIVFWNFTEMEEKNLLGDIAFSDYKNLVIRPLDE 404

Query: 396 QDIEIEQFHFEYDMDTERPRIFNDIITLRSGDHIIKLTLSHAIAQSTKLSRFEKRITPIL 455
           QDIE EQFHFEYD DTERPRIFNDI+TLRSGDH+I+LTLSHAIAQS+KLSRFE RITPIL
Sbjct: 405 QDIETEQFHFEYDKDTERPRIFNDILTLRSGDHMIELTLSHAIAQSSKLSRFESRITPIL 464

Query: 456 GTVSKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPL 515
            +V+KLPKRLALYGTLGL+R+QLLK+SGKLFKLRVDVNLSSSVLD+PEFFWS EPSLHPL
Sbjct: 465 ASVTKLPKRLALYGTLGLQRKQLLKRSGKLFKLRVDVNLSSSVLDSPEFFWSSEPSLHPL 524

Query: 516 YTAMREYLEIDPRVQVLNDRCKVFLEFFDICVNSIAEKDMARITWWXXXXXXXXXXXXTA 575
           Y AMREYLEID RVQVLNDRCKVFLEFFDICV+S+AE+++AR+TWW              
Sbjct: 525 YIAMREYLEIDQRVQVLNDRCKVFLEFFDICVDSVAERNIARVTWWFIIVIIVGVIFSLT 584

Query: 576 EILAR 580
           EI  R
Sbjct: 585 EIFVR 589

>CAGL0C01969g Chr3 complement(206652..208511) [1860 bp, 619 aa] {ON}
           similar to uniprot|P43620 Saccharomyces cerevisiae
           YFR048w
          Length = 619

 Score =  630 bits (1625), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/583 (59%), Positives = 403/583 (69%), Gaps = 48/583 (8%)

Query: 20  MSRRSPSILVTDARSTKKRSSAPFAGNANTRRD-------------KTGGSMPTVIENXX 66
           MS+RSPSILVTDAR++K R SAPFAG+A   R              + G  +   +    
Sbjct: 16  MSKRSPSILVTDARTSKNRRSAPFAGHAAGVRSASSSTGSGSSASAERGAELMKYVNGNL 75

Query: 67  XXXXXXXXXXEFMPKAGSG--------------RTRQGKFSEVSMDNILSEMSDVPSGRR 112
                          +  G              R   G+FSE+S+DNILS+ SDVPSGRR
Sbjct: 76  RGSRGQYAATGGRSSSNHGTGDLSNRGTSSPPRRRASGRFSEISIDNILSDRSDVPSGRR 135

Query: 113 QERLSSSSFE----YER-RPAHYNKTIRPLPSRTSKTSEKFVLIPDENVKRFAQGFHKRS 167
           +ER S+SSF+    Y+R  P    K I  LP RTSKTS+K VLIP++      +G  +R 
Sbjct: 136 EERGSNSSFDRSMIYDRLHPQPIRKMINTLPIRTSKTSQKLVLIPEDGSVPPTRGALERR 195

Query: 168 ASRVFSELSYGEHNTAG-----LPSITAYNVAEGFNLNLASQFLKETHNVSIRRYDEXXX 222
               F + +  E          L  ITAYN+AEGFNL L S+FLK TH V  R YDE   
Sbjct: 196 EQPTFVKRNPTERIPKSSRDHRLSRITAYNLAEGFNLKLLSKFLKSTHEVKPRLYDECLY 255

Query: 223 XXXXXXXXXGKDGFRIRSNVSKKMVGGKTLIDRLIDTSEQRDHHYEYYSGVETVEDMHNN 282
                    GKDGFR++SNVSKK+VGGKTLI++LIDTSEQRDHHYEYYSGVET+ED +NN
Sbjct: 256 IAYTLPLLPGKDGFRLKSNVSKKVVGGKTLIEKLIDTSEQRDHHYEYYSGVETLEDANNN 315

Query: 283 FEINENGNGRDPDGLRNADHLAPLSSNMQSFDPSEPQFFAEELSEIGLHPIQDSSSEQHE 342
           +E+       DP  + N ++    ++   SFDPSEPQ+FAEE  +  L   +  S   + 
Sbjct: 316 YEL-------DPTSVDNENNNNSNNNPADSFDPSEPQYFAEETPKEQLERERSESLHINP 368

Query: 343 REKVL----DAQQHAEIFIFNYGVIVFWNFTELEEKNILGDIAFSGMKNMVTRPLDEQDI 398
             K +    D  QHAEIF+F+YGVIVFWNFTE EEKN+LGDIAFS  KN+V RPLDEQDI
Sbjct: 369 GSKPIAVNADEDQHAEIFVFHYGVIVFWNFTEEEEKNLLGDIAFSDYKNLVIRPLDEQDI 428

Query: 399 EIEQFHFEYDMDTERPRIFNDIITLRSGDHIIKLTLSHAIAQSTKLSRFEKRITPILGTV 458
           EIEQFHFEYD DTERPRIFNDIITLRSGDHII+LTLSHAIAQS+KLSRFE RI+PIL TV
Sbjct: 429 EIEQFHFEYDKDTERPRIFNDIITLRSGDHIIELTLSHAIAQSSKLSRFESRISPILTTV 488

Query: 459 SKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYTA 518
           ++LPKRLALYGTLGLKREQL+KKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLY A
Sbjct: 489 TRLPKRLALYGTLGLKREQLIKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYVA 548

Query: 519 MREYLEIDPRVQVLNDRCKVFLEFFDICVNSIAEKDMARITWW 561
           MREYLEID RVQVLNDRC VFLEFFDICV+SIAE+++ R+TWW
Sbjct: 549 MREYLEIDQRVQVLNDRCMVFLEFFDICVDSIAERNIVRVTWW 591

>NDAI0B06280 Chr2 (1519871..1521688) [1818 bp, 605 aa] {ON}
           Anc_3.568
          Length = 605

 Score =  629 bits (1622), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/607 (56%), Positives = 416/607 (68%), Gaps = 52/607 (8%)

Query: 10  GNNRTVPRNMMSRRSPSILVTDARSTKKRSSAPFAGNANTRRDKTGGSMPTVIENXXXXX 69
           GN R  P   M++RSPSILVTD+R++K R SAPFAG+A    ++    +P    N     
Sbjct: 8   GNGRVRP---MAKRSPSILVTDSRTSKNRLSAPFAGHAAGVLNRDEHRLP---RNKSYRY 61

Query: 70  XXXXXXXEFMPKAGSGRTRQGKFSEVSMDNILSEMSDVPSGRRQERLSSSSFE------- 122
                  E   +  SG    G+FS+VS+DNILS+ SDVPSGRR+ERLS+SS E       
Sbjct: 62  NATNSNAELRGRHPSGGG--GRFSDVSIDNILSDSSDVPSGRREERLSNSSLERSPLVTD 119

Query: 123 -YERRPAHYNKTIRPLPSRTSKTSEKFVLIPDE--NVKR------FAQGFHKRSAS---R 170
               R  +  KTI PLPSRTSKTS++ VLIP+E  NV +       + G  ++  +   +
Sbjct: 120 RAHSRSQYQRKTINPLPSRTSKTSQRLVLIPEEGDNVSKDDIRGNISSGLDRKRHTPIPK 179

Query: 171 VFSELSYGEHNTAGLPSITAYNVAEGFNLNLASQFLKETHNVSIRRYDEXXXXXXXXXXX 230
              E    E  T  L  ITAYNVAEGFNL+L S+FL++TH VS R YDE           
Sbjct: 180 YNDEYYQPEPRTHKLARITAYNVAEGFNLSLLSKFLQDTHEVSPRMYDECLYVAYTLPLL 239

Query: 231 XGKDGFRIRSNVSKKMVGGKTLIDRLIDTSEQRDHHYEYYSGVETVEDMHNNFEINENGN 290
            GKDGFRI+SNVSKK VGG TLID+LIDTSEQRDHHYEY+SGVET+ED +NN+E+N    
Sbjct: 240 PGKDGFRIKSNVSKKFVGGMTLIDKLIDTSEQRDHHYEYFSGVETLEDANNNYELNPTSP 299

Query: 291 GRDPDGLRN---ADHLAPLSSNMQSFDPSEPQFFAEELSEIGLHPIQDSSSEQHEREKVL 347
             +   + N     HL    +N  +F+PSEPQFFAEE       PI+    EQ+ER  ++
Sbjct: 300 PME--NVENQPIPTHLPVPPTNPDAFNPSEPQFFAEET------PIEQKLREQNERLNIV 351

Query: 348 -------------DAQQHAEIFIFNYGVIVFWNFTELEEKNILGDIAFSGMK-NMVTRPL 393
                        +  QHAEIF+F+YGVIVFWNFTE++EKN+LGDI FS  + N+V RPL
Sbjct: 352 PTNIAMNSSQVAANGDQHAEIFVFHYGVIVFWNFTEVQEKNLLGDITFSYYRRNLVIRPL 411

Query: 394 DEQDIEIEQFHFEYDMDTERPRIFNDIITLRSGDHIIKLTLSHAIAQSTKLSRFEKRITP 453
           DEQDIE EQFHF YD +TERPRIFNDI+TLRSGDH+I+LTLSHAIAQS+KLSRFE RI+P
Sbjct: 412 DEQDIETEQFHFGYDKNTERPRIFNDIVTLRSGDHMIELTLSHAIAQSSKLSRFESRISP 471

Query: 454 ILGTVSKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLH 513
           +L +++KLPKRLALYGTLGLKR QLLKKSGKLFKLRVDVNLSSS+LD+PEFFWS EPSL 
Sbjct: 472 LLTSITKLPKRLALYGTLGLKRSQLLKKSGKLFKLRVDVNLSSSILDSPEFFWSTEPSLS 531

Query: 514 PLYTAMREYLEIDPRVQVLNDRCKVFLEFFDICVNSIAEKDMARITWWXXXXXXXXXXXX 573
           PLY AMREYLEID RVQVLNDRC VFLEFFDICV+S+AEK++AR TWW            
Sbjct: 532 PLYIAMREYLEIDQRVQVLNDRCIVFLEFFDICVDSVAEKNIARFTWWFVIAIIVGLFFS 591

Query: 574 TAEILAR 580
            +EI  R
Sbjct: 592 LSEIFVR 598

>TBLA0E00210 Chr5 complement(29729..31624) [1896 bp, 631 aa] {ON}
           Anc_3.568 YFR048W
          Length = 631

 Score =  624 bits (1609), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/611 (55%), Positives = 409/611 (66%), Gaps = 56/611 (9%)

Query: 20  MSRRSPSILVTDARSTKKRSSAPFAGNA--------NTRRD---KTGGSMPTV---IENX 65
           +S+RSPSILVTD RS + R SAPFAG+A          R++    +GG   T    + N 
Sbjct: 19  LSKRSPSILVTDYRSNRTRKSAPFAGHAADSNSNLEQVRKNLSSYSGGYKSTWNRNLSNN 78

Query: 66  XXXXXXXXXXXEFMPKA--------GSGRTRQGKFSEVSMDNILSEMSDVPSGRRQERLS 117
                      +   K+         S R  QG+FS++S+DNIL + S++PS RR+ER S
Sbjct: 79  SSAANGNVFGNKPFKKSFASVNNGRKSRRGSQGRFSDISIDNILQDTSEIPSARREERSS 138

Query: 118 SSSFEY------ERRPAHYN--KTIRPLPSRTSKTSEKFVLIPDENVKRFAQGFHKRSAS 169
            SS+E         R ++YN  KTI PLP RTSKTS+K VLIP+E   R       RS S
Sbjct: 139 GSSYERFSMFDDHLRSSYYNFSKTITPLPPRTSKTSQKLVLIPEEPDSRSNSLGRPRSTS 198

Query: 170 RVFS-----ELSYGEHNTAGLPSITAYNVAEGFNLNLASQFLKETHNVSIRRYDEXXXXX 224
            + +        YG    A LP +TAY+++EG NL L S+FLK+ H VS R YDE     
Sbjct: 199 SLRAYPRGDRSRYGIKAKARLPRLTAYHLSEGLNLKLMSKFLKKYHEVSPRLYDECLYVA 258

Query: 225 XXXXXXXGKDGFRIRSNVSKKMVGGKTLIDRLIDTSEQRDHHYEYYSGVETVEDMHNNFE 284
                  GKDG+RI+SN+SKK++GGKTLID++ID SEQRDHHYEYYSGVE +ED +NN+E
Sbjct: 259 YTLPLLPGKDGYRIKSNISKKVIGGKTLIDKMIDASEQRDHHYEYYSGVEVLEDANNNYE 318

Query: 285 INENGNGRDPDGLRNADHLAPLSSNMQSFDPSEPQFFAEELSEIGLHPIQDSSSEQHER- 343
           ++ N    D D     DHL    +N  +F+PSEPQ+FAEE       P +    EQ E+ 
Sbjct: 319 LSTNPVQADTDINNIPDHLPNTMANTDNFNPSEPQYFAEET------PSEQKLREQEEQL 372

Query: 344 --------------EKVLDAQQHAEIFIFNYGVIVFWNFTELEEKNILGDIAFSGMKNMV 389
                         E +    QHAEIFIF YGVIVFWNFTE +EKNILGDIAF+  K++V
Sbjct: 373 GLIANSTITTSSSSELITGKSQHAEIFIFRYGVIVFWNFTEAQEKNILGDIAFADYKDLV 432

Query: 390 TRPLDEQDIEIEQFHFEYDMDTERPRIFNDIITLRSGDHIIKLTLSHAIAQSTKLSRFEK 449
            RPLDEQDIE E+FHFEYD DTERPRIFND+ITLRSGDHIIKLTLSH+IAQS+KLSRFE 
Sbjct: 433 IRPLDEQDIETEEFHFEYDADTERPRIFNDVITLRSGDHIIKLTLSHSIAQSSKLSRFES 492

Query: 450 RITPILGTVSKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFE 509
           R+ P+L +V+KLPKRLALYGTLGL R+QLLKKSGKLFKLRVDVNLSSSVLDTPEFFW+FE
Sbjct: 493 RLEPLLNSVTKLPKRLALYGTLGLTRQQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWTFE 552

Query: 510 PSLHPLYTAMREYLEIDPRVQVLNDRCKVFLEFFDICVNSIAEKDMARITWWXXXXXXXX 569
           PSLHPLY AMREYLEID RVQV+NDRC V LEFF+ICV+S+AE+++AR+TWW        
Sbjct: 553 PSLHPLYVAMREYLEIDERVQVVNDRCMVLLEFFNICVDSVAERNIARVTWWFIIVLILG 612

