Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AFR264W3.569ON70770737250.0
KLLA0A00682g3.569ON70870830610.0
NCAS0E002503.569ON70870830410.0
KAFR0J028903.569ON70670729930.0
Kpol_507.83.569ON70770729860.0
YGL245W (GUS1)3.569ON70870829700.0
Suva_7.163.569ON70870829600.0
CAGL0C01947g3.569ON70570829590.0
Smik_7.163.569ON70870829570.0
SAKL0F00748g3.569ON70770729520.0
Skud_7.223.569ON70870829470.0
NDAI0I032503.569ON70970729420.0
KNAG0I002203.569ON70770929240.0
Kwal_47.192723.569ON70470529180.0
TDEL0D063703.569ON70670629170.0
TPHA0A060203.569ON70770729050.0
KLTH0G00682g3.569ON70470528550.0
ZYRO0E09570g3.569ON70670428270.0
TBLA0E001903.569ON70770827950.0
ZYRO0C07018g6.51ON8035416134e-68
YOR168W (GLN4)6.51ON8093735932e-65
TDEL0G041906.51ON8093735907e-65
KNAG0M011006.51ON7993345853e-64
Smik_15.3486.51ON8103735845e-64
Skud_15.3326.51ON8093315835e-64
SAKL0E02134g6.51ON8013825731e-62
TBLA0G004506.51ON8084075732e-62
NDAI0K028606.51ON8144075704e-62
AGR259C6.51ON7983985695e-62
KAFR0G026106.51ON7943315686e-62
Kwal_56.225596.51ON8003825678e-62
Suva_8.2236.51ON8213815688e-62
Kpol_1037.386.51ON8084065652e-61
NCAS0F002406.51ON8114075624e-61
CAGL0L04532g6.51ON7953315615e-61
Ecym_31356.51ON8044245615e-61
KLTH0C10340g6.51ON8003985591e-60
KLLA0F20449g6.51ON8043985536e-60
TPHA0J005506.51ON8083565538e-60
NDAI0A084607.100ON5293091682e-11
NCAS0I005607.100ON5273031654e-11
KNAG0L006207.100ON5173121644e-11
TBLA0E021807.100ON5313601467e-09
Skud_15.1227.100ON5324271395e-08
Suva_15.1347.100ON5353561395e-08
Kpol_1044.127.100ON5363101378e-08
CAGL0F01133g7.100ON5323441369e-08
YOL033W (MSE1)7.100ON5363561361e-07
TPHA0L005907.100ON5583151351e-07
KAFR0D013207.100ON514951342e-07
AEL338C7.100ON533651296e-07
TDEL0H035007.100ON5343251297e-07
Ecym_26267.100ON5733141298e-07
KLLA0F07975g7.100ON5423131262e-06
Smik_15.1327.100ON5353621252e-06
SAKL0B09548g7.100ON5543061216e-06
Kwal_26.72027.100ON567651191e-05
KLTH0D02794g7.100ON5462991191e-05
ZYRO0D05808g7.100ON533461073e-04
KLLA0F10395g6.153ON37232910.021
Smik_12.4694.236ON89567771.3
Kpol_2001.91.209ON415230707.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR264W
         (707 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR264W Chr6 (908580..910703) [2124 bp, 707 aa] {ON} Syntenic ho...  1439   0.0  
KLLA0A00682g Chr1 (67685..69811) [2127 bp, 708 aa] {ON} highly s...  1183   0.0  
NCAS0E00250 Chr5 (36306..38432) [2127 bp, 708 aa] {ON} Anc_3.569     1176   0.0  
KAFR0J02890 Chr10 complement(549654..551774) [2121 bp, 706 aa] {...  1157   0.0  
Kpol_507.8 s507 (51597..53720) [2124 bp, 707 aa] {ON} (51597..53...  1154   0.0  
YGL245W Chr7 (39023..41149) [2127 bp, 708 aa] {ON}  GUS1Glutamyl...  1148   0.0  
Suva_7.16 Chr7 (33556..35682) [2127 bp, 708 aa] {ON} YGL245W (REAL)  1144   0.0  
CAGL0C01947g Chr3 (204411..206528) [2118 bp, 705 aa] {ON} highly...  1144   0.0  
Smik_7.16 Chr7 (33804..35930) [2127 bp, 708 aa] {ON} YGL245W (REAL)  1143   0.0  
SAKL0F00748g Chr6 (64800..66923) [2124 bp, 707 aa] {ON} highly s...  1141   0.0  
Skud_7.22 Chr7 (43191..45317) [2127 bp, 708 aa] {ON} YGL245W (REAL)  1139   0.0  
NDAI0I03250 Chr9 complement(762687..764816) [2130 bp, 709 aa] {O...  1137   0.0  
KNAG0I00220 Chr9 (26235..28358) [2124 bp, 707 aa] {ON} Anc_3.569...  1130   0.0  
Kwal_47.19272 s47 complement(1165848..1167962) [2115 bp, 704 aa]...  1128   0.0  
TDEL0D06370 Chr4 complement(1143917..1146037) [2121 bp, 706 aa] ...  1128   0.0  
TPHA0A06020 Chr1 complement(1361027..1363150) [2124 bp, 707 aa] ...  1123   0.0  
KLTH0G00682g Chr7 (45680..47794) [2115 bp, 704 aa] {ON} highly s...  1104   0.0  
ZYRO0E09570g Chr5 complement(762205..764325) [2121 bp, 706 aa] {...  1093   0.0  
TBLA0E00190 Chr5 (24885..27008) [2124 bp, 707 aa] {ON} Anc_3.569...  1081   0.0  
ZYRO0C07018g Chr3 (528834..531245) [2412 bp, 803 aa] {ON} highly...   240   4e-68
YOR168W Chr15 (649303..651732) [2430 bp, 809 aa] {ON}  GLN4Gluta...   233   2e-65
TDEL0G04190 Chr7 (761363..763792) [2430 bp, 809 aa] {ON} Anc_6.5...   231   7e-65
KNAG0M01100 Chr13 (194806..197205) [2400 bp, 799 aa] {ON} Anc_6....   229   3e-64
Smik_15.348 Chr15 (605412..607844) [2433 bp, 810 aa] {ON} YOR168...   229   5e-64
Skud_15.332 Chr15 (598097..600526) [2430 bp, 809 aa] {ON} YOR168...   229   5e-64
SAKL0E02134g Chr5 complement(162366..164771) [2406 bp, 801 aa] {...   225   1e-62
TBLA0G00450 Chr7 complement(90053..92479) [2427 bp, 808 aa] {ON}...   225   2e-62
NDAI0K02860 Chr11 (646106..648550) [2445 bp, 814 aa] {ON} Anc_6....   224   4e-62
AGR259C Chr7 complement(1227063..1229459) [2397 bp, 798 aa] {ON}...   223   5e-62
KAFR0G02610 Chr7 (538902..541286) [2385 bp, 794 aa] {ON} Anc_6.5...   223   6e-62
Kwal_56.22559 s56 complement(179568..181970) [2403 bp, 800 aa] {...   223   8e-62
Suva_8.223 Chr8 (399431..401896) [2466 bp, 821 aa] {ON} YOR168W ...   223   8e-62
Kpol_1037.38 s1037 complement(93063..95489) [2427 bp, 808 aa] {O...   222   2e-61
NCAS0F00240 Chr6 complement(37406..39841) [2436 bp, 811 aa] {ON}...   221   4e-61
CAGL0L04532g Chr12 (524088..526475) [2388 bp, 795 aa] {ON} highl...   220   5e-61
Ecym_3135 Chr3 (250906..253320) [2415 bp, 804 aa] {ON} similar t...   220   5e-61
KLTH0C10340g Chr3 (857898..860300) [2403 bp, 800 aa] {ON} highly...   219   1e-60
KLLA0F20449g Chr6 (1898253..1900667) [2415 bp, 804 aa] {ON} high...   217   6e-60
TPHA0J00550 Chr10 complement(123101..125527) [2427 bp, 808 aa] {...   217   8e-60
NDAI0A08460 Chr1 (1951121..1952710) [1590 bp, 529 aa] {ON} Anc_7...    69   2e-11
NCAS0I00560 Chr9 complement(89020..90603) [1584 bp, 527 aa] {ON}...    68   4e-11
KNAG0L00620 Chr12 complement(92148..93701) [1554 bp, 517 aa] {ON...    68   4e-11
TBLA0E02180 Chr5 complement(532174..533769) [1596 bp, 531 aa] {O...    61   7e-09
Skud_15.122 Chr15 (222353..223951) [1599 bp, 532 aa] {ON} YOL033...    58   5e-08
Suva_15.134 Chr15 (235964..237571) [1608 bp, 535 aa] {ON} YOL033...    58   5e-08
Kpol_1044.12 s1044 complement(21668..23278) [1611 bp, 536 aa] {O...    57   8e-08
CAGL0F01133g Chr6 complement(114888..116486) [1599 bp, 532 aa] {...    57   9e-08
YOL033W Chr15 (263475..265085) [1611 bp, 536 aa] {ON}  MSE1Mitoc...    57   1e-07
TPHA0L00590 Chr12 complement(100345..102021) [1677 bp, 558 aa] {...    57   1e-07
KAFR0D01320 Chr4 complement(262226..263770) [1545 bp, 514 aa] {O...    56   2e-07
AEL338C Chr5 complement(12870..14471) [1602 bp, 533 aa] {ON} Syn...    54   6e-07
TDEL0H03500 Chr8 (582143..583747) [1605 bp, 534 aa] {ON} Anc_7.1...    54   7e-07
Ecym_2626 Chr2 (1212098..1213819) [1722 bp, 573 aa] {ON} similar...    54   8e-07
KLLA0F07975g Chr6 complement(746708..748336) [1629 bp, 542 aa] {...    53   2e-06
Smik_15.132 Chr15 (229667..231274) [1608 bp, 535 aa] {ON} YOL033...    53   2e-06
SAKL0B09548g Chr2 (809247..810911) [1665 bp, 554 aa] {ON} simila...    51   6e-06
Kwal_26.7202 s26 complement(261450..263153) [1704 bp, 567 aa] {O...    50   1e-05
KLTH0D02794g Chr4 complement(270516..272156) [1641 bp, 546 aa] {...    50   1e-05
ZYRO0D05808g Chr4 complement(493474..495075) [1602 bp, 533 aa] {...    46   3e-04
KLLA0F10395g Chr6 complement(959120..960238) [1119 bp, 372 aa] {...    40   0.021
Smik_12.469 Chr12 complement(820772..823459) [2688 bp, 895 aa] {...    34   1.3  
Kpol_2001.9 s2001 (28658..29905) [1248 bp, 415 aa] {ON} (28658.....    32   7.4  

>AFR264W Chr6 (908580..910703) [2124 bp, 707 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL245W (GUS1)
          Length = 707

 Score = 1439 bits (3725), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 698/707 (98%), Positives = 698/707 (98%)

Query: 1   MSSTLIIAAKSPAVAYAELIAARAVNEAKQDAVAIQFTEGKEAAAASFDGESQNALERMV 60
           MSSTLIIAAKSPAVAYAELIAARAVNEAKQDAVAIQFTEGKEAAAASFDGESQNALERMV
Sbjct: 1   MSSTLIIAAKSPAVAYAELIAARAVNEAKQDAVAIQFTEGKEAAAASFDGESQNALERMV 60

Query: 61  EKYPDVLGSVPEEAAWWIAYARTDLVVKDFKKLSGSLEKLDAHLNLRTFVLGGMQPTVAD 120
           EKYPDVLGSVPEEAAWWIAYARTDLVVKDFKKLSGSLEKLDAHLNLRTFVLGGMQPTVAD
Sbjct: 61  EKYPDVLGSVPEEAAWWIAYARTDLVVKDFKKLSGSLEKLDAHLNLRTFVLGGMQPTVAD 120

Query: 121 VAVWGALRSNGPVGSIIKNKVYVNVSRWYTTLELIPAFGGAHEFLAKSLKELKAAGNVNK 180
           VAVWGALRSNGPVGSIIKNKVYVNVSRWYTTLELIPAFGGAHEFLAKSLKELKAAGNVNK
Sbjct: 121 VAVWGALRSNGPVGSIIKNKVYVNVSRWYTTLELIPAFGGAHEFLAKSLKELKAAGNVNK 180

Query: 181 KKETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFD 240
           KKETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFD
Sbjct: 181 KKETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFD 240

Query: 241 DTNPSKERVEFQDSILEDLELLGIKGDRITHSSDYFQEMYDYCVQMIKEGKAYCDDTPTX 300
           DTNPSKERVEFQDSILEDLELLGIKGDRITHSSDYFQEMYDYCVQMIKEGKAYCDDTPT 
Sbjct: 241 DTNPSKERVEFQDSILEDLELLGIKGDRITHSSDYFQEMYDYCVQMIKEGKAYCDDTPTE 300

Query: 301 XXXXXXXXGIASARRERSVEENLKIFTEEMKNGTEEGLKNCVRAKRDYAALNKTLKDPVL 360
                   GIASARRERSVEENLKIFTEEMKNGTEEGLKNCVRAKRDYAALNKTLKDPVL
Sbjct: 301 RMREERMEGIASARRERSVEENLKIFTEEMKNGTEEGLKNCVRAKRDYAALNKTLKDPVL 360

Query: 361 YRCNLTPHHRTGTAWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALKLR 420
           YRCNLTPHHRTGTAWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALKLR
Sbjct: 361 YRCNLTPHHRTGTAWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALKLR 420

Query: 421 KVHIWDFARVNFVRTLLSKRKLQWLVDKQVVSNWDDPRFPTVRGVRRRGMTIEGLRNFVL 480
           KVHIWDFARVNFVRTLLSKRKLQWLVDKQVVSNWDDPRFPTVRGVRRRGMTIEGLRNFVL
Sbjct: 421 KVHIWDFARVNFVRTLLSKRKLQWLVDKQVVSNWDDPRFPTVRGVRRRGMTIEGLRNFVL 480

Query: 481 SQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTVVTNPVKLHLNGADVPQTPLTEMKPKHK 540
           SQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTVVTNPVKLHLNGADVPQTPLTEMKPKHK
Sbjct: 481 SQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTVVTNPVKLHLNGADVPQTPLTEMKPKHK 540

Query: 541 KNPAVGEKKVIYYKDVLIGAEDAAMLAAGEEVTLMDWGNAIIRGKNDDGSLTADLNLEGD 600
           KNPAVGEKKVIYYKDVLIGAEDAAMLAAGEEVTLMDWGNAIIRGKNDDGSLTADLNLEGD
Sbjct: 541 KNPAVGEKKVIYYKDVLIGAEDAAMLAAGEEVTLMDWGNAIIRGKNDDGSLTADLNLEGD 600

Query: 601 FKKTKFKLTWLADTSDTVPVDLVDFDHLISKDRLEEEDNFEDFLTPETEFHTTAIADLNV 660
           FKKTKFKLTWLADTSDTVPVDLVDFDHLISKDRLEEEDNFEDFLTPETEFHTTAIADLNV
Sbjct: 601 FKKTKFKLTWLADTSDTVPVDLVDFDHLISKDRLEEEDNFEDFLTPETEFHTTAIADLNV 660

Query: 661 KDMKVGDVIQFERTGYYRLDTVGSGDKPFVFFTIPDGKAVNKYGAKK 707
           KDMKVGDVIQFERTGYYRLDTVGSGDKPFVFFTIPDGKAVNKYGAKK
Sbjct: 661 KDMKVGDVIQFERTGYYRLDTVGSGDKPFVFFTIPDGKAVNKYGAKK 707

>KLLA0A00682g Chr1 (67685..69811) [2127 bp, 708 aa] {ON} highly
           similar to uniprot|P46655 Saccharomyces cerevisiae
           YGL245W GUS1 Glutamyl-tRNA synthetase (GluRS) forms a
           complex with methionyl-tRNA synthetase (Mes1p) and Arc1p
           complex formation increases the catalytic efficiency of
           both tRNA synthetases and ensures their correct
           localization to the cytoplasm
          Length = 708

 Score = 1183 bits (3061), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 558/708 (78%), Positives = 622/708 (87%), Gaps = 1/708 (0%)

Query: 1   MSSTLIIAAKSPAVAYAELIAARAVNEAKQD-AVAIQFTEGKEAAAASFDGESQNALERM 59
           MS++LII AK+P +AY ELIAAR VN +K D  + I F E K+AAAASF+GE+++ L ++
Sbjct: 1   MSASLIIGAKAPVIAYPELIAARKVNASKGDNTIEISFVEDKKAAAASFNGETEDVLTKL 60

Query: 60  VEKYPDVLGSVPEEAAWWIAYARTDLVVKDFKKLSGSLEKLDAHLNLRTFVLGGMQPTVA 119
              YPD+L    + +A WI +    LV+K+F++L+ SL KL+AHLNLRT++L  ++P++A
Sbjct: 61  SAAYPDILNDNSDSSAEWIEFGAKQLVIKNFQQLAESLAKLNAHLNLRTYILNTLEPSLA 120

Query: 120 DVAVWGALRSNGPVGSIIKNKVYVNVSRWYTTLELIPAFGGAHEFLAKSLKELKAAGNVN 179
           D+AVWG LRSNG VGSIIKNKVY+NVSRWY+T ELIP FG AHEFL KSL+ELK A NVN
Sbjct: 121 DIAVWGYLRSNGMVGSIIKNKVYINVSRWYSTFELIPEFGQAHEFLTKSLQELKKASNVN 180

Query: 180 KKKETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 239
           KKKETHKANFEI LPDAK+GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF
Sbjct: 181 KKKETHKANFEIGLPDAKVGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 240

Query: 240 DDTNPSKERVEFQDSILEDLELLGIKGDRITHSSDYFQEMYDYCVQMIKEGKAYCDDTPT 299
           DDTNPSKE+ EFQDSILEDLELLGIKGDRIT+SSDYFQEMYDYCVQMIKEGKAYCDDTPT
Sbjct: 241 DDTNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQEMYDYCVQMIKEGKAYCDDTPT 300

Query: 300 XXXXXXXXXGIASARRERSVEENLKIFTEEMKNGTEEGLKNCVRAKRDYAALNKTLKDPV 359
                    GI S+RRER+VEENLKIFTEEMKNGTEEGLKNCVRAK DY ALNK ++DPV
Sbjct: 301 ERMREERTEGIPSSRRERTVEENLKIFTEEMKNGTEEGLKNCVRAKIDYEALNKAMRDPV 360

Query: 360 LYRCNLTPHHRTGTAWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALKL 419
           +YRCNLTPHHRTGTAWKIYPTYDFCVPIVD+LEGVTHALRTIEYRDRN QY+WMLNAL L
Sbjct: 361 IYRCNLTPHHRTGTAWKIYPTYDFCVPIVDSLEGVTHALRTIEYRDRNPQYDWMLNALHL 420

Query: 420 RKVHIWDFARVNFVRTLLSKRKLQWLVDKQVVSNWDDPRFPTVRGVRRRGMTIEGLRNFV 479
           RKVHIWDFARVNFVRTLLSKRKLQWLVDK +VSNWDDPRFPTVRGVRRRGMTIEGLRNFV
Sbjct: 421 RKVHIWDFARVNFVRTLLSKRKLQWLVDKDIVSNWDDPRFPTVRGVRRRGMTIEGLRNFV 480

Query: 480 LSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTVVTNPVKLHLNGADVPQTPLTEMKPKH 539
           LSQGPSRNVINLEWNLIW+FNKKVIDP+APRHT + +PVK+HL G DVPQTP  EMK KH
Sbjct: 481 LSQGPSRNVINLEWNLIWSFNKKVIDPVAPRHTAIVSPVKVHLEGDDVPQTPNVEMKLKH 540