Query: 570 XXXXTAEILAR 580
                 EIL R
Sbjct: 613 VLFSLTEILIR 623

>Smik_7.368 Chr7 (606969..608948) [1980 bp, 659 aa] {ON} YFR048W
           (REAL)
          Length = 659

 Score =  603 bits (1554), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/624 (54%), Positives = 397/624 (63%), Gaps = 88/624 (14%)

Query: 20  MSRRSPSILVTDARSTKKRSSAPFAGNANTRRDKTGGSMPTVIENXXXXXXXXXXXXEFM 79
           M +RSPSILVTDAR++K R SAPFAG+A   R         ++ +               
Sbjct: 13  MPKRSPSILVTDARTSKNRMSAPFAGHAAGSRKSMENK--NLVRSQGVRSSNIGSSSLQN 70

Query: 80  PKAGSGRTRQGKFSEVSMDNILSEMSDVPSGRRQERLSSSSFEYERRPAHYN------KT 133
           P     R+  G+FS++S+DNILS+ SD+PS RR+ERLSSSS +   RP +Y       K 
Sbjct: 71  PTHPRRRS-SGRFSDISIDNILSDNSDIPSARREERLSSSSND---RPRNYERLSSRRKM 126

Query: 134 IRPLPSRTSKTSEKFVLIPDENVKRFAQGFHKRSASRVFSELSYGEHNT----------A 183
           I PLP RTSKTS+K VLIP+E+     Q     +  R    +   + N+           
Sbjct: 127 INPLPPRTSKTSQKLVLIPEEDDLSHFQTMPTNALDRQRPRVGSMKPNSFDRLPRHSRDK 186

Query: 184 GLPSITAYNVAEGFNLNLASQFLKETHNVSIRRYDEXXXXXXXXXXXXGKDGFRIRSNVS 243
            +  ITAYNVA+GFNLN   +FL ETH VS R YDE            GK GFRI+SN+S
Sbjct: 187 SMARITAYNVADGFNLNQLYKFLHETHEVSPRLYDECLYVAYTLPLLPGKGGFRIKSNIS 246

Query: 244 KKMVGGKTLIDRLIDTSEQRDHHYEYYSGVETVEDMHNNFEINENGNGRD--------PD 295
           KK VGGKTLID LIDTSEQRDHHYEYYSGVETVED +NN+E+  NGN           PD
Sbjct: 247 KKTVGGKTLIDNLIDTSEQRDHHYEYYSGVETVEDANNNYELEANGNNNSTNQDTTIVPD 306

Query: 296 GLRNA----DHLAPL---------------------------------SSNMQSFDPSEP 318
            L N     D   P+                                  SN +  D SEP
Sbjct: 307 HLPNPVGQQDSFNPMEPQFFAEETPLEIEERERTERINMLKKEEKDIDGSNGEKNDESEP 366

Query: 319 QFFAEELSE-----IGLHPIQDSSSEQHEREKVLD----------------AQQHAEIFI 357
             +  +  +         P   S+S Q       D                  +HAEIFI
Sbjct: 367 VSYVNDGKDHHAYSACFSPPASSASTQSALSSSRDDFNRVYEVHSDNGHDGNDRHAEIFI 426

Query: 358 FNYGVIVFWNFTELEEKNILGDIAFSGMKNMVTRPLDEQDIEIEQFHFEYDMDTERPRIF 417
           F+YGVIVFWNFTE++EKNILGDI F+G K+++ RPLDEQDIE EQFHFEYD DTERPRIF
Sbjct: 427 FHYGVIVFWNFTEIQEKNILGDITFAGYKSLMIRPLDEQDIETEQFHFEYDRDTERPRIF 486

Query: 418 NDIITLRSGDHIIKLTLSHAIAQSTKLSRFEKRITPILGTVSKLPKRLALYGTLGLKREQ 477
           NDI+TLRSGDHII+LTLSHAIAQS+KLSRFE RI+PIL +V+KLPKRLALYGTLGLKREQ
Sbjct: 487 NDIVTLRSGDHIIELTLSHAIAQSSKLSRFESRISPILISVTKLPKRLALYGTLGLKREQ 546

Query: 478 LLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYTAMREYLEIDPRVQVLNDRCK 537
           LLKKSGKLFKLRVDVNLSS++LDTPEFFWSFEPSLHPLY AMREYLEID RVQVLNDRCK
Sbjct: 547 LLKKSGKLFKLRVDVNLSSTILDTPEFFWSFEPSLHPLYVAMREYLEIDQRVQVLNDRCK 606

Query: 538 VFLEFFDICVNSIAEKDMARITWW 561
           VFLEFFDICV+S+AE++MAR+TWW
Sbjct: 607 VFLEFFDICVDSVAERNMARVTWW 630

>KAFR0J00170 Chr10 complement(27714..29537) [1824 bp, 607 aa] {ON}
           Anc_3.568 YFR048W
          Length = 607

 Score =  587 bits (1512), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/588 (54%), Positives = 404/588 (68%), Gaps = 33/588 (5%)

Query: 20  MSRRSPSILVTDARSTKKRSSAPFAGNA----NTRRDKTGGSMPTVIENXXXXXXXXXXX 75
           M +RSPSILVTD+RS+K R SAPFAG+A    N+  D   G  P    N           
Sbjct: 19  MPKRSPSILVTDSRSSKNRMSAPFAGHAAFGTNSSVDPRTGRPPQGAFNDGNSTKM---- 74

Query: 76  XEFMPKAGSG---RTRQGKFSEVSMDNILSEMSDVPSGRRQERLSSSSFEY-----ERRP 127
             + PK  +    R + GKFS++S+DNIL++ S+VPSGRR+ER S+SS++      ER  
Sbjct: 75  --YRPKVINNTRIRRQPGKFSDISLDNILADNSEVPSGRREERRSNSSWDRFPIGNERLH 132

Query: 128 AHY--NKTIRPLPSRTSKTSEKFVLIPDENVKRFAQG-FHKRSASRVFSELSYGEHN--- 181
           A     K + PLP+RTSK S+K VLIP+E +++  +  F K  +      L   E+N   
Sbjct: 133 ASSLKKKMMNPLPTRTSKISQKLVLIPEEELQKGRKANFLKEQSHTKRPSLGNIEYNFKK 192

Query: 182 -TAGLPSITAYNVAEGFNLNLASQFLKETHNVSIRRYDEXXXXXXXXXXXXGKDGFRIRS 240
               LP +TAYN+AEGFNL + S FL+ETH+VS R YD+            G+DGFR++S
Sbjct: 193 TVNNLPRLTAYNIAEGFNLKVLSNFLEETHDVSPRLYDDCLYVPYILPLLPGRDGFRVKS 252

Query: 241 NVSKKMVGGKTLIDRLIDTSEQRDHHYEYYSGVE----TVEDMHNNFEINENGNGRDPDG 296
           N+SK++VGGKTLIDRLIDTSEQRDHHYE++SGVE    +  D  NN     N N  + + 
Sbjct: 253 NISKRIVGGKTLIDRLIDTSEQRDHHYEFFSGVEDEVNSGPDTRNNPHDKLNVNQVNTEE 312

Query: 297 LRNADHLAPLSSNMQSFDPSEPQFFAEELSE--IGLHPIQDSSSEQHEREKVLDAQQHAE 354
           L   D L+  + N   FDPSEPQFFAE+ +   +    +++SS     +  + +  QHAE
Sbjct: 313 LGPTDMLSINAVNQDVFDPSEPQFFAEDSATQTMDTSNVENSSLTSSRQANLEEEDQHAE 372

Query: 355 IFIFNYGVIVFWNFTELEEKNILGDIAF-SGMKNMVTRPLDEQDIEIEQFHFEYDMDT-E 412
           IFIF+YGVIVFWNFTE++EKN+L DI+F    K +V +PLDEQDIE E+FHFEY+ D  E
Sbjct: 373 IFIFHYGVIVFWNFTEMQEKNVLADISFFEDTKRLVLKPLDEQDIETEEFHFEYNKDNNE 432

Query: 413 RPRIFNDIITLRSGDHIIKLTLSHAIAQSTKLSRFEKRITPILGTVSKLPKRLALYGTLG 472
           RPRIFNDIITLRS DH+IKLTLS+AIAQS+KLSRFE RI+P+   V KLPKRLAL+GTLG
Sbjct: 433 RPRIFNDIITLRSHDHMIKLTLSYAIAQSSKLSRFESRISPLFTAVIKLPKRLALFGTLG 492

Query: 473 LKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYTAMREYLEIDPRVQVL 532
           +KREQLLKKSGKLFKLRVDVNLSS++LDTP FFWS EPSLHPLY AMREYLEID RVQV+
Sbjct: 493 MKREQLLKKSGKLFKLRVDVNLSSNILDTPGFFWSIEPSLHPLYVAMREYLEIDKRVQVV 552

Query: 533 NDRCKVFLEFFDICVNSIAEKDMARITWWXXXXXXXXXXXXTAEILAR 580
           NDRCKVFLEFFDICV+S+AEK++AR+T W              EI+ R
Sbjct: 553 NDRCKVFLEFFDICVDSVAEKNIARVTLWFLVVIIVGVLFSFTEIVVR 600

>KNAG0D02960 Chr4 (533165..535120) [1956 bp, 651 aa] {ON} Anc_3.568
           YFR048W
          Length = 651

 Score =  586 bits (1511), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/621 (53%), Positives = 409/621 (65%), Gaps = 85/621 (13%)

Query: 17  RNMMSRRSPSILVTDARSTKKRSSAPFAGNANTRRDKTGGSMPTV-----IENXXXXXXX 71
           R+ +++RSPSILVTD+RS++ RSSAPFAG+A        GSM        ++        
Sbjct: 13  RDPLAKRSPSILVTDSRSSQSRSSAPFAGHA------ASGSMANYHKSKQLQQQKSVRGG 66

Query: 72  XXXXXEFMPKAGSG---------------RTRQ---GKFSEVSMDNILSEMSDVPSGRRQ 113
                      GSG               R R+   G+FS VSMDNIL   S VPSGRR+
Sbjct: 67  GVGSGSSAGNYGSGARGPSGNSLNSAPGARARKRPSGRFSNVSMDNILHNDSAVPSGRRE 126

Query: 114 ERLSSSSFEYERRPA--------HYNKTIRPLPSRTSKTSEKFVLIPDENVKRFAQGF-- 163
           +R S+SS  ++R P          Y K I PLPSRTSK S+K VLIP+++      G   
Sbjct: 127 QRGSTSS--WDRFPVTEILHASNSYRKMINPLPSRTSKISQKLVLIPEDDTVNAENGTST 184

Query: 164 -------------------HKRSASRV-----FSELSYGEHNTAGLPSITAYNVAEGFNL 199
                               KR ++R+     F   SY   N+  L  +TAYN+AEGF+L
Sbjct: 185 KGSGNPPLRKSRNIGPVLDRKRHSTRMTNLNEFDNESY-RFNSGNLSRLTAYNIAEGFDL 243

Query: 200 NLASQFLKETHNVSIRRYDEXXXXXXXXXXXXGKDGFRIRSNVSKKMVGGKTLIDRLIDT 259
            +  +FL+ TH V  R YD+            GKDGFRI+SNVSKK VGG TLID+LIDT
Sbjct: 244 TMLHRFLQNTHEVHPRLYDDCLYVPYVLPLLPGKDGFRIKSNVSKKAVGGGTLIDKLIDT 303

Query: 260 SEQRDHHYEYYSGVETVEDMHNNFEINENGNGRD--PDGLRNADHLAPLSS--NMQSFDP 315
           SE+RDHHYEYYSGVET+ED +NN+E+   G   +   D     DHL   ++  N  +FDP
Sbjct: 304 SERRDHHYEYYSGVETLEDANNNYELEATGGHTNEMSDVSVIPDHLPQPTAGINPDAFDP 363

Query: 316 SEPQFFAEEL---------SEIGLHPIQDSSSEQHEREKVL------DAQQHAEIFIFNY 360
            EPQFFAEE           E+      + ++++  RE+ L      D+  HAE+FIF+Y
Sbjct: 364 REPQFFAEETPVEQELRQREEMKSITSDEGTNKRSSRERNLERKVSEDSTDHAELFIFHY 423

Query: 361 GVIVFWNFTELEEKNILGDIAFSGMKNMVTRPLDEQDIEIEQFHFEYDMDTERPRIFNDI 420
           GVIVFWNFTE +EKN+LGDI F+  K+++ RP+DEQDIE E+FHFEYDMDTERPRIFNDI
Sbjct: 424 GVIVFWNFTEEQEKNLLGDITFADDKDLMIRPIDEQDIETEEFHFEYDMDTERPRIFNDI 483

Query: 421 ITLRSGDHIIKLTLSHAIAQSTKLSRFEKRITPILGTVSKLPKRLALYGTLGLKREQLLK 480
           +TLRSGDHI+K+TLS+AIAQS+KLSRFE RITP+L  V KLPKRLAL+GTLGL+REQLLK
Sbjct: 484 VTLRSGDHIVKMTLSYAIAQSSKLSRFESRITPLLSAVMKLPKRLALHGTLGLRREQLLK 543

Query: 481 KSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYTAMREYLEIDPRVQVLNDRCKVFL 540
           KSGKLFKLRVDVNLSSS+LDTP+FFWS EPSLHPLY AMREYLEID RVQV+NDRCKVFL
Sbjct: 544 KSGKLFKLRVDVNLSSSILDTPDFFWSIEPSLHPLYIAMREYLEIDKRVQVVNDRCKVFL 603

Query: 541 EFFDICVNSIAEKDMARITWW 561
           EFFDICV+S+AE++MAR+TWW
Sbjct: 604 EFFDICVDSVAERNMARVTWW 624

>TPHA0A06010 Chr1 (1359051..1360922) [1872 bp, 623 aa] {ON}
           Anc_3.568 YFR048W
          Length = 623

 Score =  584 bits (1505), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/567 (56%), Positives = 390/567 (68%), Gaps = 33/567 (5%)

Query: 27  ILVTDARSTKKRSSAPFAGNANTRRDK----TGGSMPTVIENXXXXXXXXXXXXEFMPKA 82
           ILVTD+RS + R +APFA +A   RD+     G S  +   +            +     
Sbjct: 32  ILVTDSRSNRNRINAPFARHAAGLRDRNSNFVGPSADSRKNSSNGVFASPKSHQKLHMNN 91