Query: 540 KKNPAVGEKKVIYYKDVLIGAEDAAMLAAGEEVTLMDWGNAIIRGKNDDGSLTADLNLEG 599
           KKNPA+GEKKVIYYKD++I  EDA +L+ GEEVTLMDWGNAII  KNDDGS  A L+LEG
Sbjct: 541 KKNPAIGEKKVIYYKDIVIDEEDAKLLSEGEEVTLMDWGNAIITKKNDDGSFNAKLHLEG 600

Query: 600 DFKKTKFKLTWLADTSDTVPVDLVDFDHLISKDRLEEEDNFEDFLTPETEFHTTAIADLN 659
           DFK TKFKLTWLADT D V  DLVDFDHLISKD+LEE +NFEDFLTP+TEFHTTA ADLN
Sbjct: 601 DFKTTKFKLTWLADTDDKVEADLVDFDHLISKDKLEEGENFEDFLTPKTEFHTTAYADLN 660

Query: 660 VKDMKVGDVIQFERTGYYRLDTVGSGDKPFVFFTIPDGKAVNKYGAKK 707
           VKDMKVGD+IQFER GY+RLD++    KP+VFFTIPDGK+VNKYGAKK
Sbjct: 661 VKDMKVGDIIQFERKGYFRLDSLPKDGKPYVFFTIPDGKSVNKYGAKK 708

>NCAS0E00250 Chr5 (36306..38432) [2127 bp, 708 aa] {ON} Anc_3.569
          Length = 708

 Score = 1176 bits (3041), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 556/708 (78%), Positives = 619/708 (87%), Gaps = 1/708 (0%)

Query: 1   MSSTLIIAAKSPAVAYAELIAARAVNEAKQDAVAIQFTEGKEAAAASFDGESQNALERMV 60
           MS+TL+I  K+P VAYAELIAAR VNE K ++++I+F + K+AA A+F+G++++A  ++V
Sbjct: 1   MSATLVINGKAPVVAYAELIAARIVNETKPNSISIEFVDDKKAAPATFNGDNKDAFLKIV 60

Query: 61  EKYPDVLGSVPEE-AAWWIAYARTDLVVKDFKKLSGSLEKLDAHLNLRTFVLGGMQPTVA 119
            ++ DV  +  EE    W+  A  +LV+K+F+KLS SL KLDAHLNLRTF+LGG++ + A
Sbjct: 61  AQFSDVFSNSKEEDITQWVKMASEELVIKNFQKLSESLGKLDAHLNLRTFILGGLKYSAA 120

Query: 120 DVAVWGALRSNGPVGSIIKNKVYVNVSRWYTTLELIPAFGGAHEFLAKSLKELKAAGNVN 179
           D+A WGALRSNG  GSIIKNKV VNVSRWYT LE+ P FG  HEFL KSL+ELK   N  
Sbjct: 121 DIACWGALRSNGMCGSIIKNKVEVNVSRWYTLLEMDPIFGSVHEFLTKSLQELKKTANAG 180

Query: 180 KKKETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 239
           KKKETHKANFEIDLPDAK+GEVVTRFPPEPSGYLHIGHAKAA+LNQYFAQAYKGKLIIRF
Sbjct: 181 KKKETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRF 240

Query: 240 DDTNPSKERVEFQDSILEDLELLGIKGDRITHSSDYFQEMYDYCVQMIKEGKAYCDDTPT 299
           DDTNPSKE+ EFQDSILEDLELLGIKGDRITHSSDYFQEMYDYC+QMIKEGKAYCDDTPT
Sbjct: 241 DDTNPSKEKEEFQDSILEDLELLGIKGDRITHSSDYFQEMYDYCIQMIKEGKAYCDDTPT 300

Query: 300 XXXXXXXXXGIASARRERSVEENLKIFTEEMKNGTEEGLKNCVRAKRDYAALNKTLKDPV 359
                    GIASARR+RSVEENLKIFTEEMKNGTEEGLKNCVRAK DY ALNKTL+DPV
Sbjct: 301 EKMREERMDGIASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPV 360

Query: 360 LYRCNLTPHHRTGTAWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALKL 419
           +YRCNLTPHHRTGT WK+YPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWML AL L
Sbjct: 361 IYRCNLTPHHRTGTTWKVYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLQALNL 420

Query: 420 RKVHIWDFARVNFVRTLLSKRKLQWLVDKQVVSNWDDPRFPTVRGVRRRGMTIEGLRNFV 479
           RKVHIWDFARVNFVRTLLSKRKLQW+VDK +VSNWDDPRFPTVRGVRRRGMT+EGLRNFV
Sbjct: 421 RKVHIWDFARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTVRGVRRRGMTVEGLRNFV 480

Query: 480 LSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTVVTNPVKLHLNGADVPQTPLTEMKPKH 539
           LSQGPSRNVINLEWNLIWAFNKKVIDP+APRHT + NPVK+HL G DVPQTP  EMKPKH
Sbjct: 481 LSQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAIVNPVKIHLEGDDVPQTPKIEMKPKH 540

Query: 540 KKNPAVGEKKVIYYKDVLIGAEDAAMLAAGEEVTLMDWGNAIIRGKNDDGSLTADLNLEG 599
           KKNPAVGEKKVIY+KD++I  +DA +L A EEVT+MDWGN II  KN DGSL   L+LEG
Sbjct: 541 KKNPAVGEKKVIYFKDIVIDKDDADLLEANEEVTMMDWGNVIITQKNADGSLVGKLHLEG 600

Query: 600 DFKKTKFKLTWLADTSDTVPVDLVDFDHLISKDRLEEEDNFEDFLTPETEFHTTAIADLN 659
           DFKKTK KLTWLADT D VPVDLVDFDHLI+KD+LEE+++FEDFLTP TEFHT AIADLN
Sbjct: 601 DFKKTKHKLTWLADTPDVVPVDLVDFDHLITKDKLEEDESFEDFLTPVTEFHTDAIADLN 660

Query: 660 VKDMKVGDVIQFERTGYYRLDTVGSGDKPFVFFTIPDGKAVNKYGAKK 707
           VKDMKVGD+IQFER GYYRLD +    KP+VFFTIPDGK+VNKYGAKK
Sbjct: 661 VKDMKVGDIIQFERKGYYRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708

>KAFR0J02890 Chr10 complement(549654..551774) [2121 bp, 706 aa] {ON}
           Anc_3.569 YGL245W
          Length = 706

 Score = 1157 bits (2993), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 545/707 (77%), Positives = 614/707 (86%), Gaps = 1/707 (0%)

Query: 1   MSSTLIIAAKSPAVAYAELIAARAVNEAKQDAVAIQFTEGKEAAAASFDGESQNALERMV 60
           MS+TL+I  K+P VAY  LIAAR VN A+ DA+ I+F + K++A A+F+G S+ +  ++V
Sbjct: 1   MSATLVINGKAPVVAYDSLIAARLVNAARPDAIKIEFVDDKKSAPATFNGSSEGSFNKIV 60

Query: 61  EKYPDVLGSVPEEAAWWIAYARTDLVVKDFKKLSGSLEKLDAHLNLRTFVLGGMQPTVAD 120
             +PD   +    A+ WI  A  + +VK+F+KL+ SLEKLDA+LNLRTF+ GG++ + AD
Sbjct: 61  AAFPDAFRNA-NVASEWINVASEEFIVKNFQKLAQSLEKLDAYLNLRTFISGGLEYSAAD 119

Query: 121 VAVWGALRSNGPVGSIIKNKVYVNVSRWYTTLELIPAFGGAHEFLAKSLKELKAAGNVNK 180
           +A WGALRSNG VGSIIKNKVYVNVSRWY+ LE+ P FG  HEFL KSL+ELK   +  K
Sbjct: 120 IAAWGALRSNGMVGSIIKNKVYVNVSRWYSLLEMDPLFGTVHEFLTKSLQELKKNASAGK 179

Query: 181 KKETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFD 240
           KKETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFD
Sbjct: 180 KKETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFD 239

Query: 241 DTNPSKERVEFQDSILEDLELLGIKGDRITHSSDYFQEMYDYCVQMIKEGKAYCDDTPTX 300
           DTNPSKE+ EFQDSILEDLELLGIKGDR+T+SSDYFQEMYD CVQ+IKEG AYCDDTPT 
Sbjct: 240 DTNPSKEKTEFQDSILEDLELLGIKGDRVTYSSDYFQEMYDLCVQLIKEGGAYCDDTPTE 299

Query: 301 XXXXXXXXGIASARRERSVEENLKIFTEEMKNGTEEGLKNCVRAKRDYAALNKTLKDPVL 360
                   GIASARR+R+VEENL+IFTEEMKNGTEEGLKNCVRAK DYAALNKTL+DPV+
Sbjct: 300 KMREERMDGIASARRDRTVEENLRIFTEEMKNGTEEGLKNCVRAKIDYAALNKTLRDPVI 359

Query: 361 YRCNLTPHHRTGTAWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALKLR 420
           YRCNLTPHHRTG  WK+YPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNAL LR
Sbjct: 360 YRCNLTPHHRTGATWKMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALHLR 419

Query: 421 KVHIWDFARVNFVRTLLSKRKLQWLVDKQVVSNWDDPRFPTVRGVRRRGMTIEGLRNFVL 480
           KVHIWDFARVNFVRTLLSKRKLQW+VDK +VSNWDDPRFPTVRGVRRRGMT+EGLRNFVL
Sbjct: 420 KVHIWDFARVNFVRTLLSKRKLQWMVDKHLVSNWDDPRFPTVRGVRRRGMTVEGLRNFVL 479

Query: 481 SQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTVVTNPVKLHLNGADVPQTPLTEMKPKHK 540
           SQGPSRNVINLEWN+IWAFNKKVIDP+APRHT V NPVK+HL G D P+TP  EMKPKHK
Sbjct: 480 SQGPSRNVINLEWNIIWAFNKKVIDPVAPRHTAVVNPVKIHLTGEDAPETPKIEMKPKHK 539

Query: 541 KNPAVGEKKVIYYKDVLIGAEDAAMLAAGEEVTLMDWGNAIIRGKNDDGSLTADLNLEGD 600
           KNPAVGEKKVIYYKD+++  EDA ++   EEVTLMDWGN II  KN DGS+ A ++LEGD
Sbjct: 540 KNPAVGEKKVIYYKDIVVDKEDADVIEVNEEVTLMDWGNIIITKKNADGSMEAKVHLEGD 599

Query: 601 FKKTKFKLTWLADTSDTVPVDLVDFDHLISKDRLEEEDNFEDFLTPETEFHTTAIADLNV 660
           FKKT  KLTWLADT D VPVDLVDFDHLISKD+LEE+++FEDFLTPETEFHT+AIADLNV
Sbjct: 600 FKKTAHKLTWLADTEDVVPVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLNV 659

Query: 661 KDMKVGDVIQFERTGYYRLDTVGSGDKPFVFFTIPDGKAVNKYGAKK 707
           K+MKVGDVIQFER GY+RLD++    KP+VFFTIPDGK+VNKYGAKK
Sbjct: 660 KEMKVGDVIQFERKGYFRLDSLPKDGKPYVFFTIPDGKSVNKYGAKK 706

>Kpol_507.8 s507 (51597..53720) [2124 bp, 707 aa] {ON}
           (51597..53720) [2124 nt, 708 aa]
          Length = 707

 Score = 1154 bits (2986), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 547/707 (77%), Positives = 611/707 (86%)

Query: 1   MSSTLIIAAKSPAVAYAELIAARAVNEAKQDAVAIQFTEGKEAAAASFDGESQNALERMV 60
           MS+TL+I  K+P VAYAELIAAR VN +K D++ I+F E K+A+ A+ +G+S + L ++V
Sbjct: 1   MSATLVIGGKAPVVAYAELIAARIVNSSKPDSIKIEFVEDKKASPATLNGDSVDVLSKIV 60

Query: 61  EKYPDVLGSVPEEAAWWIAYARTDLVVKDFKKLSGSLEKLDAHLNLRTFVLGGMQPTVAD 120
               DV       +  WI  A  +LVVK+F++L+ SLEKLDAHLNLRT++ GG+  TVAD
Sbjct: 61  TANSDVFPEGAANSTEWIKIASEELVVKNFQQLNKSLEKLDAHLNLRTYINGGLNFTVAD 120

Query: 121 VAVWGALRSNGPVGSIIKNKVYVNVSRWYTTLELIPAFGGAHEFLAKSLKELKAAGNVNK 180
           +A WGALRSNG VGSIIKNKV VNVSRWYT LE    FGG HEFL KSL+ELK A    K
Sbjct: 121 IACWGALRSNGMVGSIIKNKVNVNVSRWYTLLEENTLFGGVHEFLTKSLQELKKASTAGK 180

Query: 181 KKETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFD 240
           KKETHKANFEIDLPDAK+GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFD
Sbjct: 181 KKETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFD 240

Query: 241 DTNPSKERVEFQDSILEDLELLGIKGDRITHSSDYFQEMYDYCVQMIKEGKAYCDDTPTX 300
           DTNPSKE VEFQDSILEDLELLGIKGDRITHSSDYFQEMYDYCVQ+IK+GKAYCDDTPT 
Sbjct: 241 DTNPSKENVEFQDSILEDLELLGIKGDRITHSSDYFQEMYDYCVQLIKDGKAYCDDTPTE 300

Query: 301 XXXXXXXXGIASARRERSVEENLKIFTEEMKNGTEEGLKNCVRAKRDYAALNKTLKDPVL 360
                   GIAS RR+RSVEENLKIFTEEMKNGTEEGLKNCVRAK DY ALNKTL+DPV+
Sbjct: 301 KMRDERMNGIASVRRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDPVI 360

Query: 361 YRCNLTPHHRTGTAWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALKLR 420
           +RCNLTPHHRTG+ WK+YPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALKLR
Sbjct: 361 FRCNLTPHHRTGSQWKMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALKLR 420

Query: 421 KVHIWDFARVNFVRTLLSKRKLQWLVDKQVVSNWDDPRFPTVRGVRRRGMTIEGLRNFVL 480
           KVHIWDFARVNFVRTLLSKRKLQW+VDK +VSNW+DPRFPTVRGVRRRGMT+EGLRNFVL
Sbjct: 421 KVHIWDFARVNFVRTLLSKRKLQWMVDKNLVSNWEDPRFPTVRGVRRRGMTVEGLRNFVL 480

Query: 481 SQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTVVTNPVKLHLNGADVPQTPLTEMKPKHK 540
           SQGPSRNVINLEWNLIW+FNKKVIDP+ PR T V +PVK+HL G D PQ+   EMKPKH 
Sbjct: 481 SQGPSRNVINLEWNLIWSFNKKVIDPVCPRLTAVVDPVKIHLEGEDAPQSAKVEMKPKHP 540

Query: 541 KNPAVGEKKVIYYKDVLIGAEDAAMLAAGEEVTLMDWGNAIIRGKNDDGSLTADLNLEGD 600
           KNP VGEKKV++YKD++I  EDA  +  GEE+TLM+WGNAII  KN DGSL A L+LEGD
Sbjct: 541 KNPVVGEKKVVFYKDIVIDREDADSIEDGEEITLMNWGNAIITKKNADGSLNAKLHLEGD 600

Query: 601 FKKTKFKLTWLADTSDTVPVDLVDFDHLISKDRLEEEDNFEDFLTPETEFHTTAIADLNV 660
           FKKTK K+TWLADT D V VDLVDFDHLISKD+LEE+++FEDFLTPETEFHT+AIADLNV
Sbjct: 601 FKKTKHKVTWLADTEDVVKVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLNV 660

Query: 661 KDMKVGDVIQFERTGYYRLDTVGSGDKPFVFFTIPDGKAVNKYGAKK 707
           KDMKVGD+IQFER GYYRLD++ +  KP+VFFTIPDGK+VNKYGAKK
Sbjct: 661 KDMKVGDIIQFERKGYYRLDSLAADGKPYVFFTIPDGKSVNKYGAKK 707

>YGL245W Chr7 (39023..41149) [2127 bp, 708 aa] {ON}
           GUS1Glutamyl-tRNA synthetase (GluRS), forms a complex
           with methionyl-tRNA synthetase (Mes1p) and Arc1p;
           complex formation increases the catalytic efficiency of
           both tRNA synthetases and ensures their correct
           localization to the cytoplasm
          Length = 708

 Score = 1148 bits (2970), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 542/708 (76%), Positives = 611/708 (86%), Gaps = 1/708 (0%)

Query: 1   MSSTLIIAAKSPAVAYAELIAARAVNEAKQDAVAIQFTEGKEAAAASFDGESQNALERMV 60
           M STL I  K+P VAYAELIAAR VN    +++AI+  + K+A AA  D  +++   ++ 
Sbjct: 1   MPSTLTINGKAPIVAYAELIAARIVNALAPNSIAIKLVDDKKAPAAKLDDATEDVFNKIT 60

Query: 61  EKYPDVLGSV-PEEAAWWIAYARTDLVVKDFKKLSGSLEKLDAHLNLRTFVLGGMQPTVA 119
            K+  +  +   E+ A W+  A+ +LV+K+F KLS SLE LD+ LNLRTF+LGG++ + A
Sbjct: 61  SKFAAIFDNGDKEQVAKWVNLAQKELVIKNFAKLSQSLETLDSQLNLRTFILGGLKYSAA 120

Query: 120 DVAVWGALRSNGPVGSIIKNKVYVNVSRWYTTLELIPAFGGAHEFLAKSLKELKAAGNVN 179
           DVA WGALRSNG  GSIIKNKV VNVSRWYT LE+ P FG AH+FL+KSL ELK + NV 
Sbjct: 121 DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLSKSLLELKKSANVG 180

Query: 180 KKKETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 239
           KKKETHKANFEIDLPDAK+GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF
Sbjct: 181 KKKETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 240

Query: 240 DDTNPSKERVEFQDSILEDLELLGIKGDRITHSSDYFQEMYDYCVQMIKEGKAYCDDTPT 299
           DDTNPSKE+ EFQDSILEDL+LLGIKGDRIT+SSDYFQEMYDYCVQMIK+GKAYCDDTPT
Sbjct: 241 DDTNPSKEKEEFQDSILEDLDLLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAYCDDTPT 300

Query: 300 XXXXXXXXXGIASARRERSVEENLKIFTEEMKNGTEEGLKNCVRAKRDYAALNKTLKDPV 359
                    G+ASARR+RSVEENL+IFTEEMKNGTEEGLKNCVRAK DY ALNKTL+DPV
Sbjct: 301 EKMREERMDGVASARRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPV 360

Query: 360 LYRCNLTPHHRTGTAWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALKL 419
           +YRCNLTPHHRTG+ WKIYPTYDFCVPIVDA+EGVTHALRTIEYRDRNAQY+WML AL+L
Sbjct: 361 IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNAQYDWMLQALRL 420

Query: 420 RKVHIWDFARVNFVRTLLSKRKLQWLVDKQVVSNWDDPRFPTVRGVRRRGMTIEGLRNFV 479
           RKVHIWDFAR+NFVRTLLSKRKLQW+VDK +V NWDDPRFPTVRGVRRRGMT+EGLRNFV
Sbjct: 421 RKVHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTVRGVRRRGMTVEGLRNFV 480

Query: 480 LSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTVVTNPVKLHLNGADVPQTPLTEMKPKH 539
           LSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHT + NPVK+HL G++ PQ P  EMKPKH
Sbjct: 481 LSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGSEAPQEPKIEMKPKH 540

Query: 540 KKNPAVGEKKVIYYKDVLIGAEDAAMLAAGEEVTLMDWGNAIIRGKNDDGSLTADLNLEG 599
           KKNPAVGEKKVIYYKD+++  +DA ++   EEVTLMDWGN II  KNDDGS+ A LNLEG
Sbjct: 541 KKNPAVGEKKVIYYKDIVVDKDDADVINVDEEVTLMDWGNVIITKKNDDGSMVAKLNLEG 600

Query: 600 DFKKTKFKLTWLADTSDTVPVDLVDFDHLISKDRLEEEDNFEDFLTPETEFHTTAIADLN 659
           DFKKTK KLTWLADT D VPVDLVDFDHLI+KDRLEE+++FEDFLTP+TEFHT AIADLN
Sbjct: 601 DFKKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLN 660

Query: 660 VKDMKVGDVIQFERTGYYRLDTVGSGDKPFVFFTIPDGKAVNKYGAKK 707
           VKDMK+GD+IQFER GYYRLD +    KP+VFFTIPDGK+VNKYGAKK
Sbjct: 661 VKDMKIGDIIQFERKGYYRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708

>Suva_7.16 Chr7 (33556..35682) [2127 bp, 708 aa] {ON} YGL245W (REAL)
          Length = 708

 Score = 1144 bits (2960), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 542/708 (76%), Positives = 609/708 (86%), Gaps = 1/708 (0%)

Query: 1   MSSTLIIAAKSPAVAYAELIAARAVNEAKQDAVAIQFTEGKEAAAASFDGESQNALERMV 60
           M STL I  K+PAVAYAELIAAR VN    +++A++F + K+A AA  D  +++   ++ 
Sbjct: 1   MPSTLTINGKAPAVAYAELIAARIVNALAPNSIAVEFVDDKKAPAAKLDDATEDVFNKIT 60

Query: 61  EKYPDVL-GSVPEEAAWWIAYARTDLVVKDFKKLSGSLEKLDAHLNLRTFVLGGMQPTVA 119
            K+  +      EE A W+  A+ +LVVK+F KLS SLE LD  LNLRTF+LGG++ + A
Sbjct: 61  GKFAAIFDNGKKEEVAKWVKLAQEELVVKNFGKLSQSLETLDTQLNLRTFILGGLKYSAA 120

Query: 120 DVAVWGALRSNGPVGSIIKNKVYVNVSRWYTTLELIPAFGGAHEFLAKSLKELKAAGNVN 179
           DVA WGALRSNG  GSIIKNKV VNVSRWYT LE+ P FG AHEFL KSL+E+K   NV 
Sbjct: 121 DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHEFLTKSLQEVKKNANVG 180

Query: 180 KKKETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 239
           KKKETHKANFEIDLPDAK+G+VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGK+IIRF
Sbjct: 181 KKKETHKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRF 240

Query: 240 DDTNPSKERVEFQDSILEDLELLGIKGDRITHSSDYFQEMYDYCVQMIKEGKAYCDDTPT 299
           DDTNPSKE+ EFQDSILEDLELLGIKGDRIT+SSDYFQEMYDYCVQMIK+GKAYCDDTPT
Sbjct: 241 DDTNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAYCDDTPT 300

Query: 300 XXXXXXXXXGIASARRERSVEENLKIFTEEMKNGTEEGLKNCVRAKRDYAALNKTLKDPV 359
                    GIASARR+RSVEENL+IFTEEMKNGTE GLKNCVRAK DY ALNKTL+DPV
Sbjct: 301 EKMREERMDGIASARRDRSVEENLRIFTEEMKNGTEVGLKNCVRAKIDYEALNKTLRDPV 360

Query: 360 LYRCNLTPHHRTGTAWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALKL 419
           +YRCNLTPHHRTG+ WKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQY+WML AL+L
Sbjct: 361 IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLQALRL 420

Query: 420 RKVHIWDFARVNFVRTLLSKRKLQWLVDKQVVSNWDDPRFPTVRGVRRRGMTIEGLRNFV 479
           RKVHIWDFAR+NFVRTLLSKRKLQW+VDK++V NWDDPRFPTVRGVRRRGMT+EGLRNFV
Sbjct: 421 RKVHIWDFARINFVRTLLSKRKLQWMVDKELVGNWDDPRFPTVRGVRRRGMTVEGLRNFV 480

Query: 480 LSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTVVTNPVKLHLNGADVPQTPLTEMKPKH 539
           LSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHT V NPVK+HL GA+ PQ P  EMKPKH
Sbjct: 481 LSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAVVNPVKIHLEGAEAPQEPKIEMKPKH 540

Query: 540 KKNPAVGEKKVIYYKDVLIGAEDAAMLAAGEEVTLMDWGNAIIRGKNDDGSLTADLNLEG 599
           KKNPAVGEKKVIYYKD+++  +DA ++   EEVTLMDWGN +I  KN DGS+ A L+LEG
Sbjct: 541 KKNPAVGEKKVIYYKDIVVDKDDADVIDVDEEVTLMDWGNVVITKKNADGSMVAKLHLEG 600

Query: 600 DFKKTKFKLTWLADTSDTVPVDLVDFDHLISKDRLEEEDNFEDFLTPETEFHTTAIADLN 659
           DFKKTK KLTWLADT D VPVDLVDFDHL++KD+LEE+++FEDFLTPETEFHT AIADLN
Sbjct: 601 DFKKTKHKLTWLADTKDIVPVDLVDFDHLLTKDKLEEDESFEDFLTPETEFHTDAIADLN 660

Query: 660 VKDMKVGDVIQFERTGYYRLDTVGSGDKPFVFFTIPDGKAVNKYGAKK 707
           VKDMKVGD++QFER GY+RLD +    KP+VFFTIPDGK+VNKYGAKK
Sbjct: 661 VKDMKVGDIVQFERKGYFRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708

>CAGL0C01947g Chr3 (204411..206528) [2118 bp, 705 aa] {ON} highly
           similar to uniprot|P46655 Saccharomyces cerevisiae
           YGL245w
          Length = 705

 Score = 1144 bits (2959), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 552/708 (77%), Positives = 621/708 (87%), Gaps = 4/708 (0%)

Query: 1   MSSTLIIAAKSPAVAYAELIAARAVNEAKQDA-VAIQFTEGKEAAAASFDGESQNALERM 59
           MSSTL+I  K+P VAYAELIAAR VN++K DA V ++F + K++AAA+FDG+S NALE +
Sbjct: 1   MSSTLVINGKAPVVAYAELIAARLVNDSKSDASVTVEFVDDKKSAAATFDGKSDNALEAI 60

Query: 60  VEKYPDVLGSVPEEAAWWIAYARTDLVVKDFKKLSGSLEKLDAHLNLRTFVLGGMQPTVA 119
           V K+P++LG+  EE+  WI  A  +LV+K+F+KL+ SLEKLDA LN RT++ GG++   A
Sbjct: 61  VAKFPEILGA-NEESKPWIKLAAEELVIKNFQKLAQSLEKLDAQLNFRTYINGGLKFDSA 119

Query: 120 DVAVWGALRSNGPVGSIIKNKVYVNVSRWYTTLELIPAFGGAHEFLAKSLKELKAAGNVN 179
           D+A WGALRSNG VGSIIKNKVYVNVSRWY  LE  P+FG +HEFL KSL+ELK A N  
Sbjct: 120 DIACWGALRSNGMVGSIIKNKVYVNVSRWYLLLESNPSFGQSHEFLTKSLQELKKAANAG 179

Query: 180 KKKETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 239
           KKKE+HKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF
Sbjct: 180 KKKESHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 239

Query: 240 DDTNPSKERVEFQDSILEDLELLGIKGDRITHSSDYFQEMYDYCVQMIKEGKAYCDDTPT 299
           DDTNPSKE+ EFQDSILEDLELLGIKGDRIT+SSDYFQEMY+ CV++IKEGKAYCDDTPT
Sbjct: 240 DDTNPSKEKTEFQDSILEDLELLGIKGDRITYSSDYFQEMYELCVKLIKEGKAYCDDTPT 299

Query: 300 XXXXXXXXXGIASARRERSVEENLKIFTEEMKNGTEEGLKNCVRAKRDYAALNKTLKDPV 359
                    GIASARRERSVEENLKIFTE+MKNGTEEGLKNCVRAK DYAALNKTL+DPV
Sbjct: 300 EKMREERMDGIASARRERSVEENLKIFTEDMKNGTEEGLKNCVRAKIDYAALNKTLRDPV 359

Query: 360 LYRCNLTPHHRTGTAWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALKL 419
           +YRCNLTPHHRTG+ WK+YPTYDFCVPIVD++EGVTHALRTIEYRDRNAQY+W L+ L L
Sbjct: 360 IYRCNLTPHHRTGSEWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWFLDNLNL 419

Query: 420 RKVHIWDFARVNFVRTLLSKRKLQWLVDKQVVSNWDDPRFPTVRGVRRRGMTIEGLRNFV 479
           RKVHIWDFARVNFVRTLLSKRKLQW+VDK +VSNWDDPRFPTVRGVRRRGMT+EGLRNFV
Sbjct: 420 RKVHIWDFARVNFVRTLLSKRKLQWMVDKNLVSNWDDPRFPTVRGVRRRGMTVEGLRNFV 479

Query: 480 LSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTVVTNPVKLHLNGADVPQTPLTEMKPKH 539
           LSQGPSRNVINLEWNLIWAFNKKVIDP+APRHT + NPVK+H+ GA  P++P TEMKPKH
Sbjct: 480 LSQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAIVNPVKIHIEGA--PESPKTEMKPKH 537

Query: 540 KKNPAVGEKKVIYYKDVLIGAEDAAMLAAGEEVTLMDWGNAIIRGKNDDGSLTADLNLEG 599
           KKNPAVGEKKVIYY++V+I  EDA  +   EEVTLMDWGN II  KN DGS+ A L+LEG
Sbjct: 538 KKNPAVGEKKVIYYQNVVIDKEDADSIEDNEEVTLMDWGNIIITKKNADGSMEAKLHLEG 597

Query: 600 DFKKTKFKLTWLADTSDTVPVDLVDFDHLISKDRLEEEDNFEDFLTPETEFHTTAIADLN 659
           DFKKTK KLTWLADT D+V VDLVDFDHLISKD+LEE+++FEDFLTP+TEFHT AIADLN
Sbjct: 598 DFKKTKHKLTWLADTDDSVKVDLVDFDHLISKDKLEEDESFEDFLTPQTEFHTEAIADLN 657

Query: 660 VKDMKVGDVIQFERTGYYRLDTVGSGDKPFVFFTIPDGKAVNKYGAKK 707
           VKDM VGD+IQFER GYYRLD      KP+VFFTIPDGK+VNKYGAKK
Sbjct: 658 VKDMIVGDIIQFERKGYYRLDAEAKDGKPYVFFTIPDGKSVNKYGAKK 705

>Smik_7.16 Chr7 (33804..35930) [2127 bp, 708 aa] {ON} YGL245W (REAL)
          Length = 708

 Score = 1143 bits (2957), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 539/708 (76%), Positives = 612/708 (86%), Gaps = 1/708 (0%)

Query: 1   MSSTLIIAAKSPAVAYAELIAARAVNEAKQDAVAIQFTEGKEAAAASFDGESQNALERMV 60
           M STL I  K+P VAYAELIAAR VN    +++AI F + K+A AA  D  +++   ++ 
Sbjct: 1   MPSTLTINGKAPIVAYAELIAARIVNALAPNSIAIVFVDDKKAPAAILDDATEDVFSKIT 60

Query: 61  EKYPDVLGSV-PEEAAWWIAYARTDLVVKDFKKLSGSLEKLDAHLNLRTFVLGGMQPTVA 119
            K+  +  +   E+ A W+  A+ +LVVK+F KLS SLE LD+ LNLRTF+LGG++ + A
Sbjct: 61  GKFAAIFDNGDKEQLAKWVDLAQKELVVKNFAKLSQSLEALDSQLNLRTFILGGLKYSAA 120

Query: 120 DVAVWGALRSNGPVGSIIKNKVYVNVSRWYTTLELIPAFGGAHEFLAKSLKELKAAGNVN 179
           DVA WGALRSNG  GSIIKNKV VNVSRWYT LE+ P FG AH+FL+KSL+ELK + NV 
Sbjct: 121 DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLSKSLQELKKSANVG 180

Query: 180 KKKETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 239
           KKKETHKANFEIDLP+AKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF
Sbjct: 181 KKKETHKANFEIDLPEAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 240

Query: 240 DDTNPSKERVEFQDSILEDLELLGIKGDRITHSSDYFQEMYDYCVQMIKEGKAYCDDTPT 299
           DDTNPSKE+ EFQDSILEDL+LLGIKGD+IT+SSDYFQEMYDYC+QMIK+GKAYCDDTPT
Sbjct: 241 DDTNPSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEMYDYCIQMIKDGKAYCDDTPT 300

Query: 300 XXXXXXXXXGIASARRERSVEENLKIFTEEMKNGTEEGLKNCVRAKRDYAALNKTLKDPV 359
                    GIAS+RR+RSVEENL+IFTEEMKNGTEEGLKNCVRAK DY ALNKTL+DPV
Sbjct: 301 EKMREERMDGIASSRRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPV 360

Query: 360 LYRCNLTPHHRTGTAWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALKL 419
           +YRCNLTPHHRTG+ WKIYPTYDFCVPIVDA+EGVTHALRTIEYRDRNAQY+WML AL+L
Sbjct: 361 IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDAVEGVTHALRTIEYRDRNAQYDWMLQALRL 420

Query: 420 RKVHIWDFARVNFVRTLLSKRKLQWLVDKQVVSNWDDPRFPTVRGVRRRGMTIEGLRNFV 479
           RKVHIWDFAR+NFVRTLLSKRKLQW+VDK +V NWDDPRFPTVRGVRRRGMT+EGLRNFV
Sbjct: 421 RKVHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTVRGVRRRGMTVEGLRNFV 480

Query: 480 LSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTVVTNPVKLHLNGADVPQTPLTEMKPKH 539
           LSQGPSRNVINLEWNLIWAFNKK+IDPIAPRHT + NPVK+HL G++ PQ P TE KPKH
Sbjct: 481 LSQGPSRNVINLEWNLIWAFNKKIIDPIAPRHTAIVNPVKIHLEGSEAPQEPKTETKPKH 540

Query: 540 KKNPAVGEKKVIYYKDVLIGAEDAAMLAAGEEVTLMDWGNAIIRGKNDDGSLTADLNLEG 599
           KKNPAVGEKKVIYYKD+++  +DA ++   EE+TLMDWGN II  KN+DGS+ A LNLEG
Sbjct: 541 KKNPAVGEKKVIYYKDIVVDKDDADVINVDEEITLMDWGNVIITKKNEDGSMIAKLNLEG 600

Query: 600 DFKKTKFKLTWLADTSDTVPVDLVDFDHLISKDRLEEEDNFEDFLTPETEFHTTAIADLN 659
           DFKKTK KLTWLADT D VPVDLVDFDHLI+KDRLEE+++FEDFLTP+TEFHT AIADLN
Sbjct: 601 DFKKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLN 660

Query: 660 VKDMKVGDVIQFERTGYYRLDTVGSGDKPFVFFTIPDGKAVNKYGAKK 707
           VKDMK+GD+IQFER GYYRLD +    KP+VFFTIPDGK+VNKYGAKK
Sbjct: 661 VKDMKIGDIIQFERKGYYRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708

>SAKL0F00748g Chr6 (64800..66923) [2124 bp, 707 aa] {ON} highly
           similar to uniprot|P46655 Saccharomyces cerevisiae
           YGL245W GUS1 Glutamyl-tRNA synthetase (GluRS) forms a
           complex with methionyl-tRNA synthetase (Mes1p) and Arc1p
           complex formation increases the catalytic efficiency of
           both tRNA synthetases and ensures their correct
           localization to the cytoplasm
          Length = 707

 Score = 1141 bits (2952), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 552/707 (78%), Positives = 606/707 (85%)

Query: 1   MSSTLIIAAKSPAVAYAELIAARAVNEAKQDAVAIQFTEGKEAAAASFDGESQNALERMV 60
           MS+ L+I  K+P VAYAELIAAR VN +K DA+ I+F + K+AA A+F+GE+ +A  +++
Sbjct: 1   MSANLVINGKAPVVAYAELIAARIVNASKADAIKIEFVDDKKAAPATFNGEADSAFSKII 60

Query: 61  EKYPDVLGSVPEEAAWWIAYARTDLVVKDFKKLSGSLEKLDAHLNLRTFVLGGMQPTVAD 120
             Y DV     + ++ W   A  + ++K+F+KLSGSL KLD+ LNLRT++L     T AD
Sbjct: 61  NAYQDVFSEGVQGSSEWSKLASEEFIIKNFQKLSGSLAKLDSRLNLRTYILDSFTATPAD 120

Query: 121 VAVWGALRSNGPVGSIIKNKVYVNVSRWYTTLELIPAFGGAHEFLAKSLKELKAAGNVNK 180
           +A WGALRSNG VGSIIKNKVYVNVSRWYT LEL P F GAHEFL KSL+ELK A N NK
Sbjct: 121 IACWGALRSNGMVGSIIKNKVYVNVSRWYTMLELDPLFSGAHEFLTKSLQELKKASNSNK 180

Query: 181 KKETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFD 240
           KKETHKANFEI LPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFD
Sbjct: 181 KKETHKANFEIGLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFD 240

Query: 241 DTNPSKERVEFQDSILEDLELLGIKGDRITHSSDYFQEMYDYCVQMIKEGKAYCDDTPTX 300
           DTNPSKE+VEFQDSILEDL+LLGIKGD+IT+SSDYF+EMY  CVQ+IKEGKAYCDDTPT 
Sbjct: 241 DTNPSKEKVEFQDSILEDLDLLGIKGDKITYSSDYFEEMYQLCVQLIKEGKAYCDDTPTE 300

Query: 301 XXXXXXXXGIASARRERSVEENLKIFTEEMKNGTEEGLKNCVRAKRDYAALNKTLKDPVL 360
                   GIASARR+RSVEENL+IF EEMKNGTEEGLKNCVRAK DY ALNK L+DPV+
Sbjct: 301 KMREERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKALRDPVI 360

Query: 361 YRCNLTPHHRTGTAWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALKLR 420
           +RCNLTPHHRTGT WK+YPTYDFCVPIVDA+EGVTHALRTIEYRDRN QYEWML+AL LR
Sbjct: 361 FRCNLTPHHRTGTTWKMYPTYDFCVPIVDAIEGVTHALRTIEYRDRNPQYEWMLDALHLR 420

Query: 421 KVHIWDFARVNFVRTLLSKRKLQWLVDKQVVSNWDDPRFPTVRGVRRRGMTIEGLRNFVL 480
           KVHIWDFARVNFVRTLLSKRKLQW+VDK  VSNWDDPRFPTVRGVRRRGMT+EGLRNFVL
Sbjct: 421 KVHIWDFARVNFVRTLLSKRKLQWMVDKGCVSNWDDPRFPTVRGVRRRGMTVEGLRNFVL 480

Query: 481 SQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTVVTNPVKLHLNGADVPQTPLTEMKPKHK 540
           SQGPSRNVINLEWNLIWAFNKKVIDP+APRHT V  PVKLHL G DVPQ P  EMK KHK
Sbjct: 481 SQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVKPVKLHLEGDDVPQNPKIEMKLKHK 540

Query: 541 KNPAVGEKKVIYYKDVLIGAEDAAMLAAGEEVTLMDWGNAIIRGKNDDGSLTADLNLEGD 600
           KNP VGEKKVIYYKDVLI  EDA +++ GEE+TLMDWGN II  KN DGSL   L+LEGD
Sbjct: 541 KNPDVGEKKVIYYKDVLIDQEDADVVSEGEELTLMDWGNVIITKKNSDGSLVGKLHLEGD 600