Query: 83  GSGRTRQGKFSEVSMDNILSEMSDVPSGRRQERLSSSSFE----YERRPAHYN-KTIRPL 137
              +  +G+FS +S+DNILS+ SDVPSGRR+ER SSSS++    YE+  A+ N K +  L
Sbjct: 92  KHDQVLRGRFSGISVDNILSDSSDVPSGRREERRSSSSWDRLSVYEKFKAYPNQKKLNHL 151

Query: 138 PSRTSKTSEKFVLIPDE-----------NVKRFAQGFHKRSASRVFSELSYGE------- 179
           PSRTSKTS+K VLIP++           N+++       +  SR+ S   Y         
Sbjct: 152 PSRTSKTSQKLVLIPEDIPGSEYSSPLSNLRQKPVSSPIKQ-SRINSTDYYDSSKIRPHN 210

Query: 180 HNTAGLPSITAYNVAEGFNLNLASQFLKETHNVSIRRYDEXXXXXXXXXXXXGKDGFRIR 239
            N   LP +TAYN+A+  NL   S+FLKETH VS R Y+E            GKDGFRI+
Sbjct: 211 QNYDDLPRLTAYNIADALNLKSISKFLKETHEVSSRLYNECLYVAYTLPLLSGKDGFRIK 270

Query: 240 SNVSKKMVGGKTLIDRLIDTSEQRDHHYEYYSGVETVEDMHNNFEINENGNGRDPDGLRN 299
           SN+SKK++GGKTLID LIDTSEQRDHHYEYYSG+E  ED  NN+E+  NG   + D    
Sbjct: 271 SNISKKVIGGKTLIDELIDTSEQRDHHYEYYSGIENPEDASNNYELEANGIPAENDVTVI 330

Query: 300 ADHLAPLSSNMQSFDPSEPQFFAEE-----LSEIGLHPIQDSSSEQHEREKVLDAQQHAE 354
            DHL  ++++  +F+P +PQ+FAEE             IQ +         + D  QHAE
Sbjct: 331 PDHLPSVTNSTDAFNPGDPQYFAEETPSEKKLREKKEEIQINQKVNKAISLLTDEDQHAE 390

Query: 355 IFIFNYGVIVFWNFTELEEKNILGDIAFSGMKNMVTRPLDEQDIEIEQFHFEYDMDTERP 414
           IFIF+YGVIVFWNF E++EKNILGD+AF+  KN++TRPL E+DIEIEQFHF YD  TERP
Sbjct: 391 IFIFHYGVIVFWNFQEIQEKNILGDVAFADSKNLLTRPLSEEDIEIEQFHFAYDRHTERP 450

Query: 415 RIFNDIITLRSGDHIIKLTLSHAIAQSTKLSRFEKRITPILGTVSKLPKRLALYGTLGLK 474
            IFND ITLRSGDHI+KLTLSHAIAQS+KLSRFE R+TPIL +++KLPKRLALYGTLGLK
Sbjct: 451 SIFNDTITLRSGDHIMKLTLSHAIAQSSKLSRFESRVTPILHSITKLPKRLALYGTLGLK 510

Query: 475 REQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYTAMREYLEIDPRVQVLND 534
           REQLLK+SGKLFKLRVDVNLSSSVLDTPEFFWS EPSLHPLY AMREYLEID RVQVLND
Sbjct: 511 REQLLKRSGKLFKLRVDVNLSSSVLDTPEFFWSLEPSLHPLYIAMREYLEIDQRVQVLND 570

Query: 535 RCKVFLEFFDICVNSIAEKDMARITWW 561
           RC VFLEFFDICV+S+AE+ + R+TWW
Sbjct: 571 RCMVFLEFFDICVDSVAERSIVRVTWW 597

>Suva_12.9 Chr12 complement(11366..13345) [1980 bp, 659 aa] {ON}
           YFR048W (REAL)
          Length = 659

 Score =  403 bits (1035), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 200/286 (69%), Positives = 225/286 (78%), Gaps = 11/286 (3%)

Query: 304 APLSSNMQSFDPSEPQFFAEELSEIGLHPIQDSSSEQHEREKVLDAQQHAEIFIFNYGVI 363
            P SS   ++ PS P   A   S  G    +D+  E ++R        HAEIFIF+YGVI
Sbjct: 382 TPPSSASSAYTPSPPSS-ARRDSNRGYEMQKDNEHEGNDR--------HAEIFIFHYGVI 432

Query: 364 VFWNFTELEEKNILGDIAFSGMKNMVTRPLDEQDIEIEQFHFEYDMDTERPRIFNDIITL 423
           VFWNFTE++EKNILGDI F+  KN++ RPLDEQDIE EQFHFEYD DTERPRIFNDI+TL
Sbjct: 433 VFWNFTEIQEKNILGDITFADYKNLMIRPLDEQDIETEQFHFEYDSDTERPRIFNDIVTL 492

Query: 424 RSGDHIIKLTLSHAIAQSTKLSRFEKRITPILGTVSKLPKRLALYGTLGLKREQLLKKSG 483
           RSGDHII+LTLSHAIAQS+KLSRFE RI+PIL +V+KLPKRLALYGTLGLKREQLLKKSG
Sbjct: 493 RSGDHIIELTLSHAIAQSSKLSRFESRISPILISVTKLPKRLALYGTLGLKREQLLKKSG 552

Query: 484 KLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYTAMREYLEIDPRVQVLNDRCKVFLEFF 543
           KLFKLRVDVNLSS++LDTPEFFWSFEPSLHPLY AMREYLEID RVQVLNDRCKVFLEFF
Sbjct: 553 KLFKLRVDVNLSSTILDTPEFFWSFEPSLHPLYVAMREYLEIDQRVQVLNDRCKVFLEFF 612

Query: 544 DICVNSIAEKDMARITWWXXXXXXXXXXXXTAEILAR--IFHYKKT 587
           DICV+S+AE++MAR+TWW             AEI  R  I H   T
Sbjct: 613 DICVDSVAERNMARVTWWFILVILFGVIFSLAEIFVRYIIIHRHST 658

 Score =  239 bits (609), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 163/348 (46%), Positives = 203/348 (58%), Gaps = 25/348 (7%)

Query: 20  MSRRSPSILVTDARSTKKRSSAPFAGNANTRRDKTGGSMPTVIENXXXXXXXXXXXXEFM 79
           M +RSPSILVTDARS++ R SAPFAG+A   R          +E               M
Sbjct: 13  MPKRSPSILVTDARSSRNRISAPFAGHAAGSRKSMENKS---VERSQGIRSSNAGPSPMM 69

Query: 80  PKAGSGRTRQGKFSEVSMDNILSEMSDVPSGRRQERLSSSSFE---YERRPAHYNKTIRP 136
           P A   R   G+FS++S+DNILS+ S++PS RR+ERLSSSS +   Y  R     K I P
Sbjct: 70  P-AHPRRRSSGRFSDISIDNILSDNSEIPSARREERLSSSSSDRPRYYERLNSRRKMINP 128

Query: 137 LPSRTSKTSEKFVLIPDEN-VKRFAQGFHK---RSASRVFSELSYGEHNTA------GLP 186
           LP RTSKTS+K VLIP+E+ + +F    H    R   +V S  S              + 
Sbjct: 129 LPPRTSKTSQKLVLIPEEDDLNQFRNMPHNALDRQRPKVGSTKSSSHDRMPRHLREKPMA 188

Query: 187 SITAYNVAEGFNLNLASQFLKETHNVSIRRYDEXXXXXXXXXXXXGKDGFRIRSNVSKKM 246
            ITAYNVA+GFNLNL  +FL++TH VS R YDE            GK GFRI+SN+SKK 
Sbjct: 189 RITAYNVADGFNLNLLYRFLEDTHEVSPRLYDECLYVAYTLPLLPGKGGFRIKSNISKKT 248

Query: 247 VGGKTLIDRLIDTSEQRDHHYEYYSGVETVEDMHNNFEINENG--NGRDPDGLRNADHLA 304
           VGGKTLID LIDTSEQRDHHYEYYSGVETVED +NN+E+  +G  N    D +   DHL 
Sbjct: 249 VGGKTLIDNLIDTSEQRDHHYEYYSGVETVEDANNNYELETSGGNNSTSQDTVTVPDHLP 308

Query: 305 PLSSNMQSFDPSEPQFFAEELSEIGLHPIQDSSSEQHEREKVLDAQQH 352
                  SF+P EPQFFAEE       P++    E+ ER  +L  +++
Sbjct: 309 NPVGQQDSFNPMEPQFFAEET------PLEQEKRERIERMNMLKKEEN 350

>YFR048W Chr6 (246146..248134) [1989 bp, 662 aa] {ON}  RMD8Cytosolic
           protein required for sporulation
          Length = 662

 Score =  398 bits (1022), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 181/211 (85%), Positives = 201/211 (95%)

Query: 351 QHAEIFIFNYGVIVFWNFTELEEKNILGDIAFSGMKNMVTRPLDEQDIEIEQFHFEYDMD 410
           +HAEIFIF+YGVIVFWNFTE++EKNILGDI F+  KN++ RPLDEQDIE EQFHFEYD D
Sbjct: 423 RHAEIFIFHYGVIVFWNFTEIQEKNILGDITFADYKNLMIRPLDEQDIETEQFHFEYDRD 482

Query: 411 TERPRIFNDIITLRSGDHIIKLTLSHAIAQSTKLSRFEKRITPILGTVSKLPKRLALYGT 470
           TERPRIFNDI+TLRSGDHII+LTLSHAIAQS+KLSRFE RI+PIL +V+KLPKRLALYGT
Sbjct: 483 TERPRIFNDIVTLRSGDHIIELTLSHAIAQSSKLSRFESRISPILISVTKLPKRLALYGT 542

Query: 471 LGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYTAMREYLEIDPRVQ 530
           LGLKREQLLKKSGKLFKLRVDVNLSS++LDTPEFFWSFEPSLHPLY AMREYLEID RVQ
Sbjct: 543 LGLKREQLLKKSGKLFKLRVDVNLSSTILDTPEFFWSFEPSLHPLYVAMREYLEIDQRVQ 602

Query: 531 VLNDRCKVFLEFFDICVNSIAEKDMARITWW 561
           VLNDRCKVFLEFFDICV+S+AE++MAR+TWW
Sbjct: 603 VLNDRCKVFLEFFDICVDSVAERNMARVTWW 633

 Score =  238 bits (606), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 162/351 (46%), Positives = 206/351 (58%), Gaps = 30/351 (8%)

Query: 20  MSRRSPSILVTDARSTKKRSSAPFAGNANTRRDKTGGSMPTVIENXXXXXXXXXXXXEFM 79
           M +RSPSILVTDAR++K R SAPFAG+A   R     +  T  +              F 
Sbjct: 13  MPKRSPSILVTDARTSKNRMSAPFAGHAAGSRKNMENAGVTKSQGVRSSAIGPSPLQSFT 72

Query: 80  -PKAGSGRTRQGKFSEVSMDNILSEMSDVPSGRRQERLSSSSF----EYERRPAHYNKTI 134
            P+    R   G+FS++S+DNILS+ SD+PS RR+ERLSSSS     +YER  +   K I
Sbjct: 73  HPR----RRSSGRFSDISIDNILSDNSDIPSARREERLSSSSSDRPRQYERLSSR-RKMI 127

Query: 135 RPLPSRTSKTSEKFVLIP-DENVKRFAQGFHKRSASRVFSELSYGEHNT----------A 183
            PLP RTSKTS+K VLIP D+N+  F Q     +  R   ++   + N+           
Sbjct: 128 NPLPPRTSKTSQKLVLIPEDDNLNHF-QTLPTNALDRQRPKVGSMKSNSFDRLPRYSKEK 186

Query: 184 GLPSITAYNVAEGFNLNLASQFLKETHNVSIRRYDEXXXXXXXXXXXXGKDGFRIRSNVS 243
            +  ITAYNVA+GFNLN   +FL+ETH VS R YDE            GK GFRI+SN+S
Sbjct: 187 SMARITAYNVADGFNLNQLYKFLQETHEVSPRLYDECLYVAYTLPLLPGKGGFRIKSNLS 246

Query: 244 KKMVGGKTLIDRLIDTSEQRDHHYEYYSGVETVEDMHNNFEINENGNGRDP--DGLRNAD 301
           KK +GGKTLID LIDTSEQRDHHYEYYSGVETVED +NN+E+  +GN  +   D     D
Sbjct: 247 KKTMGGKTLIDNLIDTSEQRDHHYEYYSGVETVEDANNNYELETSGNNNNANQDTTTVPD 306

Query: 302 HLAPLSSNMQSFDPSEPQFFAEELSEIGLHPIQDSSSEQHEREKVLDAQQH 352
           HL        SF+P EPQFFAEE       P++    E+ ER  +L  +++
Sbjct: 307 HLPNPVGQQDSFNPMEPQFFAEET------PLEIEKRERTERINMLKKEEN 351

>Skud_6.139 Chr6 (241140..243125) [1986 bp, 661 aa] {ON} YFR048W
           (REAL)
          Length = 661

 Score =  395 bits (1016), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 180/211 (85%), Positives = 200/211 (94%)

Query: 351 QHAEIFIFNYGVIVFWNFTELEEKNILGDIAFSGMKNMVTRPLDEQDIEIEQFHFEYDMD 410
           +HAEIFIF+YGVIVFWNFTE++EKNILGDI F+  +N+  RPLDEQDIE EQFHFEYD D
Sbjct: 422 RHAEIFIFHYGVIVFWNFTEIQEKNILGDITFADYRNLTIRPLDEQDIETEQFHFEYDRD 481

Query: 411 TERPRIFNDIITLRSGDHIIKLTLSHAIAQSTKLSRFEKRITPILGTVSKLPKRLALYGT 470
           TERPRIFNDI+TLRSGDHII+LTLSHAIAQS+KLSRFE RI+PIL +V+KLPKRLALYGT
Sbjct: 482 TERPRIFNDIVTLRSGDHIIELTLSHAIAQSSKLSRFESRISPILISVTKLPKRLALYGT 541

Query: 471 LGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYTAMREYLEIDPRVQ 530
           LGLKREQLLKKSGKLFKLRVDVNLSS++LDTPEFFWSFEPSLHPLY AMREYLEID RVQ
Sbjct: 542 LGLKREQLLKKSGKLFKLRVDVNLSSTILDTPEFFWSFEPSLHPLYVAMREYLEIDQRVQ 601

Query: 531 VLNDRCKVFLEFFDICVNSIAEKDMARITWW 561
           VLNDRCKVFLEFFDICV+S+AE++MAR+TWW
Sbjct: 602 VLNDRCKVFLEFFDICVDSVAERNMARVTWW 632

 Score =  235 bits (600), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 157/326 (48%), Positives = 193/326 (59%), Gaps = 30/326 (9%)

Query: 20  MSRRSPSILVTDARSTKKRSSAPFAGNANTRRDKTGGSMPTVIENXXXXXXXXXXXXEFM 79
           M +RSPSILVTDAR++KKR SAPFAG+A        GS  T +EN               
Sbjct: 13  MPKRSPSILVTDARTSKKRMSAPFAGHA-------AGSRKT-MENKDLARSQGARSSNIG 64

Query: 80  P-----KAGSGRTRQGKFSEVSMDNILSEMSDVPSGRRQERLSSSSF----EYERRPAHY 130
           P     +    R   G+FS++S+DNILS+ S +PS RR+ERLSSSS      YER  +H 
Sbjct: 65  PSPLLNQPHPRRRSSGRFSDISIDNILSDNSGIPSARREERLSSSSSDRPRHYERLNSH- 123

Query: 131 NKTIRPLPSRTSKTSEKFVLIPDENVKRFAQGFHKRSASRVFSELSYGEHNT-------- 182
            K I PLP RTSKTS+K VLIP+++     +    ++  R   ++     N+        
Sbjct: 124 RKMINPLPPRTSKTSQKLVLIPEDDDLNHFKTMPTKALDRQRPKVGSMRTNSFDRLPRHS 183

Query: 183 --AGLPSITAYNVAEGFNLNLASQFLKETHNVSIRRYDEXXXXXXXXXXXXGKDGFRIRS 240
               +  ITAYNVA+GFNLN   +FL++TH VS R YDE            GK GFRI+S
Sbjct: 184 REKSMARITAYNVADGFNLNHLYKFLQDTHEVSPRLYDECLYVAYTLPLLPGKGGFRIKS 243

Query: 241 NVSKKMVGGKTLIDRLIDTSEQRDHHYEYYSGVETVEDMHNNFEINENG--NGRDPDGLR 298
           N+SKK VGGKTLID LIDTSEQRDHHYEYYSGVETVED +NN+E+  NG  N  + D   
Sbjct: 244 NISKKTVGGKTLIDNLIDTSEQRDHHYEYYSGVETVEDANNNYELETNGGNNTTNQDTTI 303

Query: 299 NADHLAPLSSNMQSFDPSEPQFFAEE 324
             DHL        SF+P EPQFFAEE
Sbjct: 304 VPDHLPNPVGQQDSFNPMEPQFFAEE 329

>CAGL0M10483g Chr13 complement(1049771..1051069) [1299 bp, 432 aa]
           {ON} highly similar to uniprot|Q03441 Saccharomyces
           cerevisiae YDL001w
          Length = 432

 Score =  174 bits (440), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 88/198 (44%), Positives = 130/198 (65%), Gaps = 8/198 (4%)

Query: 349 AQQHAEIFIFNYGVIVFWNFTELEEKNILGDIAFSGMKNMVTRPLDEQDIEIEQFHFEYD 408
           + +H +IFIF YGVIV W FTE EEK  L D     ++      L E+DI+IE+F++ Y 
Sbjct: 201 SDKHPDIFIFEYGVIVLWGFTEREEKAFLND-----LEKFEKEKLAEEDIQIEEFNY-YV 254

Query: 409 MDTERPRIFNDIITLRSG-DHIIKLTLSHAIAQSTKLSRFEKRITPILGTVSKLPKRLAL 467
             + +PRI+ND ITLR G +++IKL++SHAIAQS K+S FE+ +   +     +P+ +A 
Sbjct: 255 TQSYQPRIYNDFITLRDGSNYMIKLSISHAIAQSVKISLFEELVDNTIEDTQDIPQEIAS 314

Query: 468 YGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYTAMREYLEIDP 527
            G + + +E+++K  G+LF LR+++NL  SVLD+PE  WS EP L P+Y A R YLEI+ 
Sbjct: 315 SGKVSMSKEEIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYQATRGYLEINQ 373

Query: 528 RVQVLNDRCKVFLEFFDI 545
           RV +LN R +V  +   +
Sbjct: 374 RVALLNQRLEVISDLLQM 391

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 49/104 (47%), Gaps = 17/104 (16%)

Query: 132 KTIRPLPSRTSKTSEKFVLIPDENVKRFAQGFHKRSASRVFSELS-------------YG 178
           + IR    RTS+T++K  L+P+E   R  +    R    V+S+++              G
Sbjct: 64  RQIRNGAQRTSRTAQKLKLLPEEAFHRDEEVSELRDRD-VYSQVNRITDKNARRDAEKLG 122

Query: 179 EHNTAGLPSITAYNVAEGFNLNLASQFLKE---THNVSIRRYDE 219
           + +   LP  T+Y  A  +N+    ++LK+   TH+   + +DE
Sbjct: 123 KAHRHLLPRCTSYCTASSYNMKDLIRWLKDSKKTHHTHPKLFDE 166

>Suva_4.252 Chr4 (445183..446475) [1293 bp, 430 aa] {ON} YDL001W
           (REAL)
          Length = 430

 Score =  171 bits (433), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 85/202 (42%), Positives = 132/202 (65%), Gaps = 8/202 (3%)

Query: 345 KVLDAQQHAEIFIFNYGVIVFWNFTELEEKNILGDIAFSGMKNMVTRPLDEQDIEIEQFH 404
           +++ + +H ++FIF YGV+V W FTE EEK  L DI     +      L E+DI++E+F+
Sbjct: 195 EIIVSDKHPDLFIFEYGVVVMWGFTEREEKAFLNDI-----EKFEKEKLAEEDIQVEEFN 249

Query: 405 FEYDMDTERPRIFNDIITLRSG-DHIIKLTLSHAIAQSTKLSRFEKRITPILGTVSKLPK 463
           + Y   + +PRI+ND ITLR G ++++KL++SHAIAQS K+S FE+ +   +     +P+
Sbjct: 250 Y-YVTKSYQPRIYNDFITLRDGSNYMVKLSISHAIAQSVKISLFEELVDNTIEDTQDIPQ 308

Query: 464 RLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYTAMREYL 523
            +A  G + + +E ++K  G+LF LR+++NL  SVLD+PE  WS EP L P+Y A R YL
Sbjct: 309 EIAYSGKVSMSKEDIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYQATRGYL 367

Query: 524 EIDPRVQVLNDRCKVFLEFFDI 545
           EI+ RV +LN R +V  +   +
Sbjct: 368 EINQRVSLLNQRLEVISDLLQM 389

 Score = 35.0 bits (79), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 46/96 (47%), Gaps = 16/96 (16%)

Query: 140 RTSKTSEKFVLIPDENVKRFAQGFHKRSASRVFSELS-------------YGEHNTAGLP 186
           RTS+T++K  L+P+E  +R  +G        V+S+++              G+ +   LP
Sbjct: 69  RTSRTAQKLKLLPEEPFQRDDEGLTDLKNQEVYSQVNRIKDKPARRDAEKLGKAHRHLLP 128

Query: 187 SITAYNVAEGFNLNLASQFLKET---HNVSIRRYDE 219
             TAY  +  +N+    ++LK+    H+   + +DE
Sbjct: 129 RSTAYCTSSSYNMKELIRWLKDCRKIHHTHPKLFDE 164

>YDL001W Chr4 (447984..449276) [1293 bp, 430 aa] {ON}
           RMD1Cytoplasmic protein required for sporulation
          Length = 430

 Score =  171 bits (432), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 85/202 (42%), Positives = 132/202 (65%), Gaps = 8/202 (3%)

Query: 345 KVLDAQQHAEIFIFNYGVIVFWNFTELEEKNILGDIAFSGMKNMVTRPLDEQDIEIEQFH 404
           +++ + +H ++FIF YGV+V W FTE EEK  L DI     +      L E+DI++E+F+
Sbjct: 195 EIIVSDKHPDLFIFEYGVVVMWGFTEREEKAFLNDI-----EKFEKEKLAEEDIQVEEFN 249

Query: 405 FEYDMDTERPRIFNDIITLRSG-DHIIKLTLSHAIAQSTKLSRFEKRITPILGTVSKLPK 463
           + Y   + +PRI+ND ITLR G ++++KL++SHAIAQS K+S FE+ +   +     +P+
Sbjct: 250 Y-YVTKSYQPRIYNDFITLRDGSNYMVKLSISHAIAQSVKISLFEELVDNTIEDTQDIPQ 308

Query: 464 RLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYTAMREYL 523
            +A  G + + +E ++K  G+LF LR+++NL  SVLD+PE  WS EP L P+Y A R YL
Sbjct: 309 EIAYSGKVSMSKEDIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYQATRGYL 367

Query: 524 EIDPRVQVLNDRCKVFLEFFDI 545
           EI+ RV +LN R +V  +   +
Sbjct: 368 EINQRVSLLNQRLEVISDLLQM 389

 Score = 34.7 bits (78), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 46/96 (47%), Gaps = 16/96 (16%)

Query: 140 RTSKTSEKFVLIPDENVKRFAQGFHKRSASRVFSELS-------------YGEHNTAGLP 186
           RTS+T++K  L+P+E  +R ++         V+S+++              G+ +   LP
Sbjct: 69  RTSRTAQKLKLLPEEPFQRDSERLTDLKNQEVYSQVNRIKDKPARRDAEKLGKAHRHLLP 128

Query: 187 SITAYNVAEGFNLNLASQFLKET---HNVSIRRYDE 219
             TAY  A  +N+    ++LK+    H+   + +DE
Sbjct: 129 RSTAYCTASSYNMKELVRWLKDCRKLHHTHPKLFDE 164

>Smik_4.235 Chr4 (427186..428481) [1296 bp, 431 aa] {ON} YDL001W
           (REAL)
          Length = 431

 Score =  171 bits (432), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 84/203 (41%), Positives = 132/203 (65%), Gaps = 8/203 (3%)

Query: 345 KVLDAQQHAEIFIFNYGVIVFWNFTELEEKNILGDIAFSGMKNMVTRPLDEQDIEIEQFH 404
           +++ + +H ++FIF YGV+V W FTE EEK  L DI     +      L E+DI++E+F+
Sbjct: 196 EIIVSDKHPDLFIFEYGVVVMWGFTEREEKAFLNDI-----EKFEKEKLAEEDIQVEEFN 250

Query: 405 FEYDMDTERPRIFNDIITLRSG-DHIIKLTLSHAIAQSTKLSRFEKRITPILGTVSKLPK 463
           + Y   + +PRI+ND ITLR G ++++KL++SHAIAQS K+S FE+ +   +     +P+
Sbjct: 251 Y-YVTKSYQPRIYNDFITLRDGSNYMVKLSISHAIAQSVKISLFEELVDNTIEDTQDIPQ 309

Query: 464 RLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYTAMREYL 523
            +A  G + + +E ++K  G+LF LR+++NL  S+LD+PE  WS EP L P+Y A R YL
Sbjct: 310 EIAYSGKVSMSKEDIMKSIGELFILRININLHGSILDSPEIMWS-EPQLEPIYQATRGYL 368

Query: 524 EIDPRVQVLNDRCKVFLEFFDIC 546
           EI+ RV +LN R +V  +   + 
Sbjct: 369 EINQRVSLLNQRLEVISDLLQML 391

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 47/96 (48%), Gaps = 16/96 (16%)

Query: 140 RTSKTSEKFVLIPDENVKRFAQGFHKRSASRVFSELS-------------YGEHNTAGLP 186
           RTS+T++K  L+P+E  +R   G  +     V+S+++              G+ +   LP
Sbjct: 70  RTSRTAQKLKLLPEEPFQRDGDGLTELKNQEVYSQVNRIKDKPARRDAEKLGKAHRHLLP 129

Query: 187 SITAYNVAEGFNLNLASQFLKET---HNVSIRRYDE 219
             TAY  A  +N+    ++LK++   H+   + +DE
Sbjct: 130 RSTAYCTASSYNMKELIRWLKDSRKLHHTHPKLFDE 165

>Skud_4.253 Chr4 (439498..440790) [1293 bp, 430 aa] {ON} YDL001W
           (REAL)
          Length = 430

 Score =  170 bits (431), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 85/202 (42%), Positives = 132/202 (65%), Gaps = 8/202 (3%)

Query: 345 KVLDAQQHAEIFIFNYGVIVFWNFTELEEKNILGDIAFSGMKNMVTRPLDEQDIEIEQFH 404
           +++ + +H ++FIF YGV+V W FTE EEK  L DI     +      L E+DI++E+F+
Sbjct: 195 EIIVSDKHPDLFIFEYGVVVMWGFTEREEKAFLNDI-----EKFEKEKLAEEDIQVEEFN 249

Query: 405 FEYDMDTERPRIFNDIITLRSG-DHIIKLTLSHAIAQSTKLSRFEKRITPILGTVSKLPK 463
           + Y   + +PRI+ND ITLR G ++++KL++SHAIAQS K+S FE+ +   +     +P+
Sbjct: 250 Y-YVTKSYQPRIYNDFITLRDGSNYMVKLSISHAIAQSVKISLFEELVDNTIEDTQDIPQ 308

Query: 464 RLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYTAMREYL 523
            +A  G + + +E ++K  G+LF LR+++NL  SVLD+PE  WS EP L P+Y A R YL
Sbjct: 309 EIAYSGKVSMGKEDIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYQATRGYL 367

Query: 524 EIDPRVQVLNDRCKVFLEFFDI 545
           EI+ RV +LN R +V  +   +
Sbjct: 368 EINQRVSLLNQRLEVISDLLQM 389

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 46/96 (47%), Gaps = 16/96 (16%)

Query: 140 RTSKTSEKFVLIPDENVKRFAQGFHKRSASRVFSELS-------------YGEHNTAGLP 186
           RTS+T++K  L+P+E  +R  +G        V+S+++              G+ +   LP
Sbjct: 69  RTSRTAQKLKLLPEEPFQRDDEGLTDLKNQEVYSQVNRIKDKPARRDAEKLGKAHRHLLP 128

Query: 187 SITAYNVAEGFNLNLASQFLKET---HNVSIRRYDE 219
             TAY  A  +N+    ++LK+    H+   + +DE
Sbjct: 129 RSTAYCTASSYNMKELIRWLKDCRKIHHTHPKLFDE 164

>NCAS0A10120 Chr1 (2022090..2023361) [1272 bp, 423 aa] {ON}
           Anc_3.209
          Length = 423