Query: 601 FKKTKFKLTWLADTSDTVPVDLVDFDHLISKDRLEEEDNFEDFLTPETEFHTTAIADLNV 660
           FKKTK KLTWLADT D V VDLVDFDHLISKD+LEE DNFEDFLTPETEFHT AIADLNV
Sbjct: 601 FKKTKLKLTWLADTEDKVDVDLVDFDHLISKDKLEEGDNFEDFLTPETEFHTPAIADLNV 660

Query: 661 KDMKVGDVIQFERTGYYRLDTVGSGDKPFVFFTIPDGKAVNKYGAKK 707
           KDMKVGDVIQFER GYYRLD++    KP+VFFTIPDGKAVNKYGAKK
Sbjct: 661 KDMKVGDVIQFERKGYYRLDSLAKDGKPYVFFTIPDGKAVNKYGAKK 707

>Skud_7.22 Chr7 (43191..45317) [2127 bp, 708 aa] {ON} YGL245W (REAL)
          Length = 708

 Score = 1139 bits (2947), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 537/708 (75%), Positives = 607/708 (85%), Gaps = 1/708 (0%)

Query: 1   MSSTLIIAAKSPAVAYAELIAARAVNEAKQDAVAIQFTEGKEAAAASFDGESQNALERMV 60
           M STL +  K+P+VAYAELIAAR VN    +++AIQF + K+A AA  D  ++    ++ 
Sbjct: 1   MPSTLTVNGKAPSVAYAELIAARIVNALAPNSIAIQFVDDKKAPAAKLDDATEGVFNKIT 60

Query: 61  EKYPDVLGSV-PEEAAWWIAYARTDLVVKDFKKLSGSLEKLDAHLNLRTFVLGGMQPTVA 119
            K+  +  +   E+ + W   A  +LVVK+F KLS SLE LD+ LN+RTF+LGG++ + A
Sbjct: 61  GKFAAIFDNGDKEQVSRWTDLAEKELVVKNFAKLSQSLETLDSQLNVRTFILGGLKYSAA 120

Query: 120 DVAVWGALRSNGPVGSIIKNKVYVNVSRWYTTLELIPAFGGAHEFLAKSLKELKAAGNVN 179
           DVA WGALRSNG  GSIIKNKV VNVSRWYT LE+ P FG AH+FL KSL+ELK + NV 
Sbjct: 121 DVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLTKSLQELKKSANVG 180

Query: 180 KKKETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 239
           KKKETHKANFEIDLPDAK+G+VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF
Sbjct: 181 KKKETHKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 240

Query: 240 DDTNPSKERVEFQDSILEDLELLGIKGDRITHSSDYFQEMYDYCVQMIKEGKAYCDDTPT 299
           DDTNPSKE+ EFQDSILEDL+LLGIKGD+IT+SSDYFQEM+DYCVQMIK+GKAYCDDTPT
Sbjct: 241 DDTNPSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEMFDYCVQMIKDGKAYCDDTPT 300

Query: 300 XXXXXXXXXGIASARRERSVEENLKIFTEEMKNGTEEGLKNCVRAKRDYAALNKTLKDPV 359
                    GIASARR RSVEENL++FTEEMKNGTEEGLKNCVRAK DY ALNKTL+DPV
Sbjct: 301 ERMREERMDGIASARRNRSVEENLRLFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDPV 360

Query: 360 LYRCNLTPHHRTGTAWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALKL 419
           +YRCNLTPHHRTG+ WKIYPTYDFCVPIVDA+EGVTHALRTIEYRDRN QY+WML AL+L
Sbjct: 361 IYRCNLTPHHRTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNIQYDWMLQALRL 420

Query: 420 RKVHIWDFARVNFVRTLLSKRKLQWLVDKQVVSNWDDPRFPTVRGVRRRGMTIEGLRNFV 479
           RKVHIWDFAR+NFVRTLLSKRKLQW+VDK +V NWDDPRFPTVRGVRRRGMT+EGLRNFV
Sbjct: 421 RKVHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTVRGVRRRGMTVEGLRNFV 480

Query: 480 LSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTVVTNPVKLHLNGADVPQTPLTEMKPKH 539
           LSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHT + NPVK+HL G + PQ P  EMKPKH
Sbjct: 481 LSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGTEAPQEPKVEMKPKH 540

Query: 540 KKNPAVGEKKVIYYKDVLIGAEDAAMLAAGEEVTLMDWGNAIIRGKNDDGSLTADLNLEG 599
           KKNPAVGEKK+IYYKD+++  EDA ++   EEVTLMDWGN II  KNDDGS+ A L+LEG
Sbjct: 541 KKNPAVGEKKLIYYKDIVVDREDADVINVDEEVTLMDWGNVIITKKNDDGSMVAKLHLEG 600

Query: 600 DFKKTKFKLTWLADTSDTVPVDLVDFDHLISKDRLEEEDNFEDFLTPETEFHTTAIADLN 659
           DFKKTK KLTWLADT D VPVDLVDFDHLI+KDRLEE+++FEDFLTP+TEFHT AIADLN
Sbjct: 601 DFKKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLN 660

Query: 660 VKDMKVGDVIQFERTGYYRLDTVGSGDKPFVFFTIPDGKAVNKYGAKK 707
           VKDMKVGD+IQFER GYYRLD +    KP+VFFTIPDGK+VN+YGAKK
Sbjct: 661 VKDMKVGDIIQFERKGYYRLDALPKNGKPYVFFTIPDGKSVNRYGAKK 708

>NDAI0I03250 Chr9 complement(762687..764816) [2130 bp, 709 aa] {ON}
           Anc_3.569 YGL245W
          Length = 709

 Score = 1137 bits (2942), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 535/707 (75%), Positives = 609/707 (86%), Gaps = 1/707 (0%)

Query: 2   SSTLIIAAKSPAVAYAELIAARAVNEAKQDAVAIQFTEGKEAAAASFDGESQNALERMVE 61
           ++TL+I  K+P VAY +LIAAR +N+AK  ++ IQF + K++A + F+G S +   +++E
Sbjct: 3   ANTLVINGKAPVVAYGDLIAARIINDAKPTSIDIQFVDDKKSAPSVFNGSSDSTFLKIIE 62

Query: 62  KYPDVLGSVPEEA-AWWIAYARTDLVVKDFKKLSGSLEKLDAHLNLRTFVLGGMQPTVAD 120
            +P++     ++A A W   A  +LVVK+F+KLS SL KLDA LNLRTF+LGG++ + AD
Sbjct: 63  GFPEIFTESNKDAVAEWTKIANEELVVKNFQKLSESLGKLDAQLNLRTFILGGLKYSAAD 122

Query: 121 VAVWGALRSNGPVGSIIKNKVYVNVSRWYTTLELIPAFGGAHEFLAKSLKELKAAGNVNK 180
           +A WGALRSNG  GSI+KNKV VNVSRWY+ LE+ P FG  HE L KSL+ELK   N  K
Sbjct: 123 IACWGALRSNGMCGSILKNKVDVNVSRWYSLLEMDPTFGSVHESLTKSLQELKKVSNSGK 182

Query: 181 KKETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFD 240
           KKETHKANFEIDLPDAK+GEVVTRFPPEPSGYLHIGHAKAA+LNQYFAQAYKGKLIIRFD
Sbjct: 183 KKETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRFD 242

Query: 241 DTNPSKERVEFQDSILEDLELLGIKGDRITHSSDYFQEMYDYCVQMIKEGKAYCDDTPTX 300
           DTNPSKE+ EFQDSILEDLELLGIKGDRIT+SSDYFQ+MY+ CV+MIKEGKAYCDDTPT 
Sbjct: 243 DTNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQQMYELCVKMIKEGKAYCDDTPTE 302

Query: 301 XXXXXXXXGIASARRERSVEENLKIFTEEMKNGTEEGLKNCVRAKRDYAALNKTLKDPVL 360
                   GIASARR+RSVEENL+IF EEMKNGTEEGLKNCVRAK DY ALNKTL+DPV+
Sbjct: 303 KMREERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVI 362

Query: 361 YRCNLTPHHRTGTAWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALKLR 420
           YRCNLTPHHRTGT WK+YPTYDFCVPIVD+LEGVTHALRTIEYRDRNAQY+WML+A+ LR
Sbjct: 363 YRCNLTPHHRTGTTWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYDWMLDAMNLR 422

Query: 421 KVHIWDFARVNFVRTLLSKRKLQWLVDKQVVSNWDDPRFPTVRGVRRRGMTIEGLRNFVL 480
           KVHIWDFARVNFVRTLLSKRKLQW+VDK +VSNWDDPRFPTVRGVRRRGMT+EGLRNFVL
Sbjct: 423 KVHIWDFARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTVRGVRRRGMTVEGLRNFVL 482

Query: 481 SQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTVVTNPVKLHLNGADVPQTPLTEMKPKHK 540
           SQGPSRNVINLEWNLIWAFNKKVIDP+A RHT + +PVK+HL G DVPQTP TEMKPKHK
Sbjct: 483 SQGPSRNVINLEWNLIWAFNKKVIDPVAARHTAIVDPVKIHLEGDDVPQTPKTEMKPKHK 542

Query: 541 KNPAVGEKKVIYYKDVLIGAEDAAMLAAGEEVTLMDWGNAIIRGKNDDGSLTADLNLEGD 600
           KNPAVGEKKVIYYKD++I   DA ++   EEVT+MDWGN II  KN DGS+   L+L+GD
Sbjct: 543 KNPAVGEKKVIYYKDIVIDKADADLIEENEEVTMMDWGNVIITKKNADGSMVGKLHLDGD 602

Query: 601 FKKTKFKLTWLADTSDTVPVDLVDFDHLISKDRLEEEDNFEDFLTPETEFHTTAIADLNV 660
           FKKTK KLTWLADT D VPVDLVDFDHLISKD+LEE+++FEDFLTP TEFHT+AIADLNV
Sbjct: 603 FKKTKHKLTWLADTEDVVPVDLVDFDHLISKDKLEEDESFEDFLTPTTEFHTSAIADLNV 662

Query: 661 KDMKVGDVIQFERTGYYRLDTVGSGDKPFVFFTIPDGKAVNKYGAKK 707
           KDMKVGD+IQFER GYYRLD V    KP+VFFTIPDGK+VNKYGAKK
Sbjct: 663 KDMKVGDIIQFERKGYYRLDAVAKDGKPYVFFTIPDGKSVNKYGAKK 709

>KNAG0I00220 Chr9 (26235..28358) [2124 bp, 707 aa] {ON} Anc_3.569
           YGL245W
          Length = 707

 Score = 1130 bits (2924), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 539/709 (76%), Positives = 606/709 (85%), Gaps = 7/709 (0%)

Query: 2   SSTLIIAAKSPAVAYAELIAARAVNEAKQDAVAIQFTEGKEAAAASFDGESQNALERMVE 61
           ++TL+I  K+P VAY  LIAAR  N AK  +VAI+F + K AA A F+G+S++ L ++  
Sbjct: 3   AATLVINGKAPIVAYGPLIAARIANSAKSSSVAIEFVDDKNAAPAVFNGDSEDVLSKIAA 62

Query: 62  KYPDVLGSVPEEAA---WWIAYARTDLVVKDFKKLSGSLEKLDAHLNLRTFVLGGMQPTV 118
           ++P++     EEAA    W+  A  + VVK+F KL+ SL KLDAHLNLRTFVLGG++ +V
Sbjct: 63  QFPELFAQ--EEAADVATWVKTANDEFVVKNFAKLAESLAKLDAHLNLRTFVLGGLKYSV 120

Query: 119 ADVAVWGALRSNGPVGSIIKNKVYVNVSRWYTTLELIPAFGGAHEFLAKSLKELKAAGNV 178
           AD+A WGALRSNG VGSIIKNKVYVNVSRWYT  E+ P F  AHEFL KS++ELK A   
Sbjct: 121 ADIACWGALRSNGMVGSIIKNKVYVNVSRWYTLFEMFPQFSNAHEFLTKSMQELKKASTA 180

Query: 179 NKKKETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIR 238
            KKKE+HKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIR
Sbjct: 181 GKKKESHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIR 240

Query: 239 FDDTNPSKERVEFQDSILEDLELLGIKGDRITHSSDYFQEMYDYCVQMIKEGKAYCDDTP 298
           FDDTNPSKE+ EFQDSILEDL LLGIKGDR+T+SSDYFQ+MYD C+Q+IKEG AYCDDTP
Sbjct: 241 FDDTNPSKEKEEFQDSILEDLSLLGIKGDRVTYSSDYFQQMYDMCIQLIKEGGAYCDDTP 300

Query: 299 TXXXXXXXXXGIASARRERSVEENLKIFTEEMKNGTEEGLKNCVRAKRDYAALNKTLKDP 358
           T         GIASARR+RSVEENLKIFTEEMKNGTEEGLKNCVRAK DYAA NKTL+DP
Sbjct: 301 TEKMREERMDGIASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYAAPNKTLRDP 360

Query: 359 VLYRCNLTPHHRTGTAWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALK 418
           V+YRCNLTPHHRTG  WK+YPTYDFCVPIVD++EGVTHALRTIEYRDRN QY+WMLNAL 
Sbjct: 361 VIYRCNLTPHHRTGDTWKVYPTYDFCVPIVDSVEGVTHALRTIEYRDRNVQYDWMLNALH 420

Query: 419 LRKVHIWDFARVNFVRTLLSKRKLQWLVDKQVVSNWDDPRFPTVRGVRRRGMTIEGLRNF 478
           LRKVHIWDFARVNFVRTLLSKRKLQW+VDK +V NWDDPRFPTVRGVRRRGMT+EGLRNF
Sbjct: 421 LRKVHIWDFARVNFVRTLLSKRKLQWMVDKGLVENWDDPRFPTVRGVRRRGMTVEGLRNF 480

Query: 479 VLSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTVVTNPVKLHLNGADVPQTPLTEMKPK 538
           VLSQGPSRNVINLEWNLIWAFNKKVIDP+APRHT V +PVKLH+ GA  P+TP TEMKPK
Sbjct: 481 VLSQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVDPVKLHIEGA--PETPKTEMKPK 538

Query: 539 HKKNPAVGEKKVIYYKDVLIGAEDAAMLAAGEEVTLMDWGNAIIRGKNDDGSLTADLNLE 598
           HKKNPAVGEKKVI+Y++V+I  EDAA L   EEVTLMDWGN II  ++ DGSL   L+LE
Sbjct: 539 HKKNPAVGEKKVIFYQNVVIDKEDAASLETDEEVTLMDWGNVIITKRHPDGSLEGKLHLE 598

Query: 599 GDFKKTKFKLTWLADTSDTVPVDLVDFDHLISKDRLEEEDNFEDFLTPETEFHTTAIADL 658
           GDFKKTK KLTWLADT D VPVDLVDFDHLI+KDRLEE ++FEDFLTP+TEF T AIADL
Sbjct: 599 GDFKKTKHKLTWLADTEDVVPVDLVDFDHLINKDRLEEGESFEDFLTPQTEFETKAIADL 658

Query: 659 NVKDMKVGDVIQFERTGYYRLDTVGSGDKPFVFFTIPDGKAVNKYGAKK 707
           NVK MKVGD+IQFER GYYRLD++    KP++FFTIPDGK+VN+YGAKK
Sbjct: 659 NVKHMKVGDIIQFERKGYYRLDSLPKDGKPYIFFTIPDGKSVNRYGAKK 707

>Kwal_47.19272 s47 complement(1165848..1167962) [2115 bp, 704 aa]
           {ON} YGL245W - Protein required for cell viability
           [contig 344] FULL
          Length = 704

 Score = 1128 bits (2918), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 537/705 (76%), Positives = 602/705 (85%), Gaps = 2/705 (0%)

Query: 3   STLIIAAKSPAVAYAELIAARAVNEAKQDAVAIQFTEGKEAAAASFDGESQNALERMVEK 62
           + L +A+K+P VAY+ELIAAR  N  K   + I F E K+A+ A+F+G S + L+ +VE 
Sbjct: 2   AKLTLASKAPVVAYSELIAARLTNAVKPGTIEIDFVEDKKASPATFEGNSNDVLKTIVES 61

Query: 63  YPDVLGSVPEEAAWWIAYARTDLVVKDFKKLSGSLEKLDAHLNLRTFVLGGMQPTVADVA 122
           +P+      +    W  +A  +LVVK+F+KLS SL+KLDA LNLRTF+LGG   + AD+A
Sbjct: 62  FPEAFKGGFDGCEKWSQFASEELVVKNFQKLSVSLDKLDAQLNLRTFLLGGTSYSPADIA 121

Query: 123 VWGALRSNGPVGSIIKNKVYVNVSRWYTTLELIPAFGGAHEFLAKSLKELKAAGNVNKKK 182
            WG+LRSNG VGSIIKN+VYVNVSRWYT LE +P FG AHEFL K+++ELK A   NKKK
Sbjct: 122 CWGSLRSNGMVGSIIKNRVYVNVSRWYTLLEQVPEFGSAHEFLTKAVQELKKASTGNKKK 181

Query: 183 ETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDT 242
           ETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAA+LNQYFAQ YKGKLIIRFDDT
Sbjct: 182 ETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDDT 241

Query: 243 NPSKERVEFQDSILEDLELLGIKGDRITHSSDYFQEMYDYCVQMIKEGKAYCDDTPTXXX 302
           NPSKE+ EFQDSILEDLELLGIKGDR+T+SSDYFQEMY+ CV+MI+EGKAYCDDT T   
Sbjct: 242 NPSKEKEEFQDSILEDLELLGIKGDRVTYSSDYFQEMYELCVKMIEEGKAYCDDTATERM 301

Query: 303 XXXXXXGIASARRERSVEENLKIFTEEMKNGTEEGLKNCVRAKRDYAALNKTLKDPVLYR 362
                 GIASARR+RSVEENL+IFT EMKNGTEEGLKNCVRAK DY A NKTL+DPV+YR
Sbjct: 302 REERMDGIASARRDRSVEENLRIFTHEMKNGTEEGLKNCVRAKIDYEAPNKTLRDPVIYR 361

Query: 363 CNLTPHHRTGTAWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALKLRKV 422
           CNLTPHHRTG+ WKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQY+WMLNAL LRKV
Sbjct: 362 CNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLNALHLRKV 421

Query: 423 HIWDFARVNFVRTLLSKRKLQWLVDKQVVSNWDDPRFPTVRGVRRRGMTIEGLRNFVLSQ 482
           HIWDFARVNFVRTLLSKRKLQW+VDK +VSNWDDPRFPTVRGVRRRGMT+EGLRNFVLSQ
Sbjct: 422 HIWDFARVNFVRTLLSKRKLQWMVDKDLVSNWDDPRFPTVRGVRRRGMTVEGLRNFVLSQ 481

Query: 483 GPSRNVINLEWNLIWAFNKKVIDPIAPRHTVVTNPVKLHLNGADVPQTPLTEMKPKHKKN 542
           GPSRNVINLEWNLIWAFNKKVIDP+APRHT V NPVK H++GA  PQTP  +MK KHKKN
Sbjct: 482 GPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVNPVKFHIDGA--PQTPDVQMKLKHKKN 539

Query: 543 PAVGEKKVIYYKDVLIGAEDAAMLAAGEEVTLMDWGNAIIRGKNDDGSLTADLNLEGDFK 602
           PAVGEKKVIYY DVLI  +DA ++  GEE+TLMDWGN I+  KN DGSLT  L+LEGDFK
Sbjct: 540 PAVGEKKVIYYTDVLIDEDDAKLIEEGEELTLMDWGNVIVTKKNADGSLTGKLHLEGDFK 599