 Score =  169 bits (428), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 84/198 (42%), Positives = 130/198 (65%), Gaps = 8/198 (4%)

Query: 349 AQQHAEIFIFNYGVIVFWNFTELEEKNILGDIAFSGMKNMVTRPLDEQDIEIEQFHFEYD 408
           + +H+E+FIF YGV+V W FTE EEK  L D     ++      L ++DI++E+F++ Y 
Sbjct: 192 SDKHSELFIFEYGVVVMWGFTEREEKCFLTD-----LERFEKEKLADEDIQVEEFNY-YV 245

Query: 409 MDTERPRIFNDIITLRSG-DHIIKLTLSHAIAQSTKLSRFEKRITPILGTVSKLPKRLAL 467
             + +PRI+ND ITLR G ++++KL++SHAIAQS K+S FE+ +   +     +P+ +A 
Sbjct: 246 TKSYQPRIYNDFITLRDGSNYMVKLSISHAIAQSVKISLFEELVDNTIEDTQDIPQEIAS 305

Query: 468 YGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYTAMREYLEIDP 527
            G + + +E ++K  G+LF LR+++NL  SVLD+PE  WS EP L P+Y A R YLEI+ 
Sbjct: 306 SGKVSMSKEDIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYQATRGYLEINQ 364

Query: 528 RVQVLNDRCKVFLEFFDI 545
           RV +LN R +V  +   +
Sbjct: 365 RVALLNQRLEVISDLLQM 382

>SAKL0C11286g Chr3 complement(1012631..1013917) [1287 bp, 428 aa]
           {ON} highly similar to uniprot|Q05210 Saccharomyces
           cerevisiae YDL001W RMD1 Cytoplasmic protein required for
           sporulation
          Length = 428

 Score =  169 bits (427), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 85/198 (42%), Positives = 129/198 (65%), Gaps = 8/198 (4%)

Query: 349 AQQHAEIFIFNYGVIVFWNFTELEEKNILGDIAFSGMKNMVTRPLDEQDIEIEQFHFEYD 408
           + +  ++FIF YGVIV W FTE EEK +L D+     +      L E+D+++EQF++ Y 
Sbjct: 197 SDKQPDLFIFEYGVIVMWGFTEREEKALLNDV-----EKFEKEKLAEEDVQVEQFNY-YI 250

Query: 409 MDTERPRIFNDIITLRSG-DHIIKLTLSHAIAQSTKLSRFEKRITPILGTVSKLPKRLAL 467
             + +PRI+ND ITLR G +++IKL++SHAIAQS K+S FE+ +   +     +P+ +A 
Sbjct: 251 TQSYQPRIYNDFITLRDGSNYMIKLSISHAIAQSVKISLFEELVDNTIEDTQDIPQEIAS 310

Query: 468 YGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYTAMREYLEIDP 527
            G + + +E ++K  G+LF LR+++NL  SVLD+PE  WS EP L P+Y A R YLEI+ 
Sbjct: 311 SGKVSMSKEDIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYQATRGYLEINQ 369

Query: 528 RVQVLNDRCKVFLEFFDI 545
           RV +LN R +V  +   +
Sbjct: 370 RVALLNQRLEVISDLLQM 387

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 47/99 (47%), Gaps = 19/99 (19%)

Query: 138 PSRTSKTSEKFVLIPDENVKR------------FAQ--GFHKRSASRVFSELSYGEHNTA 183
           P RTS+T++K  L+P+E  +R            ++Q      + A R   +L  G  +  
Sbjct: 66  PQRTSRTAQKLKLLPEEPFQRKDEELELVDKDVYSQVNRITDKPARRDAEKLGKGHRHL- 124

Query: 184 GLPSITAYNVAEGFNLNLASQFLKET---HNVSIRRYDE 219
            LP +TAY  A  +++    ++LK+    H+   + +DE
Sbjct: 125 -LPRVTAYCTASSYSMKELIRWLKDCKRIHHTHTKLFDE 162

>TDEL0D04130 Chr4 (760040..761356) [1317 bp, 438 aa] {ON} Anc_3.209
           YDL001W
          Length = 438

 Score =  168 bits (425), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 84/198 (42%), Positives = 128/198 (64%), Gaps = 8/198 (4%)

Query: 349 AQQHAEIFIFNYGVIVFWNFTELEEKNILGDIAFSGMKNMVTRPLDEQDIEIEQFHFEYD 408
           + +  E++IF YGVIV W FTE EEK  L D     ++      L E+D+++E+F++ Y 
Sbjct: 207 SDKQPELYIFEYGVIVLWGFTEREEKAFLND-----LERFEKEKLAEEDVQVEEFNY-YV 260

Query: 409 MDTERPRIFNDIITLRSG-DHIIKLTLSHAIAQSTKLSRFEKRITPILGTVSKLPKRLAL 467
             + +PRI+ND ITLR G +++IKL++SHAIAQS K+S FE+ +   +     +P+ +A 
Sbjct: 261 TQSYQPRIYNDFITLRDGSNYMIKLSISHAIAQSVKISLFEELVDNTIEDTQDIPQEIAC 320

Query: 468 YGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYTAMREYLEIDP 527
            G + + +E ++K  G+LF LR+++NL  SVLD+PE  WS EP L P+Y A R YLEI+ 
Sbjct: 321 SGKVSMSKEDIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYHATRGYLEINQ 379

Query: 528 RVQVLNDRCKVFLEFFDI 545
           RV +LN R +V  +   +
Sbjct: 380 RVALLNQRLEVISDLLQM 397

 Score = 35.4 bits (80), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 38/158 (24%), Positives = 68/158 (43%), Gaps = 31/158 (19%)

Query: 78  FMPKAGSGRTRQGKFSEVSMDNILSEMSDVPSGRRQERLSSSSFEYERRPAHYNKTIRPL 137
           + PK GS  +   + S    DN  SE+ +  +G+ +             P    K +R  
Sbjct: 30  YTPKPGSVSSGSQRIS----DNTPSEIKNKSNGKPKNM----------NPPAPGKQMRAG 75

Query: 138 PSRTSKTSEKFVLIPDENVKRFAQGFHKRSASRVFSELS-------------YGEHNTAG 184
             RTS+T++K  L+P+E  +R  +    R    V+S++S              G+ +   
Sbjct: 76  AQRTSRTAQKLKLLPEEPFQRDEEMQELRDRD-VYSQVSRITDKPARRDAEKLGKGHRHL 134

Query: 185 LPSITAYNVAEGFNLNLASQFLKET---HNVSIRRYDE 219
           LP  TAY  A  +++    ++LK+    H+   + +DE
Sbjct: 135 LPRATAYCTASSYHMKELIKWLKDCRKIHHTHPKLFDE 172

>TBLA0A00170 Chr1 (16781..18298) [1518 bp, 505 aa] {ON} Anc_3.209
           YDL001W
          Length = 505

 Score =  168 bits (425), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 85/198 (42%), Positives = 129/198 (65%), Gaps = 8/198 (4%)

Query: 349 AQQHAEIFIFNYGVIVFWNFTELEEKNILGDIAFSGMKNMVTRPLDEQDIEIEQFHFEYD 408
           + +  ++FIF YGVIV W F E EE+ +L DI     +      L E+DI+IE+F++ Y 
Sbjct: 274 SDKQPDLFIFEYGVIVMWGFIEREEQALLADI-----ERFEREKLAEEDIQIEEFNY-YV 327

Query: 409 MDTERPRIFNDIITLRSG-DHIIKLTLSHAIAQSTKLSRFEKRITPILGTVSKLPKRLAL 467
             + +PRI+ND ITLR G ++++KL++SHAIAQS K+S FE+ +   +     +P+ +AL
Sbjct: 328 TQSYQPRIYNDFITLRDGSNYMVKLSISHAIAQSVKISLFEELVDNTIEDTQGIPQEIAL 387

Query: 468 YGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYTAMREYLEIDP 527
            G + + +E ++K  G+LF LR+++NL  SVLD+PE  WS EP L P+Y A R YLEI+ 
Sbjct: 388 SGKVSMSKEDIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYQATRGYLEINQ 446

Query: 528 RVQVLNDRCKVFLEFFDI 545
           RV +LN R +V  +   +
Sbjct: 447 RVALLNQRLEVISDLLQM 464

 Score = 32.0 bits (71), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 42/106 (39%), Gaps = 30/106 (28%)

Query: 138 PSRTSKTSEKFVLIPD---------------------ENVKRFAQGFHKRSASRVFSELS 176
           P RTS+T+ K  L+P+                       V R      +R A ++     
Sbjct: 140 PQRTSRTARKLKLLPEGPFQMTPAEFQTDIFPEQEVYSQVNRITDKNARRDAEKL----- 194

Query: 177 YGEHNTAGLPSITAYNVAEGFNLNLASQFLKET---HNVSIRRYDE 219
            G+ +   LP  TAY  A  +N+     +LKET   H  + + +DE
Sbjct: 195 -GKAHRHLLPRTTAYCTASSYNMRGLIHWLKETKKAHQTTPKLFDE 239

>NDAI0A07350 Chr1 complement(1671549..1673117) [1569 bp, 522 aa]
           {ON} Anc_3.209
          Length = 522

 Score =  168 bits (425), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 85/197 (43%), Positives = 129/197 (65%), Gaps = 8/197 (4%)

Query: 350 QQHAEIFIFNYGVIVFWNFTELEEKNILGDIAFSGMKNMVTRPLDEQDIEIEQFHFEYDM 409
           +++ ++FIF YGVIV W FTE EEK  L D     ++      L E+DI+IE+F++ Y  
Sbjct: 291 KRYPDLFIFEYGVIVMWGFTEREEKRFLND-----LEKFEKEKLAEEDIQIEEFNY-YVT 344

Query: 410 DTERPRIFNDIITLRSG-DHIIKLTLSHAIAQSTKLSRFEKRITPILGTVSKLPKRLALY 468
            + +PRI+ND ITLR G +++ KL++SHAIAQS K+S FE+ +   +     +P+ +A  
Sbjct: 345 KSYQPRIYNDFITLRDGSNYMTKLSISHAIAQSVKISLFEELVDNTIEDTQDIPQEIASS 404

Query: 469 GTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYTAMREYLEIDPR 528
           G + + +E+++K  G+LF LR+++NL  SVLD+PE  WS EP L P+Y A R YLEI+ R
Sbjct: 405 GKVSMTKEEIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYQATRGYLEINQR 463

Query: 529 VQVLNDRCKVFLEFFDI 545
           V +LN R +V  +   +
Sbjct: 464 VALLNQRLEVISDLLQM 480

>KLLA0E17381g Chr5 complement(1540387..1541721) [1335 bp, 444 aa]
           {ON} similar to uniprot|Q05210 Saccharomyces cerevisiae
           YDL001W RMD1 Cytoplasmic protein required for
           sporulation
          Length = 444

 Score =  166 bits (421), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 84/198 (42%), Positives = 128/198 (64%), Gaps = 8/198 (4%)

Query: 349 AQQHAEIFIFNYGVIVFWNFTELEEKNILGDIAFSGMKNMVTRPLDEQDIEIEQFHFEYD 408
           + +  ++FIF YGVIV W FTE EEK  L D     ++      L E+D+++EQF++ Y 
Sbjct: 213 SDKQPDLFIFEYGVIVMWGFTEREEKAFLRD-----LERFEKEKLAEEDVQVEQFNY-YI 266

Query: 409 MDTERPRIFNDIITLRSG-DHIIKLTLSHAIAQSTKLSRFEKRITPILGTVSKLPKRLAL 467
             + +PRI+ND ITLR G +++IKL++SHAIAQS K+S FE+ +   +     +P+ +A 
Sbjct: 267 TQSYQPRIYNDFITLRDGSNYMIKLSISHAIAQSVKISLFEELVDNTIEDTQDIPQEIAS 326

Query: 468 YGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYTAMREYLEIDP 527
            G + + +E ++K  G+LF LR+++NL  SVLD+PE  WS EP L P+Y A R YLEI+ 
Sbjct: 327 SGKVSMSKEDIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYQATRGYLEINQ 385

Query: 528 RVQVLNDRCKVFLEFFDI 545
           RV ++N R +V  +   +
Sbjct: 386 RVALVNQRLEVISDLLQM 403

>KNAG0K01490 Chr11 (310336..311553) [1218 bp, 405 aa] {ON} Anc_3.209
           YDL001W
          Length = 405

 Score =  165 bits (418), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 86/215 (40%), Positives = 135/215 (62%), Gaps = 16/215 (7%)

Query: 340 QHEREKVLDAQ--------QHAEIFIFNYGVIVFWNFTELEEKNILGDIAFSGMKNMVTR 391
           +HE    LDA+        +  ++F+F YGV+V W FTE EEK  L DI           
Sbjct: 158 EHEDVIRLDAEGGEINVSDKQPDLFVFEYGVVVMWGFTEREEKAFLSDI-----DRFEKE 212

Query: 392 PLDEQDIEIEQFHFEYDMDTERPRIFNDIITLRSG-DHIIKLTLSHAIAQSTKLSRFEKR 450
            L ++D+++E+F++ Y   + +PRI+ND ITLR G ++++KL+++HAIAQS K+S FE+ 
Sbjct: 213 KLADEDVQVEEFNY-YVTQSYQPRIYNDFITLRDGSNYMVKLSIAHAIAQSVKISFFEEL 271

Query: 451 ITPILGTVSKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEP 510
           +   +     +P+ +AL G + + +E+++K  G+LF LR+++NL  SVLD+PE  WS EP
Sbjct: 272 VDNTIEDTQDIPQEIALSGKVSMTKEEIMKSIGELFILRININLHGSVLDSPEIMWS-EP 330

Query: 511 SLHPLYTAMREYLEIDPRVQVLNDRCKVFLEFFDI 545
            L P+Y A R YLEI+ RV +LN R +V  +   +
Sbjct: 331 QLEPIYQATRGYLEINQRVALLNQRLEVISDLLQM 365

>Kwal_27.11001 s27 complement(593288..594514) [1227 bp, 408 aa] {ON}
           YDL001W - Hypothetical ORF [contig 32] FULL
          Length = 408

 Score =  165 bits (417), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 84/198 (42%), Positives = 129/198 (65%), Gaps = 8/198 (4%)

Query: 349 AQQHAEIFIFNYGVIVFWNFTELEEKNILGDIAFSGMKNMVTRPLDEQDIEIEQFHFEYD 408
           + +  ++FIF YGV+V W FTE EEK  L D     ++      L E+D+++EQF++ Y 
Sbjct: 177 SDKQPDLFIFEYGVVVMWGFTEREEKAFLND-----LEKFEKEKLAEEDVQLEQFNY-YI 230

Query: 409 MDTERPRIFNDIITLRSG-DHIIKLTLSHAIAQSTKLSRFEKRITPILGTVSKLPKRLAL 467
             + +PRI+ND ITLR G +++IKL++SHAIAQS K+S FE+ +   +     +P+++A 
Sbjct: 231 TQSYQPRIYNDFITLRDGSNYMIKLSISHAIAQSVKISLFEELVDNTIEDTQDIPQQIAS 290

Query: 468 YGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYTAMREYLEIDP 527
            G + + +E ++K  G+LF LR+++NL  SVLD+PE  WS EP L P+Y A R YLEI+ 
Sbjct: 291 SGKVSMGKEDIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYHATRGYLEINQ 349

Query: 528 RVQVLNDRCKVFLEFFDI 545
           RV +LN R +V  +   +
Sbjct: 350 RVALLNQRLEVISDLLQM 367

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 46/104 (44%), Gaps = 16/104 (15%)

Query: 132 KTIRPLPSRTSKTSEKFVLIPDENVKRFAQGFHKRSASRVFSELS-------------YG 178
           K  R  P RTS+T++K  L+P+E   R        +   V+S++               G
Sbjct: 39  KASRVGPQRTSRTTQKLKLLPEEPFNRQQDELLSSTDREVYSQVGRITDTPARRDAEKLG 98

Query: 179 EHNTAGLPSITAYNVAEGFNLNLASQFLKET---HNVSIRRYDE 219
           +     LP +TAY  +  +N+    ++LK+    H+   + +DE
Sbjct: 99  KGQRHLLPRVTAYCTSSSYNMKELIRWLKDCKKVHHTHPKLFDE 142

>KLTH0G16544g Chr7 complement(1435479..1436705) [1227 bp, 408 aa]
           {ON} similar to uniprot|Q05210 Saccharomyces cerevisiae
           YDL001W RMD1 Cytoplasmic protein required for
           sporulation
          Length = 408

 Score =  164 bits (415), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 83/198 (41%), Positives = 128/198 (64%), Gaps = 8/198 (4%)

Query: 349 AQQHAEIFIFNYGVIVFWNFTELEEKNILGDIAFSGMKNMVTRPLDEQDIEIEQFHFEYD 408
           + +  ++FIF YGVIV W FTE EEK  L D+     +      L E+D+++EQF++ Y 
Sbjct: 177 SDKQPDLFIFEYGVIVMWGFTEREEKAFLNDV-----EKFEKEKLAEEDVQVEQFNY-YI 230

Query: 409 MDTERPRIFNDIITLRSG-DHIIKLTLSHAIAQSTKLSRFEKRITPILGTVSKLPKRLAL 467
             + +PRI+ND ITLR G ++++KL++SHAIAQS K+S FE+ +   +     +P+++A 
Sbjct: 231 TQSYQPRIYNDFITLRDGSNYMVKLSISHAIAQSVKISLFEELVDNTIEDTQDIPQQIAS 290

Query: 468 YGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYTAMREYLEIDP 527
            G + + +  ++K  G+LF LR+++NL  SVLD+PE  WS EP L P+Y A R YLEI+ 
Sbjct: 291 SGKVSMGKADIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYHATRGYLEINQ 349

Query: 528 RVQVLNDRCKVFLEFFDI 545
           RV +LN R +V  +   +
Sbjct: 350 RVALLNQRLEVISDLLQM 367

>ZYRO0A04400g Chr1 (359271..360647) [1377 bp, 458 aa] {ON} similar
           to uniprot|Q05210 Saccharomyces cerevisiae YDL001W RMD1
           Cytoplasmic protein required for sporulation
          Length = 458

 Score =  165 bits (418), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 83/198 (41%), Positives = 128/198 (64%), Gaps = 8/198 (4%)

Query: 349 AQQHAEIFIFNYGVIVFWNFTELEEKNILGDIAFSGMKNMVTRPLDEQDIEIEQFHFEYD 408
           + +  ++F+F YGV+V W FTE EEK  L DI     +      L E+D++IE+F++ Y 
Sbjct: 227 SDKQPDLFVFEYGVVVLWGFTEREEKAFLNDI-----EGFEKEKLAEEDVQIEEFNY-YV 280

Query: 409 MDTERPRIFNDIITLR-SGDHIIKLTLSHAIAQSTKLSRFEKRITPILGTVSKLPKRLAL 467
             + +PRI+ND ITLR + +++IKL++SHAIAQS K+S FE+ +   +     +P+ +A 
Sbjct: 281 TQSYQPRIYNDFITLRDASNYMIKLSISHAIAQSVKISLFEELVDNTIEDTQDIPQEIAS 340

Query: 468 YGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYTAMREYLEIDP 527
            G + + +E ++K  G+LF LR+++NL  SVLD+PE  WS EP L P+Y A R YLEI+ 
Sbjct: 341 SGKVSMSKEDIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYQATRGYLEINQ 399

Query: 528 RVQVLNDRCKVFLEFFDI 545
           RV +LN R +V  +   +
Sbjct: 400 RVALLNQRLEVVSDLLQM 417

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 51/105 (48%), Gaps = 17/105 (16%)

Query: 131 NKTIRPLPSRTSKTSEKFVLIPDENVKRFAQGFHKRSASRVFSELS-------------Y 177
           NK IR    RTS+T++K  L+P+E  +R  +    R    V+S+++              
Sbjct: 89  NKQIRTGAQRTSRTAQKLKLLPEEPFQRDEESLDLRDRD-VYSQVNRITDKPARRDAEKL 147

Query: 178 GEHNTAGLPSITAYNVAEGFNLNLASQFLKET---HNVSIRRYDE 219
           G+ +   LP  TAY  A G+++    ++LKE    H+   + +DE
Sbjct: 148 GKSHRHLLPRATAYCTASGYSMRELVRWLKECKKIHHTHPKLFDE 192

>Kpol_1045.58 s1045 (139327..140670) [1344 bp, 447 aa] {ON}
           (139329..140672) [1344 nt, 448 aa]
          Length = 447

 Score =  165 bits (417), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 82/199 (41%), Positives = 129/199 (64%), Gaps = 8/199 (4%)

Query: 349 AQQHAEIFIFNYGVIVFWNFTELEEKNILGDIAFSGMKNMVTRPLDEQDIEIEQFHFEYD 408
           + +  ++FIF YGV+V W FTE EEK  L DI     +      L E+D+++E+F++ Y 
Sbjct: 214 SDKQPDVFIFEYGVVVMWGFTEREEKAFLNDI-----EKFEKEKLAEEDVQVEEFNY-YI 267

Query: 409 MDTERPRIFNDIITLR-SGDHIIKLTLSHAIAQSTKLSRFEKRITPILGTVSKLPKRLAL 467
            ++ +PRI+ND ITLR + +++IKL++SH +AQS K+S FE+ +   +     +P+ +A 
Sbjct: 268 TESYQPRIYNDFITLRDASNYMIKLSISHGLAQSVKISLFEELVDNTIEDTQDIPQEIAS 327

Query: 468 YGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYTAMREYLEIDP 527
            G + + +E ++K  G+LF LR+++NL  SVLD+PE  WS EP L P+Y AMR YLEI+ 
Sbjct: 328 SGKVSMSKEDIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYQAMRGYLEINQ 386

Query: 528 RVQVLNDRCKVFLEFFDIC 546
           RV +LN R +V  +   + 
Sbjct: 387 RVALLNQRLEVISDLLQML 405

>KAFR0F02500 Chr6 complement(484705..486105) [1401 bp, 466 aa] {ON}
           Anc_3.209 YDL001W
          Length = 466

 Score =  165 bits (417), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 82/198 (41%), Positives = 130/198 (65%), Gaps = 8/198 (4%)

Query: 349 AQQHAEIFIFNYGVIVFWNFTELEEKNILGDIAFSGMKNMVTRPLDEQDIEIEQFHFEYD 408
           + +  ++FIF YGVIV W FTE EEK  L DI     +      L E+D+++E+F++ Y 
Sbjct: 235 SDKQPDLFIFEYGVIVMWGFTEREEKAFLNDI-----ERFEKEKLAEEDVQVEEFNY-YV 288

Query: 409 MDTERPRIFNDIITLRSG-DHIIKLTLSHAIAQSTKLSRFEKRITPILGTVSKLPKRLAL 467
             + +PRI+ND ITLR+G +++ KL++SHAIAQS K+S FE+ +   +     +P+++A 
Sbjct: 289 TQSYQPRIYNDFITLRNGSNYMTKLSISHAIAQSVKISLFEELVDNTIEDTEDIPQQIAS 348

Query: 468 YGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYTAMREYLEIDP 527
            G + + +E +++  G+LF LR+++NL  SVLD+P+  WS EP L P+Y A R YLEI+ 
Sbjct: 349 SGKVSMSKEDIMRSIGELFILRININLHGSVLDSPDIMWS-EPQLEPIYQATRGYLEINQ 407

Query: 528 RVQVLNDRCKVFLEFFDI 545
           RV++LN R +V  +   +
Sbjct: 408 RVELLNQRLEVVSDLLQM 425

>TPHA0P00550 Chr16 complement(110346..111686) [1341 bp, 446 aa] {ON}
           Anc_3.209 YDL001W
          Length = 446

 Score =  164 bits (415), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 82/191 (42%), Positives = 126/191 (65%), Gaps = 8/191 (4%)

Query: 349 AQQHAEIFIFNYGVIVFWNFTELEEKNILGDIAFSGMKNMVTRPLDEQDIEIEQFHFEYD 408
           + +  ++FIF YGV+V W FTE EEK  L DI     +      L E+DI+IE+F++ Y 
Sbjct: 215 SDKQPDVFIFEYGVVVLWGFTEREEKEFLNDI-----EKYEKEKLAEEDIQIEEFNY-YV 268

Query: 409 MDTERPRIFNDIITLRSG-DHIIKLTLSHAIAQSTKLSRFEKRITPILGTVSKLPKRLAL 467
            ++ +PRI+ND ITLR G +++ KL++SHA++QS K+S FE+ +   +     +P+ +A 
Sbjct: 269 TESYQPRIYNDFITLRDGSNYMTKLSISHALSQSVKISLFEELLDNTIEDTQDIPQEIAS 328

Query: 468 YGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYTAMREYLEIDP 527
            G + + +E ++K  G+LF LR+++NL  S+LD+PE  WS EP L P+Y A R YLEI+ 
Sbjct: 329 SGKVSMSKEDIMKSIGELFILRININLHGSILDSPEIMWS-EPQLEPIYQATRGYLEINQ 387

Query: 528 RVQVLNDRCKV 538
           RV +LN R +V
Sbjct: 388 RVALLNQRLEV 398

 Score = 34.3 bits (77), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 44/92 (47%), Gaps = 13/92 (14%)

Query: 131 NKTIRPLPSRTSKTSEKFVLIPDENVKRFAQGFHKRSASRVFSELS-------------Y 177
           NK +R    RTS+T++K  L+P+E        F     + V+S+++              
Sbjct: 76  NKHVRSGAQRTSRTTQKLKLLPEEPYDLDHNNFPDLPENEVYSQVNRIKDKSARRDAEKL 135

Query: 178 GEHNTAGLPSITAYNVAEGFNLNLASQFLKET 209
           G+ +   LP +TA+  A  +N+    ++LK++
Sbjct: 136 GKAHRHLLPRVTAFCTASSYNMRGLIRWLKDS 167

>AEL004W Chr5 (630125..631552) [1428 bp, 475 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL001W (RMD1)
          Length = 475

 Score =  162 bits (411), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 81/198 (40%), Positives = 127/198 (64%), Gaps = 8/198 (4%)

Query: 349 AQQHAEIFIFNYGVIVFWNFTELEEKNILGDIAFSGMKNMVTRPLDEQDIEIEQFHFEYD 408
           + +  ++FIF YGV+V W FTE EEK  L D     ++      L E+D+++E+F++ Y 
Sbjct: 244 SDKQPDLFIFEYGVVVMWGFTEREEKAFLND-----LERFEKEKLAEEDVQVEEFNY-YI 297

Query: 409 MDTERPRIFNDIITLRSG-DHIIKLTLSHAIAQSTKLSRFEKRITPILGTVSKLPKRLAL 467
             + +PRI+ND ITLR G +++IKL++SHAI+QS K+S FE+ +   +     +P+ +A 
Sbjct: 298 TQSYQPRIYNDFITLRDGSNYMIKLSISHAISQSVKISLFEELVDNTIEDTQDIPQEIAS 357

Query: 468 YGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYTAMREYLEIDP 527
            G + + +  ++K  G+LF LR+++NL  SVLD+PE  WS EP L P+Y A R YLEI+ 
Sbjct: 358 SGKVSMSKADIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYQATRGYLEINQ 416

Query: 528 RVQVLNDRCKVFLEFFDI 545
           RV +LN R +V  +   +
Sbjct: 417 RVALLNQRLEVVSDLLQM 434

 Score = 39.3 bits (90), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 48/98 (48%), Gaps = 16/98 (16%)

Query: 138 PSRTSKTSEKFVLIPDENVKRFAQGFHKRSASRVFSELS-------------YGEHNTAG 184
           P RTS+T++K  L+P+E  +R  +         V+S+++              G+ +   
Sbjct: 112 PQRTSRTAQKLKLLPEEPFQRSQEQEDDSVDREVYSQVNRITDKPARRDAEKLGKSHRHL 171

Query: 185 LPSITAYNVAEGFNLNLASQFLKE---THNVSIRRYDE 219
           LP +TAY  A  +N+    ++LK+   TH+   + +DE
Sbjct: 172 LPRVTAYCTASSYNMKELVRWLKDCKRTHHTHPKLFDE 209

>Ecym_5293 Chr5 (595331..596764) [1434 bp, 477 aa] {ON} similar to
           Ashbya gossypii AEL004W
          Length = 477

 Score =  162 bits (410), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 81/198 (40%), Positives = 126/198 (63%), Gaps = 8/198 (4%)

Query: 349 AQQHAEIFIFNYGVIVFWNFTELEEKNILGDIAFSGMKNMVTRPLDEQDIEIEQFHFEYD 408
             +  ++FIF YGV+V W FTE EEK  L D+     +      L E+D+++E+F++ Y 
Sbjct: 244 GDKQPDLFIFEYGVVVMWGFTEREEKAFLNDV-----EKFEKEKLAEEDVQVEEFNY-YV 297