Query: 603 KTKFKLTWLADTSDTVPVDLVDFDHLISKDRLEEEDNFEDFLTPETEFHTTAIADLNVKD 662
           KTK K+TWLADTSD V VDLVDFDHLISKD+LEE ++F DFLTP+TEFH  AIADLNVKD
Sbjct: 600 KTKLKVTWLADTSDKVNVDLVDFDHLISKDKLEEGEDFADFLTPKTEFHVPAIADLNVKD 659

Query: 663 MKVGDVIQFERTGYYRLDTVGSGDKPFVFFTIPDGKAVNKYGAKK 707
           MK GD+IQFER GYYRLD V  GDKP+VFF+IPDGK+VNKYGAKK
Sbjct: 660 MKKGDIIQFERKGYYRLDAVADGDKPYVFFSIPDGKSVNKYGAKK 704

>TDEL0D06370 Chr4 complement(1143917..1146037) [2121 bp, 706 aa]
           {ON} Anc_3.569 YGL245W
          Length = 706

 Score = 1128 bits (2917), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 538/706 (76%), Positives = 605/706 (85%), Gaps = 2/706 (0%)

Query: 3   STLIIAAKSPAVAYAELIAARAVNEAKQDAVAIQFTEGKEAAAASFDGESQNALERMVEK 62
           + LII  K+P VAYAELIAAR VN    +++ ++F + K+AA A  DGES+    +++E 
Sbjct: 2   AKLIINGKAPVVAYAELIAARVVNTVNPESINVEFVDDKKAAPAVLDGESEGVFMKIIEA 61

Query: 63  YPDVLG-SVPEEAAWWIAYARTDLVVKDFKKLSGSLEKLDAHLNLRTFVLGGMQPTVADV 121
           +P +      EE A W+  A +D V+K+F+KLSGSLEKLDA LNLRT++LGG++ + AD+
Sbjct: 62  FPKIFTEGTSEEIAAWVKTASSDYVIKNFQKLSGSLEKLDAVLNLRTYILGGLKYSAADI 121

Query: 122 AVWGALRSNGPVGSIIKNKVYVNVSRWYTTLELIPAFGGAHEFLAKSLKELKAAGNVNKK 181
           A WGALRSNG VGSIIKNKV VNVSRWYT LE   AFGGAHEFL KS+++LK A NV KK
Sbjct: 122 ACWGALRSNGMVGSIIKNKVDVNVSRWYTLLETDLAFGGAHEFLTKSMQDLKKASNVGKK 181

Query: 182 KETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDD 241
           KE HKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFA+ YKGKLIIRFDD
Sbjct: 182 KEGHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFDD 241

Query: 242 TNPSKERVEFQDSILEDLELLGIKGDRITHSSDYFQEMYDYCVQMIKEGKAYCDDTPTXX 301
           TNPSKE+ EFQDSI+EDL+LLGI+GDR+T SSDYFQEMYD CV+MIKEGKAYCDDT T  
Sbjct: 242 TNPSKEKEEFQDSIIEDLKLLGIEGDRLTFSSDYFQEMYDLCVKMIKEGKAYCDDTVTEK 301

Query: 302 XXXXXXXGIASARRERSVEENLKIFTEEMKNGTEEGLKNCVRAKRDYAALNKTLKDPVLY 361
                  GIASARR+R VEENL+IFT+EMKNGTEEGLKNCVRAK DY A NKTL+DPV+Y
Sbjct: 302 MREERMDGIASARRDRPVEENLRIFTKEMKNGTEEGLKNCVRAKIDYQAANKTLRDPVIY 361

Query: 362 RCNLTPHHRTGTAWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALKLRK 421
           RCNLTPHHRTGT  K YPTYDFCVP+VDA+EGVTHALRTIEYRDRNAQY+WMLNA+ LRK
Sbjct: 362 RCNLTPHHRTGTT-KTYPTYDFCVPVVDAIEGVTHALRTIEYRDRNAQYDWMLNAMNLRK 420

Query: 422 VHIWDFARVNFVRTLLSKRKLQWLVDKQVVSNWDDPRFPTVRGVRRRGMTIEGLRNFVLS 481
           VHIWDFARVNFVRTLLSKRKLQW+VDK +VSNWDDPRFPTVRGVRRRGMT+EGLRNFVLS
Sbjct: 421 VHIWDFARVNFVRTLLSKRKLQWMVDKNLVSNWDDPRFPTVRGVRRRGMTVEGLRNFVLS 480

Query: 482 QGPSRNVINLEWNLIWAFNKKVIDPIAPRHTVVTNPVKLHLNGADVPQTPLTEMKPKHKK 541
           QGPSRNVINLEWNLIWAFNKKVIDP+APR T V NPVKLHL+G D PQ+P TEMKPKHKK
Sbjct: 481 QGPSRNVINLEWNLIWAFNKKVIDPVAPRLTAVVNPVKLHLDGEDAPQSPKTEMKPKHKK 540

Query: 542 NPAVGEKKVIYYKDVLIGAEDAAMLAAGEEVTLMDWGNAIIRGKNDDGSLTADLNLEGDF 601
           NP VGEKKVI+YKDV+I  +DA +L   EEVTLMDWGN II  KN DGSL   LNL+GDF
Sbjct: 541 NPDVGEKKVIFYKDVVIDKDDADVLEDNEEVTLMDWGNVIITKKNADGSLEGKLNLDGDF 600

Query: 602 KKTKFKLTWLADTSDTVPVDLVDFDHLISKDRLEEEDNFEDFLTPETEFHTTAIADLNVK 661
           KKTK KLTWLADT D  PVDLVDFDHLISKD+LEE+++FEDFLTPETEFHT+AIADLNVK
Sbjct: 601 KKTKHKLTWLADTEDVAPVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLNVK 660

Query: 662 DMKVGDVIQFERTGYYRLDTVGSGDKPFVFFTIPDGKAVNKYGAKK 707
           D+KVGD+IQFER GYYRLD +    KP+VFFTIPDGK+VN+YGAKK
Sbjct: 661 DLKVGDIIQFERKGYYRLDALAKDGKPYVFFTIPDGKSVNRYGAKK 706

>TPHA0A06020 Chr1 complement(1361027..1363150) [2124 bp, 707 aa]
           {ON} Anc_3.569 YGL245W
          Length = 707

 Score = 1123 bits (2905), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 535/707 (75%), Positives = 609/707 (86%)

Query: 1   MSSTLIIAAKSPAVAYAELIAARAVNEAKQDAVAIQFTEGKEAAAASFDGESQNALERMV 60
           M +TLII  KS  VAY+ELIAAR VN  K D++ I+F E K+AAAAS +GE+ + L ++V
Sbjct: 1   MPATLIIGGKSSVVAYSELIAARIVNSVKPDSITIEFVEDKKAAAASLNGETDDVLSKIV 60

Query: 61  EKYPDVLGSVPEEAAWWIAYARTDLVVKDFKKLSGSLEKLDAHLNLRTFVLGGMQPTVAD 120
               DV       +  W+  A ++LV+K+F+KL+ SL+KLDAHLNLRTF+ GG+  ++AD
Sbjct: 61  SANADVFPEGVTGSEEWVKLAVSELVIKNFQKLATSLDKLDAHLNLRTFINGGLSYSIAD 120

Query: 121 VAVWGALRSNGPVGSIIKNKVYVNVSRWYTTLELIPAFGGAHEFLAKSLKELKAAGNVNK 180
           +A WGALRSNG VGSIIKNKV VNVSRWYT  E  P FG A+EFL KSL+ELK A +  K
Sbjct: 121 IACWGALRSNGMVGSIIKNKVNVNVSRWYTLFESNPIFGEANEFLTKSLQELKKASSAGK 180

Query: 181 KKETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFD 240
           KKETHKANFEIDLPDAK+GEVVTRFPPEPSGYLHIGHAKAA+LNQYFA AYKGKLIIRFD
Sbjct: 181 KKETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFADAYKGKLIIRFD 240

Query: 241 DTNPSKERVEFQDSILEDLELLGIKGDRITHSSDYFQEMYDYCVQMIKEGKAYCDDTPTX 300
           DTNPSKE+VEFQ+SILEDL LLGIKGDRITHSSDYFQEMYDYC+Q+IKEGKAYCDDTP  
Sbjct: 241 DTNPSKEKVEFQESILEDLALLGIKGDRITHSSDYFQEMYDYCIQLIKEGKAYCDDTPVD 300

Query: 301 XXXXXXXXGIASARRERSVEENLKIFTEEMKNGTEEGLKNCVRAKRDYAALNKTLKDPVL 360
                   GIASARR RSVEENLKIFTEEM+NGTEEGL+NCVRAK DY ALNKTL+DPV+
Sbjct: 301 KMREERMDGIASARRNRSVEENLKIFTEEMQNGTEEGLQNCVRAKIDYEALNKTLRDPVI 360

Query: 361 YRCNLTPHHRTGTAWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALKLR 420
           YRCNL PHHRTGTAWK+YPTYDFCVPIVD+LEGVTHALRTIEYRDRNAQYEWMLNA+ LR
Sbjct: 361 YRCNLNPHHRTGTAWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYEWMLNAMNLR 420

Query: 421 KVHIWDFARVNFVRTLLSKRKLQWLVDKQVVSNWDDPRFPTVRGVRRRGMTIEGLRNFVL 480
           KVHIWDFARVNFVRTLLSKRKLQW+VDK++VSNWDDPRFPTVRGVRRRGMTIEGLRNFV+
Sbjct: 421 KVHIWDFARVNFVRTLLSKRKLQWMVDKELVSNWDDPRFPTVRGVRRRGMTIEGLRNFVI 480

Query: 481 SQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTVVTNPVKLHLNGADVPQTPLTEMKPKHK 540
           SQGPSRNVINLEWNLIWAFNKKVIDP+APR T V NP+K+HL+GAD P+TP  EMKPKH 
Sbjct: 481 SQGPSRNVINLEWNLIWAFNKKVIDPVAPRLTCVINPIKIHLSGADAPETPRVEMKPKHP 540

Query: 541 KNPAVGEKKVIYYKDVLIGAEDAAMLAAGEEVTLMDWGNAIIRGKNDDGSLTADLNLEGD 600
           KNPAVGEK+VI+ KD++I  +DA ++  GEE+TLM+WGNAII  KN DGS+ A L+LEGD
Sbjct: 541 KNPAVGEKRVIFSKDIVIDKDDADVIEEGEEITLMNWGNAIIDKKNADGSIDATLHLEGD 600

Query: 601 FKKTKFKLTWLADTSDTVPVDLVDFDHLISKDRLEEEDNFEDFLTPETEFHTTAIADLNV 660
           FKKTK K+TWLA+T D   VDLVDFDHLI+KD+LEE+++FE+FLTP TEFHT AIAD+NV
Sbjct: 601 FKKTKHKITWLAETEDVTKVDLVDFDHLITKDKLEEDESFENFLTPNTEFHTDAIADVNV 660

Query: 661 KDMKVGDVIQFERTGYYRLDTVGSGDKPFVFFTIPDGKAVNKYGAKK 707
           KDMKVGD+IQFER GYYRLD +    KP++FFTIPDGKAVNKYGAKK
Sbjct: 661 KDMKVGDIIQFERKGYYRLDALPKDGKPYIFFTIPDGKAVNKYGAKK 707

>KLTH0G00682g Chr7 (45680..47794) [2115 bp, 704 aa] {ON} highly
           similar to uniprot|P46655 Saccharomyces cerevisiae
           YGL245W GUS1 Glutamyl-tRNA synthetase (GluRS) forms a
           complex with methionyl-tRNA synthetase (Mes1p) and Arc1p
           complex formation increases the catalytic efficiency of
           both tRNA synthetases and ensures their correct
           localization to the cytoplasm
          Length = 704

 Score = 1104 bits (2855), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 534/705 (75%), Positives = 602/705 (85%), Gaps = 2/705 (0%)

Query: 3   STLIIAAKSPAVAYAELIAARAVNEAKQDAVAIQFTEGKEAAAASFDGESQNALERMVEK 62
           + LIIA+K+P VAY+ELIAAR VN AK DA+ I+F E K+++ A+F+    + L+R+V+ 
Sbjct: 2   AKLIIASKAPVVAYSELIAARLVNSAKTDAIEIEFVEDKKSSPATFEDSCDDVLKRIVQT 61

Query: 63  YPDVLGSVPEEAAWWIAYARTDLVVKDFKKLSGSLEKLDAHLNLRTFVLGGMQPTVADVA 122
           YP+V     E    W   A  +L VK+F+KLS SL KLDA LN RTF+LGG   + AD+A
Sbjct: 62  YPEVFKHGFENCDEWAKLASEELTVKNFQKLSVSLAKLDACLNFRTFILGGTTFSAADIA 121

Query: 123 VWGALRSNGPVGSIIKNKVYVNVSRWYTTLELIPAFGGAHEFLAKSLKELKAAGNVNKKK 182
            WG+LRSNG VGSIIKNKVYVNVSRWYT LE IP FG AHEFL K+L+ELK A   NKKK
Sbjct: 122 CWGSLRSNGMVGSIIKNKVYVNVSRWYTLLEQIPEFGSAHEFLVKTLQELKKASTSNKKK 181

Query: 183 ETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDT 242
           ETHKANFEIDL DAK+GEVVTRFPPEPSGYLHIGHAKAA+LNQYFAQ YKGKLIIRFDDT
Sbjct: 182 ETHKANFEIDLQDAKVGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDDT 241

Query: 243 NPSKERVEFQDSILEDLELLGIKGDRITHSSDYFQEMYDYCVQMIKEGKAYCDDTPTXXX 302
           NPSKE+ EFQDSILEDLELLGIKGDR+T+SSDYFQEMYD CV+MI+EG AYCDDTPT   
Sbjct: 242 NPSKEKEEFQDSILEDLELLGIKGDRVTYSSDYFQEMYDLCVKMIEEGNAYCDDTPTDKM 301

Query: 303 XXXXXXGIASARRERSVEENLKIFTEEMKNGTEEGLKNCVRAKRDYAALNKTLKDPVLYR 362
                 G+ASARR+RSVEENL+IFT+EMKNGTEEGLKNCVRAK DY ALNKTL+DPV+YR
Sbjct: 302 REERMDGLASARRDRSVEENLRIFTQEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYR 361

Query: 363 CNLTPHHRTGTAWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALKLRKV 422
           CNLTPHHRTG+ WKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQY+WML+AL LRKV
Sbjct: 362 CNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYQWMLDALHLRKV 421

Query: 423 HIWDFARVNFVRTLLSKRKLQWLVDKQVVSNWDDPRFPTVRGVRRRGMTIEGLRNFVLSQ 482
           HIWDFARVNFVRTLLSKRKLQW+VDK +VSNWDDPRFPTVRGVRRRGMT+EGLRNFVLSQ
Sbjct: 422 HIWDFARVNFVRTLLSKRKLQWMVDKDLVSNWDDPRFPTVRGVRRRGMTVEGLRNFVLSQ 481

Query: 483 GPSRNVINLEWNLIWAFNKKVIDPIAPRHTVVTNPVKLHLNGADVPQTPLTEMKPKHKKN 542
           GPSRNVINLEWNLIWAFNKKVIDP+APRHT +  PVK H+ GA  PQTP  ++K KHKKN
Sbjct: 482 GPSRNVINLEWNLIWAFNKKVIDPVAPRHTAIVKPVKFHVEGA--PQTPDVQIKLKHKKN 539

Query: 543 PAVGEKKVIYYKDVLIGAEDAAMLAAGEEVTLMDWGNAIIRGKNDDGSLTADLNLEGDFK 602
           PAVGEKKVIYY D+LI  +DA  +  GEE+TLMDWGNAI+  KN DGSLT  L+LEGDFK
Sbjct: 540 PAVGEKKVIYYADILIDQDDADAVTEGEELTLMDWGNAIVTKKNADGSLTGKLHLEGDFK 599

Query: 603 KTKFKLTWLADTSDTVPVDLVDFDHLISKDRLEEEDNFEDFLTPETEFHTTAIADLNVKD 662
           KTK KLTWLADT D V VDLVDFDHLI+KD+LEE ++F D+LTP+TEFH +A+ADLNVKD
Sbjct: 600 KTKLKLTWLADTDDKVDVDLVDFDHLITKDKLEEGEDFADYLTPQTEFHVSAVADLNVKD 659

Query: 663 MKVGDVIQFERTGYYRLDTVGSGDKPFVFFTIPDGKAVNKYGAKK 707
           MK GD+IQFER GYYRLD+  + DKP+VFF IPDGK+VNKYGAKK
Sbjct: 660 MKKGDIIQFERKGYYRLDSFATADKPYVFFAIPDGKSVNKYGAKK 704

>ZYRO0E09570g Chr5 complement(762205..764325) [2121 bp, 706 aa] {ON}
           highly similar to uniprot|P46655 Saccharomyces
           cerevisiae YGL245W GUS1 Glutamyl-tRNA synthetase (GluRS)
           forms a complex with methionyl-tRNA synthetase (Mes1p)
           and Arc1p complex formation increases the catalytic
           efficiency of both tRNA synthetases and ensures their
           correct localization to the cytoplasm
          Length = 706

 Score = 1093 bits (2827), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 512/704 (72%), Positives = 594/704 (84%), Gaps = 2/704 (0%)

Query: 5   LIIAAKSPAVAYAELIAARAVNEAKQDAVAIQFTEGKEAAAASFDGESQNALERMVEKYP 64
           L+I  K+P VAYAELIA+R VN A +DA+ ++F + K AA   F+G S +   +++  YP
Sbjct: 4   LVINGKAPVVAYAELIASRIVNAAHKDAITVEFVDEKNAAPVVFNGSSDDTFAKIISTYP 63

Query: 65  DVLG-SVPEEAAWWIAYARTDLVVKDFKKLSGSLEKLDAHLNLRTFVLGGMQPTVADVAV 123
           DV G    EE A WI  AR  LVVK+F++LS SLE+LDA LNLRTF+LGG++ + AD+  
Sbjct: 64  DVFGHESSEEVAHWIKVAREQLVVKNFQQLSQSLERLDAVLNLRTFILGGLKISAADIVC 123

Query: 124 WGALRSNGPVGSIIKNKVYVNVSRWYTTLELIPAFGGAHEFLAKSLKELKAAGNVNKKKE 183
           WGALRSNG VGSIIKNKVYVNVSRWYT LEL P+FGGAHE+L KS++ +K A    KKKE
Sbjct: 124 WGALRSNGMVGSIIKNKVYVNVSRWYTLLELNPSFGGAHEYLTKSMQGIKKAVTAGKKKE 183

Query: 184 THKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTN 243
            HKANFEIDLPDAK+GEVVTRFPPEPSGYLHIGHAKAA+LN+YFA AYKGKLIIRFDDTN
Sbjct: 184 GHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIRFDDTN 243

Query: 244 PSKERVEFQDSILEDLELLGIKGDRITHSSDYFQEMYDYCVQMIKEGKAYCDDTPTXXXX 303
           PSKER+EFQD+ILEDLEL+GIKGD+IT+SSDYFQEMYD CVQ+IKEGKAYCDDT      
Sbjct: 244 PSKERMEFQDAILEDLELMGIKGDKITYSSDYFQEMYDLCVQLIKEGKAYCDDTDVEKMR 303

Query: 304 XXXXXGIASARRERSVEENLKIFTEEMKNGTEEGLKNCVRAKRDYAALNKTLKDPVLYRC 363
                GI SA+R+ SVEENL+IFTEEMKNGTE G KNCVRAK DY A NKTL+DPV+YRC
Sbjct: 304 EERMEGIPSAKRDLSVEENLRIFTEEMKNGTEFGQKNCVRAKIDYKAANKTLRDPVIYRC 363

Query: 364 NLTPHHRTGTAWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALKLRKVH 423
           NLTPHHRT   WK+YPTYDFCVPIVD++EGVTHALRTIEYRDRNAQY+WML AL+LRKVH
Sbjct: 364 NLTPHHRTKGQWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWMLKALRLRKVH 423

Query: 424 IWDFARVNFVRTLLSKRKLQWLVDKQVVSNWDDPRFPTVRGVRRRGMTIEGLRNFVLSQG 483
           IWDFARVNF+RTLLSKRKLQW+VD  +VSNWDDPRFPTVRGVRRRGMT+EGLRNFV+SQG
Sbjct: 424 IWDFARVNFMRTLLSKRKLQWMVDHGLVSNWDDPRFPTVRGVRRRGMTVEGLRNFVISQG 483

Query: 484 PSRNVINLEWNLIWAFNKKVIDPIAPRHTVVTNPVKLHLNGADVPQTPLTEMKPKHKKNP 543
           PS+NVINLEWNLIWA NKK+IDP+APRHT V +PV++ L G   P+TP  E+KPKHKKNP
Sbjct: 484 PSKNVINLEWNLIWAVNKKIIDPVAPRHTAVVDPVEITLEGEGAPETPKVELKPKHKKNP 543

Query: 544 AVGEKKVIYYKDVLIGAEDAAMLAAGEEVTLMDWGNAIIRGKNDDGSLTADLNLEGDFKK 603
           AVGEKKVIY   ++I  EDA++L  GEE+TLMDWGN II  KN DGSL A  NL GDFKK
Sbjct: 544 AVGEKKVIYSNKIIIDKEDASVLEVGEELTLMDWGNIIITSKNADGSLVAKTNLGGDFKK 603

Query: 604 TKFKLTWLADTSDTVPVDLVDFDHLISKDRLEEEDNFEDFLTPETEFHTTAIADLNVKDM 663
           TK K+TWLA+T D VPV++VDFDHLI+KD+LEE++NF DF+TP+TEFHT A+ D+NVKDM
Sbjct: 604 TKHKVTWLANT-DYVPVEMVDFDHLITKDKLEEDENFTDFITPQTEFHTKAVGDVNVKDM 662

Query: 664 KVGDVIQFERTGYYRLDTVGSGDKPFVFFTIPDGKAVNKYGAKK 707
           KVGD+IQFER GY RLD+   GDKP++FFTIPDGK+VN+YGAKK
Sbjct: 663 KVGDIIQFERKGYCRLDSKAEGDKPYIFFTIPDGKSVNRYGAKK 706

>TBLA0E00190 Chr5 (24885..27008) [2124 bp, 707 aa] {ON} Anc_3.569
           YGL245W
          Length = 707

 Score = 1081 bits (2795), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 535/708 (75%), Positives = 600/708 (84%), Gaps = 2/708 (0%)

Query: 1   MSSTLIIAAKSPAVAYAELIAARAVNEAKQDAVAIQFTEGKEAAAASFDGESQNALERMV 60
           MS+ LI++ K+ AVAY ELIAAR VN +  +AV I F E K+AA A+ DG S + L ++V
Sbjct: 1   MSTKLILSGKAQAVAYGELIAARIVNNSSANAVDISFVEDKKAAPATLDGSSDDVLAKIV 60

Query: 61  EKYPDVLGSVP-EEAAWWIAYARTDLVVKDFKKLSGSLEKLDAHLNLRTFVLGGMQPTVA 119
              P    S   E+ A W   A+  LVVK+F++L+ +LE LDA LNLR+FVLGG+  + A
Sbjct: 61  ALSPSSFASASKEDVAHWTKLAQEKLVVKNFQQLAQTLEILDAQLNLRSFVLGGLNFSAA 120

Query: 120 DVAVWGALRSNGPVGSIIKNKVYVNVSRWYTTLELIPAFGGAHEFLAKSLKELKAAGNVN 179
           DVAVWGALRSNG VGSIIKNKVYVNVSRWY+ LEL PAFG +HEFL KSL+ELK A N  
Sbjct: 121 DVAVWGALRSNGMVGSIIKNKVYVNVSRWYSFLELEPAFGESHEFLTKSLQELKKAANAG 180

Query: 180 KKKETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 239
           KKKE+HKANFEIDL DAK+GEVVTRFPPEPSGYLHIGHAKAA+LNQYFAQAYKGKLIIRF
Sbjct: 181 KKKESHKANFEIDLQDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRF 240

Query: 240 DDTNPSKERVEFQDSILEDLELLGIKGDRITHSSDYFQEMYDYCVQMIKEGKAYCDDTPT 299
           DDTNPSKE+ EF++SI+EDL LLGIKGDR+THSSDYFQEMYDYC+QMIKEGKAYCDDTPT
Sbjct: 241 DDTNPSKEKEEFEESIIEDLALLGIKGDRVTHSSDYFQEMYDYCIQMIKEGKAYCDDTPT 300

Query: 300 XXXXXXXXXGIASARRERSVEENLKIFTEEMKNGTEEGLKNCVRAKRDYAALNKTLKDPV 359
                    G  SARR RSVEENLKIFTE+M NGTEEGLKNCVRAK DY ALNKTL+DPV
Sbjct: 301 EKMREERMEGEPSARRNRSVEENLKIFTEDMTNGTEEGLKNCVRAKIDYKALNKTLRDPV 360

Query: 360 LYRCNLTPHHRTGTAWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALKL 419
           +YRCNLTPHH TG  WK+YPTYDFCVPIVD+LEGVTHALRTIEYRDRNAQYEWML+ALKL
Sbjct: 361 IYRCNLTPHHITGDKWKVYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYEWMLDALKL 420

Query: 420 RKVHIWDFARVNFVRTLLSKRKLQWLVDKQVVSNWDDPRFPTVRGVRRRGMTIEGLRNFV 479
           R VHIWDFARVNFVRTLLSKRKLQW+VDK +VSNWDDPRFPTVRGVRRRGM+IEGLRNFV
Sbjct: 421 RHVHIWDFARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTVRGVRRRGMSIEGLRNFV 480

Query: 480 LSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTVVTNPVKLHLNGADVPQTPLTEMKPKH 539
           LSQGPSRNVINLEWNLIWAFNKKVIDP APRHT V NP K+HL G++VPQT   EMKPKH
Sbjct: 481 LSQGPSRNVINLEWNLIWAFNKKVIDPTAPRHTAVVNPFKVHLEGSEVPQTDKIEMKPKH 540

Query: 540 KKNPAVGEKKVIYYKDVLIGAEDAAMLAAGEEVTLMDWGNAIIRGKNDDGSLTADLNLEG 599
           KKNP VGEKKV++ K+++I  EDA +L  GEE TLMDWGNAII  K D  S+TA L+LEG
Sbjct: 541 KKNPDVGEKKVVFSKNIIIDKEDADVLEEGEEFTLMDWGNAIIT-KKDANSITAKLHLEG 599

Query: 600 DFKKTKFKLTWLADTSDTVPVDLVDFDHLISKDRLEEEDNFEDFLTPETEFHTTAIADLN 659
           DFKKTK K+TWLADT D V VDLVDFDHL++KDR+EE ++FEDFLT +TEFHT+AIADLN
Sbjct: 600 DFKKTKHKITWLADTKDVVSVDLVDFDHLLNKDRIEEGESFEDFLTEKTEFHTSAIADLN 659

Query: 660 VKDMKVGDVIQFERTGYYRLDTVGSGDKPFVFFTIPDGKAVNKYGAKK 707
           VKDMK+GD IQFER GYYRLD++     P+VFFTIPDGKAVNKYGAKK
Sbjct: 660 VKDMKIGDFIQFERKGYYRLDSLPKNGNPYVFFTIPDGKAVNKYGAKK 707

>ZYRO0C07018g Chr3 (528834..531245) [2412 bp, 803 aa] {ON} highly
           similar to uniprot|P13188 Saccharomyces cerevisiae
           YOR168W GLN4 Glutamine tRNA synthetase monomeric class I
           tRNA synthetase that catalyzes the specific
           glutaminylation of tRNA(Glu) N-terminal domain proposed
           to be involved in enzyme-tRNA interactions
          Length = 803

 Score =  240 bits (613), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 172/541 (31%), Positives = 272/541 (50%), Gaps = 60/541 (11%)

Query: 196 AKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKERVEFQDSI 255
           A  G V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI
Sbjct: 246 ATHGLVHTRFPPEPNGYLHIGHSKAIMVNFGYAKFHGGHCYLRFDDTNPEAEAPEYFESI 305

Query: 256 LEDLELLGIKGDRITHSSDYFQEMYDYCVQMIKEGKAY---CDDTPTXXXXXXXXXGI-- 310
           +  +  LG    +IT+SSDYF ++Y+   ++I +GK Y   C              G   
Sbjct: 306 IRMVNWLGFHPWKITYSSDYFDQLYELAERLISKGKGYVCNCAAEEIKASRGIKPDGTPG 365

Query: 311 ----ASARRERSVEENLKIFTEEMKNGTEEGLKNCVRAKRDYAALNKTLKDPVLYRCNLT 366
               A   R RSVEENL  F  +MK+G  +  +  +R K+D ++ +  + D + YR    
Sbjct: 366 GERHACKHRSRSVEENLTEF-RKMKDGHYQPGEATLRMKQDLSSPSPQMWDLIAYRVLNA 424

Query: 367 PHHRTGTAWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALKLRKVHIWD 426
           PH RTG  W+IYPTYDF   +VD+ E +TH+L T E+      YEW+ + + + +    +
Sbjct: 425 PHPRTGNKWRIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVDVFRPTQRE 484

Query: 427 FARVNFVRTLLSKRKLQWLVDKQVVSNWDDPRFPTVRGVRRRGMTIEGLRNFVLSQGPSR 486
           + R+N   T+LSKRK+  LVD++ V  WDDPR  T+  +RRRG+    + +F+ + G + 
Sbjct: 485 YGRLNITGTVLSKRKIAKLVDEKYVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTT 544

Query: 487 NVINLEWNLIWAFNKKVIDPIAPRHTVVTNPVKLHLNGADVPQTPLTEMK-PKHKKNPAV 545
           +V N++     +  +K ++   PR   + +PV++ ++  +VP +    +  P     P  
Sbjct: 545 SVTNIQLVRFESAIRKYLEDTTPRLMFILDPVEVVVD--NVPDSFEDVVSIPFRPGTPEF 602

Query: 546 GEKKVIYYKDVLIGAEDAAMLAAGEE---------VTLMDWGNAIIRG---KNDDGSLT- 592
           GE++V + K V I   D +  A+ +E         V L+   +A+I     K+ DG +T 
Sbjct: 603 GEREVPFTKRVFIDRSDFSENASDKEFFRLTPEQPVGLIKVPHALIYKSLEKDSDGKITK 662

Query: 593 --ADLNLEGDFKKTKFKLTWLADTSD-TVPV--------------------------DLV 623
                + EG  KK K  + W+  +     PV                          D+ 
Sbjct: 663 IHVHYDTEGKIKKPKTYIQWVPLSEKFNSPVRIAETRVHNALFKSENPSAHPEGYLKDIN 722

Query: 624 DFDHLISKDRLEEEDNFEDFLTPET-EFHTTAIADLNVK-DMKVGDVIQFE--RTGYYRL 679
               ++ K+ + E  NF D L     E  +   ++  VK D K  +V +F+  RTGY+ L
Sbjct: 723 PDSEIVYKNSIVEH-NFHDILAKSPWEVDSVKNSEFYVKEDPKSKEVCRFQAMRTGYFTL 781

Query: 680 D 680
           D
Sbjct: 782 D 782

>YOR168W Chr15 (649303..651732) [2430 bp, 809 aa] {ON}
           GLN4Glutamine tRNA synthetase, monomeric class I tRNA
           synthetase that catalyzes the specific glutaminylation
           of tRNA(Glu); N-terminal domain proposed to be involved
           in enzyme-tRNA interactions
          Length = 809

 Score =  233 bits (593), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 132/373 (35%), Positives = 206/373 (55%), Gaps = 11/373 (2%)

Query: 199 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKERVEFQDSILED 258
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP KE  E+ +SI   
Sbjct: 250 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHNGTCYLRFDDTNPEKEAPEYFESIKRM 309

Query: 259 LELLGIKGDRITHSSDYFQEMYDYCVQMIKEGKAY---CDDTPTXXXXXXXXXGI----- 310
           +  LG K  +IT+SSDYF E+Y     +IK GKAY   C              G      
Sbjct: 310 VSWLGFKPWKITYSSDYFDELYRLAEVLIKNGKAYVCHCTAEEIKRGRGIKEDGTPGGER 369

Query: 311 -ASARRERSVEENLKIFTEEMKNGTEEGLKNCVRAKRDYAALNKTLKDPVLYRCNLTPHH 369
            A   R++S+E+NL+ F  +M++G  +  +  +R K+D  + +  + D + YR    PH 
Sbjct: 370 YACKHRDQSIEQNLQEF-RDMRDGKYKPGEAILRMKQDLNSPSPQMWDLIAYRVLNAPHP 428

Query: 370 RTGTAWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALKLRKVHIWDFAR 429
           RTGT W+IYPTYDF   +VD++E +TH+L T E+      YEW+ + + + +    ++ R
Sbjct: 429 RTGTKWRIYPTYDFTHCLVDSMENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 488

Query: 430 VNFVRTLLSKRKLQWLVDKQVVSNWDDPRFPTVRGVRRRGMTIEGLRNFVLSQGPSRNVI 489
           +N   T+LSKRK+  LVD++ V  WDDPR  T+  +RRRG+    + +F+ + G + +  
Sbjct: 489 LNITGTVLSKRKIAQLVDEKFVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 548

Query: 490 NLEWNLIWAFNKKVIDPIAPRHTVVTNPVKLHLNGADVPQTPLTEMKPKHKKNPAVGEKK 549
           N++     +  +K ++   PR   V +PV++ ++        L  + P     P  GE+ 
Sbjct: 549 NIQVVRFESAVRKYLEDTTPRLMFVLDPVEVVVDNLSDDYEELATI-PYRPGTPEFGERT 607

Query: 550 VIYYKDVLIGAED 562
           V +     I   D
Sbjct: 608 VPFTNKFYIERSD 620

>TDEL0G04190 Chr7 (761363..763792) [2430 bp, 809 aa] {ON} Anc_6.51
           YOR168W
          Length = 809

 Score =  231 bits (590), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 133/373 (35%), Positives = 207/373 (55%), Gaps = 11/373 (2%)

Query: 199 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKERVEFQDSILED 258
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+   G+  +RFDDTNP  E  E+ +SI   
Sbjct: 252 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYNGGETYLRFDDTNPEAEAPEYFESIKRM 311

Query: 259 LELLGIKGDRITHSSDYFQEMYDYCVQMIKEGKAY---CDDTPTXXXXXXXXXG------ 309
           +  LG K  +IT+SSDYF ++Y+    +IK GK Y   C              G      
Sbjct: 312 VSWLGFKPFKITYSSDYFDKLYELAEVLIKSGKGYVCHCTSEEVKAGRGIKEDGTPGGER 371

Query: 310 IASARRERSVEENLKIFTEEMKNGTEEGLKNCVRAKRDYAALNKTLKDPVLYRCNLTPHH 369
            A   R+RS+EE L  F  +M+NG  +  +  +R K+D ++ +  + D V YR    PH 
Sbjct: 372 FACKDRDRSIEETLDEF-RKMRNGFYKPGEATLRMKQDLSSPSPQMWDLVAYRVLNAPHP 430

Query: 370 RTGTAWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALKLRKVHIWDFAR 429
           RTG+ WKIYPTYDF   +VD+ E +TH+L T E+      YEW+ + + + +    ++ R
Sbjct: 431 RTGSKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPTQREYGR 490

Query: 430 VNFVRTLLSKRKLQWLVDKQVVSNWDDPRFPTVRGVRRRGMTIEGLRNFVLSQGPSRNVI 489
           +N   T+LSKRK+  LV+++ V  WDDPR  T+  +RRRG+    + +F+ + G + +  
Sbjct: 491 LNITGTVLSKRKIAKLVEEKYVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 550

Query: 490 NLEWNLIWAFNKKVIDPIAPRHTVVTNPVKLHLNGADVPQTPLTEMKPKHKKNPAVGEKK 549
           N++     +  +K ++   PR   V +PV++ L+        L ++ P    +P  GE++
Sbjct: 551 NIQVVRFESAIRKYLEDSTPRLMFVLDPVEVVLDNLPEDYEELVKI-PFRPGSPEFGERE 609

Query: 550 VIYYKDVLIGAED 562
           V + K   I   D
Sbjct: 610 VPFTKRFFIERSD 622

>KNAG0M01100 Chr13 (194806..197205) [2400 bp, 799 aa] {ON} Anc_6.51
           YOR168W
          Length = 799

 Score =  229 bits (585), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 122/334 (36%), Positives = 193/334 (57%), Gaps = 10/334 (2%)

Query: 196 AKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKERVEFQDSI 255
           A  G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI
Sbjct: 246 ATAGKVHTRFPPEPNGYLHIGHSKAIMVNFGYAKYHDGVCYLRFDDTNPEAEAPEYFESI 305

Query: 256 LEDLELLGIKGDRITHSSDYFQEMYDYCVQMIKEGKAY---CDDTPTXXXXXXXXXG--- 309
              +  LG +  +IT+SSDYF ++Y+    +IK GK Y   C              G   
Sbjct: 306 KRMVSWLGFEPWKITYSSDYFDKLYELAKVLIKNGKGYICHCTAEEIRRGRGIKEDGQPG 365

Query: 310 ---IASARRERSVEENLKIFTEEMKNGTEEGLKNCVRAKRDYAALNKTLKDPVLYRCNLT 366
                   RE S+E+NL+ F E MK G  +  +  +R K+D+++ +  + D + YR    
Sbjct: 366 GERFGCKHRENSIEKNLEEF-ENMKEGKYQPGEATLRMKQDFSSPSPQMWDLIAYRVLNA 424

Query: 367 PHHRTGTAWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALKLRKVHIWD 426
           PH RTG+ WKIYPTYDF   +VD+ E +TH+L T E+      YEW+ + + + +    +
Sbjct: 425 PHPRTGSKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQRE 484

Query: 427 FARVNFVRTLLSKRKLQWLVDKQVVSNWDDPRFPTVRGVRRRGMTIEGLRNFVLSQGPSR 486
           + R+N   T+LSKRK+  LV++++V  WDDPR  T+  +RRRG+    + +F+ + G + 
Sbjct: 485 YGRLNITGTILSKRKIAKLVEEKIVRGWDDPRLYTLEAIRRRGVPPGAILSFINTLGVTT 544

Query: 487 NVINLEWNLIWAFNKKVIDPIAPRHTVVTNPVKL 520
           +V N++     +  +K ++   PR   V +P+++
Sbjct: 545 SVTNIQAVRFESAIRKYLEETTPRLMFVLDPIEV 578

>Smik_15.348 Chr15 (605412..607844) [2433 bp, 810 aa] {ON} YOR168W
           (REAL)
          Length = 810

 Score =  229 bits (584), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 131/373 (35%), Positives = 204/373 (54%), Gaps = 11/373 (2%)

Query: 199 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKERVEFQDSILED 258
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP KE  E+ +SI   
Sbjct: 251 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHNGTCYLRFDDTNPEKEAPEYFESIKRM 310

Query: 259 LELLGIKGDRITHSSDYFQEMYDYCVQMIKEGKAY---CDDTPTXXXXXXXXXG------ 309
           +  LG    +IT+SSDYF E+Y     +IK GK Y   C              G      
Sbjct: 311 VSWLGFMPWKITYSSDYFDELYGLAEVLIKNGKGYVCHCTAEEIKRGRGIKEDGTPGGQR 370