Query: 409 MDTERPRIFNDIITLRSG-DHIIKLTLSHAIAQSTKLSRFEKRITPILGTVSKLPKRLAL 467
             + +PRI+ND ITLR G +++IKL++SHAI+QS K+S FE+ +   +     +P+ +A 
Sbjct: 298 TQSYQPRIYNDFITLRDGSNYMIKLSISHAISQSVKISLFEELVDNTIEDTQDIPQEIAS 357

Query: 468 YGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYTAMREYLEIDP 527
            G + + +  ++K  G+LF LR+++NL  SVLD+PE  WS EP L P+Y A R YLEI+ 
Sbjct: 358 SGKVSMSKADIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYQATRGYLEINQ 416

Query: 528 RVQVLNDRCKVFLEFFDI 545
           RV +LN R +V  +   +
Sbjct: 417 RVALLNQRLEVVSDLLQM 434

 Score = 38.9 bits (89), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 51/110 (46%), Gaps = 16/110 (14%)

Query: 126 RPAHYNKTIRPLPSRTSKTSEKFVLIPDENVKRFAQGFHKRSASRVFSELS--------- 176
           +P +   T +  P RTS+T++K  L+P+E  +R  +         V+S+++         
Sbjct: 100 KPTNNTATTKLGPQRTSRTAQKLKLLPEEPFQRIREQDCDIIDRDVYSQVNRITDKPARR 159

Query: 177 ----YGEHNTAGLPSITAYNVAEGFNLNLASQFL---KETHNVSIRRYDE 219
                G+     LP  TAY  A  +N+    ++L   K+TH+   + +DE
Sbjct: 160 DAEKLGKSQRHLLPRATAYCTASSYNMKELVRWLKYCKKTHHTHPKLFDE 209

>YDR282C Chr4 complement(1023511..1024755) [1245 bp, 414 aa] {ON}
           Putative protein of unknown function
          Length = 414

 Score = 75.5 bits (184), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 56/213 (26%), Positives = 98/213 (46%), Gaps = 34/213 (15%)

Query: 361 GVIVFWNFTELEEKNILGDIAFSGMKNMVTRPLDEQDIEIEQFHF---EYDMDTERPRIF 417
           G IV W F+E   +N +  I  +   N    PL+ +D E E   +   E + D ++    
Sbjct: 161 GSIVSWGFSESSVRNCIVPIVKAASLN----PLNGEDFETEDMDYVEIEGEQDFDKLSSL 216

Query: 418 NDIITLR-------SGDHII------------KLTLSHAIAQSTKLSRFEKRITPILGTV 458
           ++ +T R       SGD II            K   S  +++ST L+  E+ +   +   
Sbjct: 217 DNKVTPRIACESFLSGDLIIINSLDSDQGMLDKAAFSSGLSRSTNLAVLEEAMEKHISKT 276

Query: 459 SKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYTA 518
             + + ++    L L+    LK  G+LF +R  +NL S +++TP+ +WS EP L  ++  
Sbjct: 277 RTITENISKGTKLNLRSSDALKSIGRLFLIRGKLNLYSELIETPDLYWS-EPQLEEIFKN 335

Query: 519 MREYLEIDPRVQVLN-------DRCKVFLEFFD 544
           +  YL+I PR+ +LN       D C+  +   +
Sbjct: 336 VSRYLDIGPRINILNSKLDYSTDECRALISLLN 368

>Skud_4.545 Chr4 complement(966078..967319) [1242 bp, 413 aa] {ON}
           YDR282C (REAL)
          Length = 413

 Score = 74.7 bits (182), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 59/213 (27%), Positives = 97/213 (45%), Gaps = 34/213 (15%)

Query: 361 GVIVFWNFTELEEKNILGDIAFSGMKNMVTRPLDEQDIEIEQFHF---EYDMDTERPRIF 417
           G IV W F E   +N +  +  +   N    PL E+D E E   +   E   D E+    
Sbjct: 161 GSIVGWGFGESTVRNKIVPLVKAASIN----PLSEEDFETEDMDYVELEKKKDLEKLFSG 216

Query: 418 NDIITLR-------SGDHII------------KLTLSHAIAQSTKLSRFEKRITPILGTV 458
           N  +TL+       SGD I+            K   S  +++ST L+  E+ +   +   
Sbjct: 217 NKNVTLKTVDQSFLSGDLILINSLDSDQGMLDKAAFSSGLSRSTNLAVLEEAMERHISKT 276

Query: 459 SKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYTA 518
             + + ++   TL LK    LK  G+LF +R  +NL S +++TP+ +WS EP L  ++  
Sbjct: 277 RTITENISKGTTLKLKSSDALKSIGRLFLIRGKLNLYSELIETPDLYWS-EPQLELIFKN 335

Query: 519 MREYLEIDPRVQVLN-------DRCKVFLEFFD 544
           +  YL+I PR+ +LN       D C+  +   +
Sbjct: 336 VSRYLDIVPRINILNSKLDYSTDECRALISLLN 368

>KLLA0C11165g Chr3 complement(957421..958491) [1071 bp, 356 aa] {ON}
           similar to uniprot|Q05648 Saccharomyces cerevisiae
           YDR282C Hypothetical ORF
          Length = 356

 Score = 73.2 bits (178), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 54/237 (22%), Positives = 111/237 (46%), Gaps = 21/237 (8%)

Query: 361 GVIVFWNFTELEEKN-ILGDIAFSGMKNMVTRPLDEQDIEIEQFHFEYDMDT-------- 411
           G IV W F E   ++ IL  ++ + + +++    + +D++  +   E DM+         
Sbjct: 107 GSIVSWGFNETVMRDEILPLVSTARVNSLLDSQYESEDLDYVELENEDDMNNLKRDYSIN 166

Query: 412 ERPRIFNDIITLRSGDH----IIKLTLSHAIAQSTKLSRFEKRITPILGTVSKLPKRLAL 467
           +   + N++I +   +H    + K   S  I++ST+L+  E  +   +    +  + L+ 
Sbjct: 167 DESCVTNELIIINGVEHEKALLDKAAFSSGISRSTRLAVLEVALDAHIEKTREFTESLSR 226

Query: 468 YGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYTAMREYLEIDP 527
              L +  + +L+ +G+LF +R  +NL S +++TP+ +WS EP L  LY  +   L+I P
Sbjct: 227 GKKLNISEKAVLQSTGRLFLMRGKLNLYSELIETPDLYWS-EPQLEKLYRQISRNLDIQP 285

Query: 528 RVQVLNDRCKVFLEFFDICVNSIAEKDMARITWWXXXXXXXXXXXXTAEILARIFHY 584
           R+ +LN +     +     +  + EK   R+ W             T E+   ++H+
Sbjct: 286 RISILNTKLDYATDEARALMAVLNEKKGTRLEW-------IIIYLITVEVCFELYHF 335

>KLTH0G06622g Chr7 (527870..529048) [1179 bp, 392 aa] {ON} similar
           to uniprot|Q05648 Saccharomyces cerevisiae YDR282C
           Hypothetical ORF
          Length = 392

 Score = 70.5 bits (171), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 61/248 (24%), Positives = 109/248 (43%), Gaps = 23/248 (9%)

Query: 352 HAEIFIF-NYGVIVFWNFTE-LEEKNILGDIAFSGMKNMVTRPLDEQDIEIEQFHFEYDM 409
           H++I +  N G +V W   E    +NIL  I    +  +    ++ +D++  Q     D+
Sbjct: 136 HSDIMVLGNSGTVVAWGLEESFVFENILPLIEHGRVNPLTEECVESEDLDFLQVENAEDL 195

Query: 410 DTER-------PRIF--NDIITLRSGDHII----KLTLSHAIAQSTKLSRFEKRITPILG 456
           +  R       P  F   D+I + + D  +    K   S  +++ST+L+  E  +   + 
Sbjct: 196 EKVRQITNRSAPESFVEGDLIIVNAIDSDLGLLDKAAFSSGMSRSTRLAVLEHLLEAHIE 255

Query: 457 TVSKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLY 516
              K  + L+    L L   ++L+ +G LF +R  +NL S +++TP+ +WS EP L  +Y
Sbjct: 256 KSRKFTELLSQGKKLSLTESEVLQSTGSLFLIRGKLNLYSELIETPDLYWS-EPQLERIY 314

Query: 517 TAMREYLEIDPRVQVLNDRCKVFLEFFDICVNSIAEKDMARITWWXXXXXXXXXXXXTAE 576
             M   L+I PR+ +LN +     E     +  + EK    + W             T E
Sbjct: 315 KQMSRSLDIQPRISILNTKLDYATEESRAFMAVLNEKKSTHLEW-------IIIYLITVE 367

Query: 577 ILARIFHY 584
           +   + HY
Sbjct: 368 VFFELHHY 375

>Ecym_4743 Chr4 complement(1450271..1451371) [1101 bp, 366 aa] {ON}
           similar to Ashbya gossypii AAL122C
          Length = 366

 Score = 70.5 bits (171), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 62/257 (24%), Positives = 109/257 (42%), Gaps = 33/257 (12%)

Query: 348 DAQQHAEIFIFNYGVIVFWNFTELEE-KNILGDIAFSGMKNMVTRPLDEQDIEIEQFHFE 406
           D  Q   + I   G +V W   E  + +NIL  +  + +      PL E+  E E   + 
Sbjct: 105 DGHQGDVMIIRQNGTVVAWGLDESSQMENILPLVDEARI-----NPLKEKQYESEDLDYV 159

Query: 407 YDMDTERPRIFNDII-------TLRSGDHII------------KLTLSHAIAQSTKLSRF 447
               TE     +DI        +   GD I+            K  LS  +++ST+LS  
Sbjct: 160 ELDTTESWTQLHDITNRGEANESFVEGDLIVINSISANHGMLDKAALSGGLSRSTRLSVL 219

Query: 448 EKRITPILGTVSKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWS 507
           E  +   +    K  + L+    L      +L+ +G+LF +R ++NL S +++TP+ +WS
Sbjct: 220 EAALESHIAKTKKFTELLSSGKKLNFTENHILESTGRLFLIRGNLNLYSELIETPDLYWS 279

Query: 508 FEPSLHPLYTAMREYLEIDPRVQVLNDRCKVFLEFFDICVNSIAEKDMARITWWXXXXXX 567
            EP L  LY  +   L+I PR+ +LN +     +     ++ + EK   ++ W       
Sbjct: 280 -EPDLEKLYEKISRNLDIQPRITILNKKLDYATDESRALLSVLNEKKSTKLEW------- 331

Query: 568 XXXXXXTAEILARIFHY 584
                 + E+   +FH+
Sbjct: 332 IIIWLISVEVCFELFHF 348

>SAKL0G10582g Chr7 (900403..901554) [1152 bp, 383 aa] {ON} similar
           to uniprot|Q05648 Saccharomyces cerevisiae YDR282C
           Hypothetical ORF
          Length = 383

 Score = 70.5 bits (171), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 58/238 (24%), Positives = 108/238 (45%), Gaps = 22/238 (9%)

Query: 361 GVIVFWNFTE-LEEKNILGDIAFSGMKNMVTRPLDEQD---------IEIEQFHFEYDMD 410
           G +V W F E    +NIL  I+ + +  +  +  + +D         IE+EQ        
Sbjct: 146 GSVVSWGFDETCLTENILPLISPARVNPLAPKQFESEDMDYVELENSIELEQLKSVTHKI 205

Query: 411 TERPRIFNDIITLRSGDH----IIKLTLSHAIAQSTKLSRFEKRITPILGTVSKLPKRLA 466
            +   I  D+I + S D     + K   S  +++ST+L+  E  +   +    +  + L+
Sbjct: 206 DDGSFIEGDLIVINSTDSEQGLLDKAAFSSGMSRSTRLAVLEGALETHIEKTREFTELLS 265

Query: 467 LYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYTAMREYLEID 526
           +   L L    +LK +G+LF +R  +NL S +++TP+ +WS EP L  +Y  + + L+I 
Sbjct: 266 VGKKLNLTESDVLKYTGRLFLMRGKLNLYSELIETPDLYWS-EPRLEKIYKQISKNLDIH 324

Query: 527 PRVQVLNDRCKVFLEFFDICVNSIAEKDMARITWWXXXXXXXXXXXXTAEILARIFHY 584
           PR+ +LN +     +     +  + EK   R+ W             T E+   ++H+
Sbjct: 325 PRITILNTKLDYATDESRALMAVLNEKKSTRLEW-------IIIYLITIEVCFELYHF 375

>Suva_2.448 Chr2 complement(788042..789295) [1254 bp, 417 aa] {ON}
           YDR282C (REAL)
          Length = 417

 Score = 69.3 bits (168), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 56/224 (25%), Positives = 99/224 (44%), Gaps = 31/224 (13%)

Query: 361 GVIVFWNFTELEEKNILGDIAFSGMKNMVTRPLDEQDIEIEQFHF---EYDMDTER---- 413
           G IV W F E    + + D     ++     PL ++D E E   +       D E+    
Sbjct: 161 GSIVSWGFGE----STVRDKIVPLVEGASINPLAKEDFETEDMDYVELAKKQDLEKFFSG 216

Query: 414 -----PRIFNDIITLRSGDHII------------KLTLSHAIAQSTKLSRFEKRITPILG 456
                PR  N+  +  SGD I+            K   S  +++ST L+  E+ +   + 
Sbjct: 217 NNEVKPRFVNE--SFLSGDLILINSLDADQGMLDKAAFSSGLSRSTNLAVLEEALEKHIS 274

Query: 457 TVSKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLY 516
               + + ++    L LK    LK  G+LF +R  +NL S + +TP+ +WS EP L  ++
Sbjct: 275 KTRTITENISKGTKLNLKSSDALKSIGRLFLIRGKLNLYSELTETPDLYWS-EPQLEEIF 333

Query: 517 TAMREYLEIDPRVQVLNDRCKVFLEFFDICVNSIAEKDMARITW 560
             +  YL+I PR+ +LN +     +     ++ + E++ A + W
Sbjct: 334 KKVSRYLDIGPRINILNSKLDYSTDECRALISLLNERNGAFLEW 377

>Smik_4.531 Chr4 complement(955033..956277) [1245 bp, 414 aa] {ON}
           YDR282C (REAL)
          Length = 414

 Score = 68.9 bits (167), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 54/213 (25%), Positives = 95/213 (44%), Gaps = 34/213 (15%)

Query: 361 GVIVFWNFTELEEKNILGDIAFSGMKNMVTRPLDEQDIEIEQFHF-EYDMDTERPRIFN- 418
           G IV W F E   +N +  +  +   N    PL  Q+ E E   + E + + +  + FN 
Sbjct: 161 GSIVSWGFDESSVRNKIVPLIEAASIN----PLSAQNFETEDMDYVELEKNQDLEKYFNR 216