Query: 310 IASARRERSVEENLKIFTEEMKNGTEEGLKNCVRAKRDYAALNKTLKDPVLYRCNLTPHH 369
            A   R++S+E NL+ F  +M++G  +  +  +R K+D ++ +  + D + YR    PH 
Sbjct: 371 FACKHRDQSIELNLQEF-RDMRDGKYKPGEAILRMKQDLSSPSPQMWDLIAYRVLNAPHP 429

Query: 370 RTGTAWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALKLRKVHIWDFAR 429
           RTGT WKIYPTYDF   +VD++E +TH+L T E+      YEW+ + + + +    ++ R
Sbjct: 430 RTGTKWKIYPTYDFTHCLVDSMENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 489

Query: 430 VNFVRTLLSKRKLQWLVDKQVVSNWDDPRFPTVRGVRRRGMTIEGLRNFVLSQGPSRNVI 489
           +N   T+LSKRK+  LVD++ V  WDDPR  T+  +RRRG+    + +F+ + G + +  
Sbjct: 490 LNITGTVLSKRKIAQLVDEKFVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 549

Query: 490 NLEWNLIWAFNKKVIDPIAPRHTVVTNPVKLHLNGADVPQTPLTEMKPKHKKNPAVGEKK 549
           N++     +  +K ++   PR   V +PV++ ++        L  + P     P  GE+ 
Sbjct: 550 NIQVVRFESAVRKYLEDTTPRLMFVLDPVEVIVDNLSDDYEELATI-PFRPGTPEFGERT 608

Query: 550 VIYYKDVLIGAED 562
           V +     I   D
Sbjct: 609 VPFTNRFYIERSD 621

>Skud_15.332 Chr15 (598097..600526) [2430 bp, 809 aa] {ON} YOR168W
           (REAL)
          Length = 809

 Score =  229 bits (583), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 123/331 (37%), Positives = 191/331 (57%), Gaps = 10/331 (3%)

Query: 199 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKERVEFQDSILED 258
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP KE  E+ +SI   
Sbjct: 250 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYARYHNGTCYLRFDDTNPEKEAPEYFESIKRM 309

Query: 259 LELLGIKGDRITHSSDYFQEMYDYCVQMIKEGKAY---CDDTPTXXXXXXXXXG------ 309
           +  LG K  +IT+SSDYF E+Y     +I  GK Y   C              G      
Sbjct: 310 VSWLGFKPWKITYSSDYFDELYGLAEVLINNGKGYVCHCTGEEIKRSRGIKEDGTPGGER 369

Query: 310 IASARRERSVEENLKIFTEEMKNGTEEGLKNCVRAKRDYAALNKTLKDPVLYRCNLTPHH 369
            A   R++S+E NLK F  +M++G  +  +  +R K+D ++ +  + D + YR    PH 
Sbjct: 370 FACKHRDQSIELNLKEF-RDMRDGKYKPGEAILRMKQDLSSPSPQMWDLIAYRVLNAPHP 428

Query: 370 RTGTAWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALKLRKVHIWDFAR 429
           RTGT WKIYPTYDF   +VD++E +TH+L T E+      YEW+ + + + +    ++ R
Sbjct: 429 RTGTKWKIYPTYDFTHCLVDSMENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 488

Query: 430 VNFVRTLLSKRKLQWLVDKQVVSNWDDPRFPTVRGVRRRGMTIEGLRNFVLSQGPSRNVI 489
           +N   T+LSKRK+  LVD++ V  WDDPR  T+  +RRRG+    + +F+ + G + +  
Sbjct: 489 LNITGTVLSKRKIAQLVDEKFVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 548

Query: 490 NLEWNLIWAFNKKVIDPIAPRHTVVTNPVKL 520
           N++     +  +K ++   PR   V +P+++
Sbjct: 549 NIQVIRFESAVRKYLEDTTPRLMFVLDPIEV 579

>SAKL0E02134g Chr5 complement(162366..164771) [2406 bp, 801 aa] {ON}
           highly similar to uniprot|P13188 Saccharomyces
           cerevisiae YOR168W GLN4 Glutamine tRNA synthetase
           monomeric class I tRNA synthetase that catalyzes the
           specific glutaminylation of tRNA(Glu) N-terminal domain
           proposed to be involved in enzyme-tRNA interactions
          Length = 801

 Score =  225 bits (573), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 129/382 (33%), Positives = 209/382 (54%), Gaps = 11/382 (2%)

Query: 199 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKERVEFQDSILED 258
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI   
Sbjct: 246 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHNGVCYLRFDDTNPEAEAPEYFESIKRM 305

Query: 259 LELLGIKGDRITHSSDYFQEMYDYCVQMIKEGKAY---CDDTPTXXXXXXXXXG------ 309
           +  LG +  +IT+SSDYF ++YD    +IK GKAY   C              G      
Sbjct: 306 VSWLGFEPWKITYSSDYFDKLYDLAEVLIKNGKAYVCHCTAEEIKRGRGIKEDGTPGGER 365

Query: 310 IASARRERSVEENLKIFTEEMKNGTEEGLKNCVRAKRDYAALNKTLKDPVLYRCNLTPHH 369
           +A   R+R +EENL+ F  +M++G  +  +  +R K+D ++ +  + D + YR    PH 
Sbjct: 366 VACVHRDRPIEENLEEF-RKMRDGVYKPGEAILRMKQDLSSPSPQMWDLIAYRVLNAPHP 424

Query: 370 RTGTAWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALKLRKVHIWDFAR 429
           RTG  WKIYPTYDF   +VD+ E +TH+L T E+      YEW+ + + + +    ++ R
Sbjct: 425 RTGDKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 484

Query: 430 VNFVRTLLSKRKLQWLVDKQVVSNWDDPRFPTVRGVRRRGMTIEGLRNFVLSQGPSRNVI 489
           +N   T+LSKRK+  LV++ +V  W+DPR  T+  +RRRG+    + +F+ + G + +  
Sbjct: 485 LNITGTVLSKRKIAKLVNEGIVRGWNDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 544

Query: 490 NLEWNLIWAFNKKVIDPIAPRHTVVTNPVKLHLNGADVPQTPLTEMKPKHKKNPAVGEKK 549
           N++     +  +K ++    R   V +PV++ ++        +  + P     P  G++ 
Sbjct: 545 NIQVVRFESAIRKYLEDTTARLMFVLDPVEIVVDNLPEDYEEMVTI-PYRPGTPEFGDRT 603

Query: 550 VIYYKDVLIGAEDAAMLAAGEE 571
           V + K   I   D +  A  +E
Sbjct: 604 VPFTKKFFIERSDFSEAADDKE 625

>TBLA0G00450 Chr7 complement(90053..92479) [2427 bp, 808 aa] {ON}
           Anc_6.51 YOR168W
          Length = 808

 Score =  225 bits (573), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 135/407 (33%), Positives = 216/407 (53%), Gaps = 13/407 (3%)

Query: 176 GNVNKKKETHKANFEIDLPDAKI--GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKG 233
           G+++K  E  +A  E+     KI  G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G
Sbjct: 226 GDLHKVGENPQAFPELMKEHLKITGGKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHDG 285

Query: 234 KLIIRFDDTNPSKERVEFQDSILEDLELLGIKGDRITHSSDYFQEMYDYCVQMIKEGKAY 293
              +RFDDTNP  E  E+ +SI   +  LG K  +IT+SSDYF ++Y+    +I   K Y
Sbjct: 286 VCYLRFDDTNPEAEAPEYFESIKRMVSWLGFKPWKITYSSDYFDKLYELAEVLINNDKGY 345

Query: 294 ---CDDTPTXXXXXXXXXG------IASARRERSVEENLKIFTEEMKNGTEEGLKNCVRA 344
              C              G       A   R R +EENLK F   M++G  +  +  +R 
Sbjct: 346 ICHCTAEEIKRGRGIKEDGTPGGDRFACVHRNRPIEENLKEF-RSMRDGKYQPGEAILRM 404

Query: 345 KRDYAALNKTLKDPVLYRCNLTPHHRTGTAWKIYPTYDFCVPIVDALEGVTHALRTIEYR 404
           K+D  + +  + D + YR    PH RTGT WKIYPTYDF   +VD+ E +TH+L T E+ 
Sbjct: 405 KQDLTSPSPQMWDLIAYRVLNAPHPRTGTKWKIYPTYDFTHCLVDSFENITHSLCTTEFY 464

Query: 405 DRNAQYEWMLNALKLRKVHIWDFARVNFVRTLLSKRKLQWLVDKQVVSNWDDPRFPTVRG 464
                YEW+ + + + +    ++ R+N   T+LSKRK+  LV+++ V  WDDPR  T+  
Sbjct: 465 LSRESYEWLCDQVHVFRPAQREYGRLNITGTVLSKRKIAKLVEEKYVRGWDDPRLFTLEA 524

Query: 465 VRRRGMTIEGLRNFVLSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTVVTNPVKLHLNG 524
           +RRRG+    + +F+ + G + +  N++     +  +K ++   PR   + +P+++ ++ 
Sbjct: 525 IRRRGVPPGSILSFINTLGVTTSTTNIQVTRFESAIRKYLEDSTPRLMFILDPIEVVVDN 584

Query: 525 ADVPQTPLTEMKPKHKKNPAVGEKKVIYYKDVLIGAEDAAMLAAGEE 571
                  L  + P     P  GE+ V +     I   D +  ++ +E
Sbjct: 585 LADDYEELVSI-PYRPATPEFGERNVPFTNKFYIERSDFSEDSSNKE 630

>NDAI0K02860 Chr11 (646106..648550) [2445 bp, 814 aa] {ON} Anc_6.51
           YOR168W
          Length = 814

 Score =  224 bits (570), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 134/407 (32%), Positives = 215/407 (52%), Gaps = 13/407 (3%)

Query: 176 GNVNKKKETHKANFEIDLPDAKI--GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKG 233
           G+++K  E  +A  E+     K+  G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G
Sbjct: 230 GDLHKVGENPQAYPELMEEHLKVTGGKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHDG 289

Query: 234 KLIIRFDDTNPSKERVEFQDSILEDLELLGIKGDRITHSSDYFQEMYDYCVQMIKEGKAY 293
              +RFDDTNP  E  E+ +SI   +  LG    +IT+SSDYF ++YD    +I  GK Y
Sbjct: 290 VCYLRFDDTNPEAEAPEYFESIKRMVHWLGFTPWKITYSSDYFDKLYDLAELLINNGKGY 349

Query: 294 ---CDDTPTXXXXXXXXXGI------ASARRERSVEENLKIFTEEMKNGTEEGLKNCVRA 344
              C              G       A   R+R +EENL+ F   M++G  +  +  +R 
Sbjct: 350 ICHCTAEEIKRGRGIKEDGTPGGERHACKHRDRPIEENLQEF-RNMRDGKYQPGEAILRM 408

Query: 345 KRDYAALNKTLKDPVLYRCNLTPHHRTGTAWKIYPTYDFCVPIVDALEGVTHALRTIEYR 404
           K+D  + +  + D + YR     H RTGT WKIYPTYDF   +VD+ E +TH+L T E+ 
Sbjct: 409 KQDLTSPSPQMWDLIAYRVLNAAHPRTGTKWKIYPTYDFTHCLVDSFENITHSLCTTEFY 468

Query: 405 DRNAQYEWMLNALKLRKVHIWDFARVNFVRTLLSKRKLQWLVDKQVVSNWDDPRFPTVRG 464
                YEW+ + + + +    ++ R+N   T+LSKRK+  LVD++ V  WDDPR  T+  
Sbjct: 469 LSRESYEWLCDQVHVFRPAQREYGRLNITGTVLSKRKIAKLVDEKFVRGWDDPRLFTLEA 528

Query: 465 VRRRGMTIEGLRNFVLSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTVVTNPVKLHLNG 524
           +RRRG+    + +F+ + G + +  N++     +  +K ++   PR   + +P+++ ++ 
Sbjct: 529 IRRRGVPPGSILSFINTLGVTTSTTNIQVVRFESAIRKYLEDTTPRLMFILDPIEVIVDN 588

Query: 525 ADVPQTPLTEMKPKHKKNPAVGEKKVIYYKDVLIGAEDAAMLAAGEE 571
                  L  + P     P  GE+ V +     I   D + +   +E
Sbjct: 589 LSDDYEELVTI-PYRAGTPEFGERTVPFTNKFFIERSDFSEVTDDKE 634

>AGR259C Chr7 complement(1227063..1229459) [2397 bp, 798 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR168W
           (GLN4)
          Length = 798

 Score =  223 bits (569), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 135/398 (33%), Positives = 213/398 (53%), Gaps = 13/398 (3%)

Query: 176 GNVNKKKETHKANFEIDLPDAKI--GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKG 233
           G+++K  E  +A  E+ +   K   G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G
Sbjct: 220 GDLHKVGENPQAYPELMVEHLKATGGKVHTRFPPEPNGYLHIGHSKAIMVNFGYAKHHGG 279

Query: 234 KLIIRFDDTNPSKERVEFQDSILEDLELLGIKGDRITHSSDYFQEMYDYCVQMIKEGKAY 293
              +RFDDTNP  E  E+ +SI   +  LG    +IT+SSDYF ++Y+    +IK GK Y
Sbjct: 280 VCYLRFDDTNPEAEAPEYFESIERMVAWLGFSPWKITYSSDYFDQLYELAEVLIKNGKGY 339

Query: 294 ---CDDTPTXXXXXXXXXG------IASARRERSVEENLKIFTEEMKNGTEEGLKNCVRA 344
              C              G      +  A RER +EENL  F   M++G     +  +R 
Sbjct: 340 ICHCTAEEIRRGRGIKEDGTPGGERLPCAHRERPIEENLAEF-RNMRDGKYAPGEAILRM 398

Query: 345 KRDYAALNKTLKDPVLYRCNLTPHHRTGTAWKIYPTYDFCVPIVDALEGVTHALRTIEYR 404
           K+D ++ +  + D V YR    PH RTG+ W+IYPTYDF   +VD+LE +TH+L T E+ 
Sbjct: 399 KQDLSSPSPQMWDLVAYRVLNAPHPRTGSKWRIYPTYDFTHCLVDSLENITHSLCTAEFY 458

Query: 405 DRNAQYEWMLNALKLRKVHIWDFARVNFVRTLLSKRKLQWLVDKQVVSNWDDPRFPTVRG 464
                YEW+ + + + +    ++ R+N   T+LSKRK+  LV ++ V  WDDPR  T+  
Sbjct: 459 LSRESYEWLCDQVHVFRPAQREYGRLNITGTVLSKRKIAKLVHEKYVRGWDDPRLFTLEA 518

Query: 465 VRRRGMTIEGLRNFVLSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTVVTNPVKLHLNG 524
           +RRRG+    + +F+ + G + +  N++     +  +K ++    R   V +P+++ ++ 
Sbjct: 519 IRRRGVPPGAILSFINTLGVTTSTTNIQVVRFESAIRKYLEDTTARLMFVLDPIEVIVDN 578

Query: 525 ADVPQTPLTEMKPKHKKNPAVGEKKVIYYKDVLIGAED 562
                  L  + P     P  GE+ V + K   I   D
Sbjct: 579 LPEDYEELVSI-PYRPGTPEFGERTVPFSKRFYIERSD 615

>KAFR0G02610 Chr7 (538902..541286) [2385 bp, 794 aa] {ON} Anc_6.51
           YOR168W
          Length = 794

 Score =  223 bits (568), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 123/331 (37%), Positives = 185/331 (55%), Gaps = 10/331 (3%)

Query: 199 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKERVEFQDSILED 258
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + GK  +RFDDTNP  E  E+ +SI   
Sbjct: 247 GKVHTRFPPEPNGYLHIGHSKAIMVNFGYAKHFGGKCYLRFDDTNPEAEAPEYFESIKRM 306

Query: 259 LELLGIKGDRITHSSDYFQEMYDYCVQMIKEGKAY---CDDTPTXXXXXXXXXGI----- 310
           +  LG K  +IT+SSDYF ++YD    +IK  K Y   C              G      
Sbjct: 307 VSWLGFKPWKITYSSDYFDKLYDLAEFLIKSDKGYICHCTAEEIKRGRGIKEDGTPGGER 366

Query: 311 -ASARRERSVEENLKIFTEEMKNGTEEGLKNCVRAKRDYAALNKTLKDPVLYRCNLTPHH 369
            A A R R +EE+L  F  +MK+G  E  K  +R K+D  + N  + D + YR    PH 
Sbjct: 367 SACAHRSRPIEESLAEF-RKMKDGFYEPGKAILRMKQDLQSPNPQMWDLIAYRVLNAPHP 425

Query: 370 RTGTAWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALKLRKVHIWDFAR 429
           RTG  W+IYPTYDF   +VD+ E +TH+L T E+      YEW+ + + + +    ++ R
Sbjct: 426 RTGDKWRIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 485

Query: 430 VNFVRTLLSKRKLQWLVDKQVVSNWDDPRFPTVRGVRRRGMTIEGLRNFVLSQGPSRNVI 489
           +N   T+LSKRK+  LV+   V  WDDPR  T+  +RRRG+    + +F+ + G + +  
Sbjct: 486 LNITGTILSKRKIAKLVELHHVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSDT 545

Query: 490 NLEWNLIWAFNKKVIDPIAPRHTVVTNPVKL 520
           N++        +K ++   PR   + +P+++
Sbjct: 546 NIQVARFETAVRKYLEETTPRLMFILDPIEI 576

>Kwal_56.22559 s56 complement(179568..181970) [2403 bp, 800 aa] {ON}
           YOR168W (GLN4) - glutaminyl-tRNA synthetase [contig 185]
           FULL
          Length = 800

 Score =  223 bits (567), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 131/382 (34%), Positives = 204/382 (53%), Gaps = 11/382 (2%)

Query: 199 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKERVEFQDSILED 258
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+   G   +RFDDTNP  E  E+ +SI   
Sbjct: 245 GKVHTRFPPEPNGYLHIGHSKAIMVNFGYAKHNDGVCYLRFDDTNPEAEAPEYFESIKNM 304

Query: 259 LELLGIKGDRITHSSDYFQEMYDYCVQMIKEGKAY---CDDTPTXXXXXXXXXGI----- 310
           +  LG K  +IT+SSDYF ++Y+    +I   KAY   C              G      
Sbjct: 305 VAWLGFKPWKITYSSDYFDKLYELAEVLISNSKAYVCHCSGEEIKRGRGIKEDGTPGGER 364

Query: 311 -ASARRERSVEENLKIFTEEMKNGTEEGLKNCVRAKRDYAALNKTLKDPVLYRCNLTPHH 369
            A   R RSVEENL  F  +M++G  +  +  +R K+D  + +  + D + YR    PH 
Sbjct: 365 RACVHRSRSVEENLTEF-RKMRDGHYKPGEAILRMKQDLESPSPQMWDLIAYRVLNAPHP 423

Query: 370 RTGTAWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALKLRKVHIWDFAR 429
           RTG  WKIYPTYDF   +VD+ E +TH+L T E+      YEW+ + + + +    ++ R
Sbjct: 424 RTGDKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 483

Query: 430 VNFVRTLLSKRKLQWLVDKQVVSNWDDPRFPTVRGVRRRGMTIEGLRNFVLSQGPSRNVI 489
           +N   T+LSKRK+  LV++  V  WDDPR  T+  +RRRG+    + +F+ + G + +  
Sbjct: 484 LNITGTVLSKRKIAKLVNEHYVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 543