Query: 419 ----------------DIITLRSGDH----IIKLTLSHAIAQSTKLSRFEKRITPILGTV 458
                           D+I + S D     + K   S  +++ST L+  E+ +   +   
Sbjct: 217 NSKLTPKNADQSFLCGDLILINSLDSDQGMLDKAAFSSGLSRSTNLAVLEEAMEKHILKT 276

Query: 459 SKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYTA 518
             + + ++    L LK    LK  G+LF +R  +NL S +++TP+ +WS EP L  ++  
Sbjct: 277 RTITENISRGTKLNLKSSDALKSIGRLFLIRGKLNLYSELIETPDLYWS-EPQLEEIFKN 335

Query: 519 MREYLEIDPRVQVLN-------DRCKVFLEFFD 544
           +  YL+I PR+ +LN       D C+  +   +
Sbjct: 336 VSRYLDIAPRINILNSKLDYSTDECRALISLLN 368

>Kwal_23.5643 s23 complement(1249364..1250488) [1125 bp, 374 aa]
           {ON} YDR282C - Hypothetical ORF [contig 11] FULL
          Length = 374

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 63/249 (25%), Positives = 107/249 (42%), Gaps = 27/249 (10%)

Query: 353 AEIFIF-NYGVIVFWNFTE-LEEKNILGDIAFSGMKNMVTRPLDEQDIEIEQFHFEYDMD 410
           ++I I  N G +V W   E    +NIL  I  + +  +    ++ +D++      E   D
Sbjct: 123 SDIMILGNSGTVVSWGIDESFTLENILPLIQSARINPLAENAMESEDLD--YLEIESIED 180

Query: 411 TERPR-----------IFNDIITLRSGD----HIIKLTLSHAIAQSTKLSRFEKRITPIL 455
            ER R           +  D+I + S D     + K   S  I++ST+L+  E+ +   +
Sbjct: 181 LERVRHTLSRSVDGSFVEGDLIVVNSIDPELGLLDKAAFSSGISRSTRLAILEELLEAHI 240

Query: 456 GTVSKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPL 515
               K  + L+    L L    +L+ +G LF +R  +NL S + +TP+ +WS EP L  +
Sbjct: 241 EKTRKFTENLSDGKRLNLTESMVLRSTGSLFLIRGKLNLYSELTETPDLYWS-EPQLERI 299

Query: 516 YTAMREYLEIDPRVQVLNDRCKVFLEFFDICVNSIAEKDMARITWWXXXXXXXXXXXXTA 575
           Y  M   L+I PR+ +LN +     E     +  + EK    + W             T 
Sbjct: 300 YKQMSRSLDIQPRIAILNTKLDYATEESRAFMAVLNEKKGTHLEW-------IIIYLITV 352

Query: 576 EILARIFHY 584
           E+   + HY
Sbjct: 353 EVCFELHHY 361

>CAGL0H01045g Chr8 complement(98818..99903) [1086 bp, 361 aa] {ON}
           similar to uniprot|Q05648 Saccharomyces cerevisiae
           YDR282c
          Length = 361

 Score = 66.2 bits (160), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 45/184 (24%), Positives = 87/184 (47%), Gaps = 26/184 (14%)

Query: 415 RIFNDIITLRSGDH----IIKLTLSHAIAQSTKLSRFEKRITPILGTVSKLPKRLALYGT 470
           R+  D+I + S +     + K   S  +++ST L+  E  +   +     + ++++    
Sbjct: 182 RLIGDVILINSIEKSEGILDKAAFSSGLSRSTALAVLENAMERHISNTRIITEKISTGIK 241

Query: 471 LGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYTAMREYLEIDPRVQ 530
           L +K    LK  G+LF +R  +NL S +++TP+ +WS EP L  ++  +  YL+I PR+ 
Sbjct: 242 LKVKESDALKSIGRLFLIRGRLNLYSELIETPDLYWS-EPELEIIFKDVSRYLDISPRIN 300

Query: 531 VLN-------DRCKVFLEFFDICVNSIAEKDMARITWWXXXXXXXXXXXXTAEILARIFH 583
           +LN       D C+  L   +       E++ + + W             T E++  +FH
Sbjct: 301 ILNSKLDYSTDECRAILSLLN-------ERNSSFLEW-------IIIYLITFEVIFELFH 346

Query: 584 YKKT 587
           + K+
Sbjct: 347 FYKS 350

>TPHA0D01710 Chr4 complement(356399..357559) [1161 bp, 386 aa] {ON}
           Anc_5.291 YDR282C
          Length = 386

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 58/240 (24%), Positives = 101/240 (42%), Gaps = 28/240 (11%)

Query: 361 GVIVFWNFTELEEKNILGDIAFSGMKNMVTRPLDEQDIEIEQFHF---------EYDMDT 411
           G ++ W   E E    L D     +      PLDE   E E   F           +M++
Sbjct: 146 GSVISWGLNEKE----LLDNFIPILSEARINPLDESKYETEDIDFIEIENSKALSKNMES 201

Query: 412 ER---PRIFNDIITLRSGD----HIIKLTLSHAIAQSTKLSRFEKRITPILGTVSKLPKR 464
                  I +D++ + S D     + K   S  IA+ST L+  E  +         + ++
Sbjct: 202 HLHNGSYIMDDLLIVNSIDPELGLLDKAAFSSGIARSTSLAVLEAALEEHTQKSRIITEK 261

Query: 465 LALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYTAMREYLE 524
            +    + LK +  L   GKLF +R  +NL S++++TP+ +WS EP L  +Y  +  +L+
Sbjct: 262 FSRGIQINLKEKHFLTSIGKLFLIRGRLNLYSNIIETPDLYWS-EPRLEKIYKNVSHFLD 320

Query: 525 IDPRVQVLNDRCKVFLEFFDICVNSIAEKDMARITWWXXXXXXXXXXXXTAEILARIFHY 584
           I PR+ +LN +     +   + ++ + EK    + W             T E+   + HY
Sbjct: 321 IAPRINILNSKLDYCTDHSRMLLSVLNEKKGTFLEW-------IIIYLITVEVCFELHHY 373

>Kpol_1033.6 s1033 complement(11719..12930) [1212 bp, 403 aa] {ON}
           complement(11719..12930) [1212 nt, 404 aa]
          Length = 403

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 51/193 (26%), Positives = 87/193 (45%), Gaps = 23/193 (11%)

Query: 361 GVIVFWNFTELEEKNILGDIAFSGMKNMVTRPLDEQDIEIEQFHF-EYDMDTERPR---- 415
           G +V W F E    N L +     +++ +  PL     E E   F E D + E       
Sbjct: 154 GSVVSWGFDE----NTLTNNILPLIESAIINPLVPDKYESEDLDFIELDNEDETTLKLLP 209

Query: 416 ---------IFNDIITLRSGDH----IIKLTLSHAIAQSTKLSRFEKRITPILGTVSKLP 462
                    I  D+I + S D     + K   S  I++ST L+  E  +   +     + 
Sbjct: 210 SGDANEASFIAEDVIVINSIDQTSGLLDKAAFSSGISRSTSLAVLESALEEHINRSRIIT 269

Query: 463 KRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYTAMREY 522
           + ++    + L     LK  G+LF +R  +NL S +++TP+ +WS EP L  +Y  + +Y
Sbjct: 270 ESVSNGKKMNLNERDFLKSIGRLFLIRGKLNLYSEIIETPDLYWS-EPQLEKIYKNVSKY 328

Query: 523 LEIDPRVQVLNDR 535
           L++ PR+ +LN +
Sbjct: 329 LDVVPRINILNSK 341

>AAL122C Chr1 complement(132431..133531) [1101 bp, 366 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR282C
          Length = 366

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 60/253 (23%), Positives = 113/253 (44%), Gaps = 16/253 (6%)

Query: 323 EELSEIGLHPIQDSSSEQHEREKVLDAQQHAEIFIFNYGVIVFWNFTELEEKNILGDIAF 382
           E L + G  P+    +E    +   +  Q   + I   G +V W F E   K  +  +  
Sbjct: 81  ELLFQKGYQPVNLIPNEIVTFKYFYEGLQGDVMVIGQNGSVVSWGFDEASHKQHILPLID 140

Query: 383 SGMKNMVTRPLDEQD----IEIEQFHFEYDMDT-------ERPRIFNDIITL--RSGDH- 428
               N + + L E +    +EIE       + +       E+  I  D+I +   SGD  
Sbjct: 141 GARTNPLPQSLYESEDLDYVEIESKEEWSQISSLVNVSGLEQSFIKEDLIVVDRTSGDKD 200

Query: 429 -IIKLTLSHAIAQSTKLSRFEKRITPILGTVSKLPKRLALYGTLGLKREQLLKKSGKLFK 487
            + K   S  I++ST L+  E+ +   + +     + L+    L +   ++LK +G+LF 
Sbjct: 201 MLDKAAFSSGISRSTMLAVLERNMEAHIESTRSFTELLSKGNRLNITEAEILKSTGRLFL 260

Query: 488 LRVDVNLSSSVLDTPEFFWSFEPSLHPLYTAMREYLEIDPRVQVLNDRCKVFLEFFDICV 547
           +R  +NL S +++TP+ +WS EP+L  +Y  +   L++  R+ +LN +     +     +
Sbjct: 261 MRGKLNLYSELIETPDLYWS-EPTLETIYKQVSRNLDVPARISILNKKLDYATDESRALM 319

Query: 548 NSIAEKDMARITW 560
           + + EK   R+ W
Sbjct: 320 SVLNEKKSTRLEW 332

>ZYRO0G16478g Chr7 complement(1349497..1350702) [1206 bp, 401 aa]
           {ON} similar to uniprot|Q05648 Saccharomyces cerevisiae
           YDR282C Hypothetical ORF
          Length = 401

 Score = 63.5 bits (153), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 53/199 (26%), Positives = 91/199 (45%), Gaps = 30/199 (15%)

Query: 361 GVIVFWNFTELE-EKNILGDIAFSGMKNMVTRPLD--------------EQDIEIEQFHF 405
           G I+ W F E    +NIL  +     ++  T PL+              E  +++E    
Sbjct: 147 GSIICWGFDEATVNQNILKLV-----EDARTNPLNPDEFESEDMDYVELENKLQLESVQL 201

Query: 406 EYDMDT-----ERPRIFNDIITLRSGD----HIIKLTLSHAIAQSTKLSRFEKRITPILG 456
           E          E   +  D+I + S D     + K   S   ++STKL+  E  +   + 
Sbjct: 202 ESANHAAVKYLETSLLVGDLILINSTDPGAGLLHKAAFSSGFSRSTKLAVLENAMERHIV 261

Query: 457 TVSKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLY 516
               + ++++    L LKR   LK  G+LF +R  +NL S +++TP+ +WS EP L  ++
Sbjct: 262 ETRIITEKVSKGVRLNLKRGDALKSIGRLFLIRGKLNLYSELIETPDLYWS-EPQLEKIF 320

Query: 517 TAMREYLEIDPRVQVLNDR 535
               +YL+I PR+ +LN +
Sbjct: 321 KETSKYLDIGPRINILNSK 339

>KAFR0E01530 Chr5 complement(309332..310423) [1092 bp, 363 aa] {ON}
           Anc_5.291 YDR282C
          Length = 363

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 51/219 (23%), Positives = 100/219 (45%), Gaps = 24/219 (10%)

Query: 361 GVIVFWNFTELEEKNILGDIAFSGMKNMVTRPLDEQDIEIEQFHFEYDMDTERPRIFNDI 420
           G  V W      E+N+L       ++N    PL E + EIE   +     +E      DI
Sbjct: 119 GATVSWGI----EENVLRSEIIPLIENACINPLSENEFEIEDMDYIELRKSEDLSFVQDI 174

Query: 421 I------TLRSGDHII------------KLTLSHAIAQSTKLSRFEKRITPILGTVSKLP 462
                  +   GD I+            K+  S  +++ST L+  E ++   +    K+ 
Sbjct: 175 CDREDDNSFLLGDLIMINSVGPLYGVMDKVAFSSGLSRSTMLAVLENKMETHIKETRKVT 234

Query: 463 KRLALYGT-LGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYTAMRE 521
           ++++   T   +K + +L+  G+LF +R  +NL S +++TP+ +WS E  L  ++  +  
Sbjct: 235 EKISKGVTNTKMKEKDVLRFIGRLFMIRGQLNLYSELIETPDLYWS-ETQLEEIFKKISN 293

Query: 522 YLEIDPRVQVLNDRCKVFLEFFDICVNSIAEKDMARITW 560
           YL++ PR+ +LN +     E   + ++ + E+  + + W
Sbjct: 294 YLDMKPRISILNSKLDYSTEECRLLISLLNERKSSFLEW 332

>TDEL0E03360 Chr5 (635665..636882) [1218 bp, 405 aa] {ON} Anc_5.291
           YDR282C
          Length = 405

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 42/170 (24%), Positives = 80/170 (47%), Gaps = 12/170 (7%)

Query: 419 DIITLRSGD----HIIKLTLSHAIAQSTKLSRFEKRITPILGTVSKLPKRLALYGTLGLK 474
           D+I + S D     + K   S  +A+ST L+  E  +   +     + ++++    L L 
Sbjct: 228 DLIVINSTDPDSGMLYKAAYSSGLARSTSLAVLENSMEAHISRTRIITEKISRGVKLNLN 287

Query: 475 REQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYTAMREYLEIDPRVQVLND 534
             + L+  G+LF +R  +NL S +++TP+ +WS EP L  ++     YL+I PR+ +LN 
Sbjct: 288 EGEALRSIGRLFLIRGRLNLYSELIETPDLYWS-EPLLERIFKQTSRYLDIGPRINILNT 346

Query: 535 RCKVFLEFFDICVNSIAEKDMARITWWXXXXXXXXXXXXTAEILARIFHY 584
           +     +     +  ++EK    + W             + EI+  I+H+
Sbjct: 347 KLDYSTDECRALMGVLSEKKGTFLEW-------IIIYLISLEIIFEIYHF 389

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 58,632,073
Number of extensions: 2560095
Number of successful extensions: 8145
Number of sequences better than 10.0: 72
Number of HSP's gapped: 8219
Number of HSP's successfully gapped: 91
Length of query: 591
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 476
Effective length of database: 40,294,809
Effective search space: 19180329084
Effective search space used: 19180329084
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)