Query: 490 NLEWNLIWAFNKKVIDPIAPRHTVVTNPVKLHLNGADVPQTPLTEMKPKHKKNPAVGEKK 549
           N++     +  +K ++   PR  ++ +PV++ ++        L ++ P     P  GE+ 
Sbjct: 544 NIQVVRFESAIRKYLEDNTPRLMMILDPVEVVVDNLPDDYEELVKI-PYRPGTPEFGERS 602

Query: 550 VIYYKDVLIGAEDAAMLAAGEE 571
           V + K   I   D +     +E
Sbjct: 603 VPFTKKFYIERSDFSEATGNKE 624

>Suva_8.223 Chr8 (399431..401896) [2466 bp, 821 aa] {ON} YOR168W
           (REAL)
          Length = 821

 Score =  223 bits (568), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 130/381 (34%), Positives = 204/381 (53%), Gaps = 27/381 (7%)

Query: 199 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKERVEFQDSILED 258
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP KE  E+ +SI   
Sbjct: 250 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHDGTCYLRFDDTNPEKEAPEYFESIKRM 309

Query: 259 LELLGIKGDRITHSSDYFQEMYDYCVQMIKEGKAY---CDDTPTXXXXXXXXXG------ 309
           +  LG +  +IT+SSDYF E+Y     +I   K Y   C              G      
Sbjct: 310 VSWLGFEPWKITYSSDYFDELYRLAEVLINNDKGYICHCTAEEIKRGRGIKEDGTPGGER 369

Query: 310 IASARRERSVEENLKIFTEEMKNGTEEGLKNCVRAKRDYAALNKTLKDPVLYRCNLTPHH 369
            A   R++ +E NL+ F   M++G  +  +  +R K+D ++ +  + D + YR    PH 
Sbjct: 370 FACKHRDQPIELNLQEF-RNMRDGKYKPGEAILRMKQDLSSPSPQMWDLIAYRVLNAPHP 428

Query: 370 RTGTAWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALKLRKVHIWDFAR 429
           RTGT WKIYPTYDF   +VD++E +TH+L T E+      YEW+ + + + +    ++ R
Sbjct: 429 RTGTKWKIYPTYDFTHCLVDSMENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 488

Query: 430 VNFVRTLLSKRKLQWLVDKQVVSNWDDPRFPTVRGVRRRGMTIEGLRNFVLSQGPSRNVI 489
           +N   T+LSKRK+  LVD++ V  WDDPR  T+  +RRRG+    + +F+ + G + +  
Sbjct: 489 LNITGTVLSKRKIAQLVDEKFVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 548

Query: 490 NLEWNLIWAFNKKVIDPIAPRHTVVTNPVKLHLNG--------ADVPQTPLTEMKPKHKK 541
           N++     +  +K ++   PR   V +P+++ ++         A +P  P T        
Sbjct: 549 NIQVVRFESAIRKYLEDTTPRLMFVLDPIEVVVDNLADDFEELATIPYRPGT-------- 600

Query: 542 NPAVGEKKVIYYKDVLIGAED 562
            PA GE+ V +     I   D
Sbjct: 601 -PAFGERTVPFTNKFYIERSD 620

>Kpol_1037.38 s1037 complement(93063..95489) [2427 bp, 808 aa] {ON}
           complement(93063..95489) [2427 nt, 809 aa]
          Length = 808

 Score =  222 bits (565), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 135/406 (33%), Positives = 214/406 (52%), Gaps = 29/406 (7%)

Query: 176 GNVNKKKETHKANFEIDLPDAKI--GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKG 233
           G+++K  E  +A  E+     K+  G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G
Sbjct: 226 GDLHKVGENPQAYPELMAEHLKVTGGKVHTRFPPEPNGYLHIGHSKAIMVNFGYAKYWDG 285

Query: 234 KLIIRFDDTNPSKERVEFQDSILEDLELLGIKGDRITHSSDYFQEMYDYCVQMIKEGKAY 293
              +RFDDTNP  E  E+ +SI   +  LG K  +IT+SSDYF ++Y+    +I+  + Y
Sbjct: 286 VCYLRFDDTNPEAEAPEYFESIKRMVSWLGFKPWKITYSSDYFDKLYELAEILIQNDRGY 345

Query: 294 ---CDDTPTXXXXXXXXXGI------ASARRERSVEENLKIFTEEMKNGTEEGLKNCVRA 344
              C              G       A   R+R VEE+LK F   M++G  +  +  +R 
Sbjct: 346 ICHCTAEEIKRGRGIKEDGTPGGERSACKHRDRPVEESLKEF-RNMRDGVYQPGEATLRM 404

Query: 345 KRDYAALNKTLKDPVLYRCNLTPHHRTGTAWKIYPTYDFCVPIVDALEGVTHALRTIEYR 404
           K+D  + +  + D + YR    PH RTG+ WKIYPTYDF   +VD+ E +TH+L T E+ 
Sbjct: 405 KQDLTSPSPQMWDLIAYRVLNAPHPRTGSKWKIYPTYDFTHCLVDSFENITHSLCTTEFY 464

Query: 405 DRNAQYEWMLNALKLRKVHIWDFARVNFVRTLLSKRKLQWLVDKQVVSNWDDPRFPTVRG 464
                YEW+ + + + +    ++ R+N   T+LSKRK+  LV+   V  WDDPR  T+  
Sbjct: 465 LSRESYEWLCDQVHVFRPAQREYGRLNITGTVLSKRKIAKLVEGNYVRGWDDPRLFTLEA 524

Query: 465 VRRRGMTIEGLRNFVLSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTVVTNPVKLHLNG 524
           +RRRG+    + +F+ + G + +  N++     +  +K ++   PR   V +P+++ ++ 
Sbjct: 525 IRRRGVPPGAILSFINTLGVTTSTTNIQVVRFESAVRKFLEDTTPRLMFVLDPIEVVVDN 584

Query: 525 --------ADVPQTPLTEMKPKHKKNPAVGEKKVIYYKDVLIGAED 562
                   A +P  P T         P  GE+ V + K   I   D
Sbjct: 585 LPEDYEEIASIPYRPGT---------PEFGERNVPFTKKFYIERSD 621

>NCAS0F00240 Chr6 complement(37406..39841) [2436 bp, 811 aa] {ON}
           Anc_6.51 YOR168W
          Length = 811

 Score =  221 bits (562), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 134/407 (32%), Positives = 214/407 (52%), Gaps = 13/407 (3%)

Query: 176 GNVNKKKETHKANFEIDLPDAKI--GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKG 233
           G+++K  E  +A  E+ +   K   G+V TRFPPEP+GYLHIGH+KA ++N  +A+   G
Sbjct: 229 GDLHKVGENPQAYPELMVEHLKATGGKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYNDG 288

Query: 234 KLIIRFDDTNPSKERVEFQDSILEDLELLGIKGDRITHSSDYFQEMYDYCVQMIKEGKAY 293
             I+RFDDTNP  E  E+ +SI   +  LG    +IT+SSDYF ++YD    +I   + Y
Sbjct: 289 VCILRFDDTNPEAEAPEYFESIKRMVSWLGFVPWKITYSSDYFDKLYDLAEVLINNDRGY 348

Query: 294 ---CDDTPTXXXXXXXXXGI------ASARRERSVEENLKIFTEEMKNGTEEGLKNCVRA 344
              C              G       A   R  S+E NLK F   M++G  +  +  +R 
Sbjct: 349 ICHCTAEEIKRGRGIKEDGTPGGERSACVHRSNSIETNLKEF-RNMRDGVYKPGEATLRM 407

Query: 345 KRDYAALNKTLKDPVLYRCNLTPHHRTGTAWKIYPTYDFCVPIVDALEGVTHALRTIEYR 404
           K+D  + +  + D + YR    PH RTGT WKIYPTYDF   +VD+ E +TH+L T E+R
Sbjct: 408 KQDLTSPSPQMWDLIAYRVLNAPHPRTGTKWKIYPTYDFTHCLVDSFENITHSLCTTEFR 467

Query: 405 DRNAQYEWMLNALKLRKVHIWDFARVNFVRTLLSKRKLQWLVDKQVVSNWDDPRFPTVRG 464
                YEW+ + + + +    ++ R+N   T+LSKRK+  LVD+  V  WDDPR  T+  
Sbjct: 468 LSRESYEWLCDQVHVFRPAQREYGRLNITGTVLSKRKIAKLVDEHHVRGWDDPRLFTLEA 527

Query: 465 VRRRGMTIEGLRNFVLSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTVVTNPVKLHLNG 524
           +RRRG+    + +F+ + G + +  N++        +K ++   PR   + +P+++ ++ 
Sbjct: 528 IRRRGVPPGAILSFINTLGVTTSTTNIQVARFENSIRKYLEDSTPRLMFILDPIEIVVDN 587

Query: 525 ADVPQTPLTEMKPKHKKNPAVGEKKVIYYKDVLIGAEDAAMLAAGEE 571
                  +  + P     P  G++ V + K   I   D + ++  +E
Sbjct: 588 LPEDYEEILSI-PYRAGTPEFGDRTVPFTKRFYIERSDFSEVSDDKE 633

>CAGL0L04532g Chr12 (524088..526475) [2388 bp, 795 aa] {ON} highly
           similar to uniprot|P13188 Saccharomyces cerevisiae
           YOR168w GLN4
          Length = 795

 Score =  220 bits (561), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 119/331 (35%), Positives = 190/331 (57%), Gaps = 10/331 (3%)

Query: 199 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKERVEFQDSILED 258
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI   
Sbjct: 241 GKVHTRFPPEPNGYLHIGHSKAIMVNFGYAKYHDGVCYLRFDDTNPEAEAPEYFESIKRM 300

Query: 259 LELLGIKGDRITHSSDYFQEMYDYCVQMIKEGKAY---CDDTPTXXXXXXXXXGI----- 310
           +  LG K  ++T+SSDYF ++Y+    +IK GK Y   C              G      
Sbjct: 301 VSWLGFKPWKVTYSSDYFDKLYELAEVLIKNGKGYVCHCTAEEIKRGRGIKEDGTPGGER 360

Query: 311 -ASARRERSVEENLKIFTEEMKNGTEEGLKNCVRAKRDYAALNKTLKDPVLYRCNLTPHH 369
            A   R++SVE+NL+ F   M++G  +  +  +R K++  + +  + D + YR    PH 
Sbjct: 361 HACKHRDQSVEKNLEEF-RAMRDGKYKPGEAILRMKQNLESPSPQMWDLIAYRVLNAPHP 419

Query: 370 RTGTAWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALKLRKVHIWDFAR 429
           RTGT WKIYPTYDF   +VD+ E +TH+L T E+      YEW+ + + + +    ++ R
Sbjct: 420 RTGTKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 479

Query: 430 VNFVRTLLSKRKLQWLVDKQVVSNWDDPRFPTVRGVRRRGMTIEGLRNFVLSQGPSRNVI 489
           +N   T+LSKRK+  LVD+  V  WDDPR  T+  +RRRG+    + +F+ + G + +  
Sbjct: 480 LNITGTVLSKRKIAKLVDEHFVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 539

Query: 490 NLEWNLIWAFNKKVIDPIAPRHTVVTNPVKL 520
           N++     +  +K ++   PR  ++ +P+++
Sbjct: 540 NIQVVRFESAIRKYLEDSTPRLMMILDPIEV 570

>Ecym_3135 Chr3 (250906..253320) [2415 bp, 804 aa] {ON} similar to
           Ashbya gossypii AGR259C
          Length = 804

 Score =  220 bits (561), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 137/424 (32%), Positives = 222/424 (52%), Gaps = 13/424 (3%)

Query: 159 GGAHEFLAKSLKELKAAGNVNKKKETHKANFEI--DLPDAKIGEVVTRFPPEPSGYLHIG 216
           GG  E   +++      G+++K  E  +A  E+  +   A  G V TRFPPEP+GYLHIG
Sbjct: 209 GGTAEGTKRTMFTEGFLGDLHKVGENPQAYPELMEEHLKATGGRVQTRFPPEPNGYLHIG 268

Query: 217 HAKAALLNQYFAQAYKGKLIIRFDDTNPSKERVEFQDSILEDLELLGIKGDRITHSSDYF 276
           H+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI   +  LG K  +IT+SSDYF
Sbjct: 269 HSKAIMVNFGYAKYHNGICYLRFDDTNPEAEAPEYFESIERMVTWLGFKPWKITYSSDYF 328

Query: 277 QEMYDYCVQMIKEGKAY---CDDTPTXXXXXXXXXGI------ASARRERSVEENLKIFT 327
            ++YD    +I+  K Y   C              G       + + RERS+ ENL  F 
Sbjct: 329 DQLYDLAEVLIQNNKGYVCHCTGEEIKRGRGIKEDGTPGGERKSCSHRERSITENLAAF- 387

Query: 328 EEMKNGTEEGLKNCVRAKRDYAALNKTLKDPVLYRCNLTPHHRTGTAWKIYPTYDFCVPI 387
            +M++G  +  +  +R K+D  + +  + D + YR    PH RTG+ WKIYPTYDF   +
Sbjct: 388 RKMRDGFYKPGEAILRMKQDLNSPSPQMWDLIAYRVLDAPHPRTGSKWKIYPTYDFTHCL 447

Query: 388 VDALEGVTHALRTIEYRDRNAQYEWMLNALKLRKVHIWDFARVNFVRTLLSKRKLQWLVD 447
           VD+ E +TH+L T E+      YEW+ + + + +    ++ R+N   T+LSKRK+  LV+
Sbjct: 448 VDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGRLNITGTVLSKRKIARLVN 507

Query: 448 KQVVSNWDDPRFPTVRGVRRRGMTIEGLRNFVLSQGPSRNVINLEWNLIWAFNKKVIDPI 507
           ++ V  WDDPR  T+  +RRRG+    + +F+ + G +    N++     +  +K ++  
Sbjct: 508 EKYVRGWDDPRLFTLEAIRRRGIPPGAILSFINTLGVTTTTTNIQVVRFESAIRKYLEDT 567

Query: 508 APRHTVVTNPVKLHLNGADVPQTPLTEMKPKHKKNPAVGEKKVIYYKDVLIGAEDAAMLA 567
             R   + +P+++ +N        L  + P     P  G++ V + K   I   D +   
Sbjct: 568 TARLMFLLDPIEVVVNNLPEDYQELVTI-PYRPGTPEFGDRTVPFTKRFYIERTDFSENT 626

Query: 568 AGEE 571
           A +E
Sbjct: 627 ADKE 630

>KLTH0C10340g Chr3 (857898..860300) [2403 bp, 800 aa] {ON} highly
           similar to uniprot|P13188 Saccharomyces cerevisiae
           YOR168W GLN4 Glutamine tRNA synthetase monomeric class I
           tRNA synthetase that catalyzes the specific
           glutaminylation of tRNA(Glu) N-terminal domain proposed
           to be involved in enzyme-tRNA interactions
          Length = 800

 Score =  219 bits (559), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 135/398 (33%), Positives = 213/398 (53%), Gaps = 13/398 (3%)

Query: 176 GNVNKKKETHKANFEIDLPDAKI--GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKG 233
           G+++K  E  +A  E+     K+  G+V TRFPPEP+GYLHIGH+KA ++N  +A+   G
Sbjct: 220 GDLHKVGENPQAYPELMADHLKVTGGKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKHNDG 279

Query: 234 KLIIRFDDTNPSKERVEFQDSILEDLELLGIKGDRITHSSDYFQEMYDYCVQMIKEGKAY 293
              +RFDDTNP  E  E+ +SI   +  LG K  +IT+SSDYF ++Y+   ++I  GKAY
Sbjct: 280 VCYLRFDDTNPEAEAPEYFESIKSMVSWLGFKPWKITYSSDYFDKLYELAEKLITNGKAY 339

Query: 294 ---CDDTPTXXXXXXXXXGI------ASARRERSVEENLKIFTEEMKNGTEEGLKNCVRA 344
              C              G       A   R RSVEENL  F  +M++G  +  +  +R 
Sbjct: 340 VCHCTAEEIKRGRGIKEDGTPGGERHACVHRGRSVEENLAEF-RKMRDGAYKPGEATLRM 398

Query: 345 KRDYAALNKTLKDPVLYRCNLTPHHRTGTAWKIYPTYDFCVPIVDALEGVTHALRTIEYR 404
           K+D  + +  + D + YR     H RTG  WKIYPTYDF   +VD+ E +TH+L T E+ 
Sbjct: 399 KQDLESPSPQMWDLIAYRVLNASHPRTGDKWKIYPTYDFTHCLVDSFENITHSLCTTEFY 458

Query: 405 DRNAQYEWMLNALKLRKVHIWDFARVNFVRTLLSKRKLQWLVDKQVVSNWDDPRFPTVRG 464
                YEW+ + + + +    ++ R+N   T+LSKRK+  LV++  V  W+DPR  T+  
Sbjct: 459 LSRESYEWLCDQVHVFRPAQREYGRLNITGTILSKRKIAKLVNEHYVRGWNDPRLFTLEA 518

Query: 465 VRRRGMTIEGLRNFVLSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTVVTNPVKLHLNG 524
           +RRRG+    + +F+ + G + +  N++     +  +K ++   PR  +V +PV++ ++ 
Sbjct: 519 IRRRGVPPGAILSFINTLGVTTSTTNIQVVRFESAIRKYLEDNTPRLMMVLDPVEVVVDN 578

Query: 525 ADVPQTPLTEMKPKHKKNPAVGEKKVIYYKDVLIGAED 562
                  L  + P     P  GE++V +     I   D
Sbjct: 579 LPEDYEELVTV-PYRPGTPEFGERQVPFTGKFYIERSD 615

>KLLA0F20449g Chr6 (1898253..1900667) [2415 bp, 804 aa] {ON} highly
           similar to uniprot|P13188 Saccharomyces cerevisiae
           YOR168W GLN4 Glutamine tRNA synthetase monomeric class I
           tRNA synthetase that catalyzes the specific
           glutaminylation of tRNA(Glu) N-terminal domain proposed
           to be involved in enzyme-tRNA interactions
          Length = 804

 Score =  217 bits (553), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 138/398 (34%), Positives = 212/398 (53%), Gaps = 13/398 (3%)

Query: 176 GNVNKKKETHKANFEIDLPDAKI--GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKG 233
           G+++K  E  +A  E+     K   G+V TRFPPEP+GYLHIGH+KA ++N  FA+ + G
Sbjct: 224 GDLHKVGENEQAYPELMAEHLKATGGKVHTRFPPEPNGYLHIGHSKAIMVNFGFAKYHNG 283

Query: 234 KLIIRFDDTNPSKERVEFQDSILEDLELLGIKGDRITHSSDYFQEMYDYCVQMIKEGKAY 293
              +RFDDTNP  E  E+ +SI   +  LG K  + T+SSDYF E+Y     +IK GKAY
Sbjct: 284 VCYLRFDDTNPEAEAPEYFESIKSMVSWLGFKPWKTTYSSDYFDELYQLAETLIKNGKAY 343

Query: 294 ---CDDTPTXXXXXXXXXGI------ASARRERSVEENLKIFTEEMKNGTEEGLKNCVRA 344
              C              G       A   RER +EE+L  F  +M++G  +  +  +R 
Sbjct: 344 VCHCSAEEIKRGRGIKEDGTPGGERKACVSRERPIEESLTEF-RKMRDGFYKPGEAILRM 402

Query: 345 KRDYAALNKTLKDPVLYRCNLTPHHRTGTAWKIYPTYDFCVPIVDALEGVTHALRTIEYR 404
           K+D  + +  + D + YR    PH RTG  WKIYPTYDF   +VD+LE +TH+L T E+ 
Sbjct: 403 KQDLNSPSPQMWDLIAYRVLDAPHPRTGDKWKIYPTYDFTHCLVDSLENITHSLCTTEFY 462

Query: 405 DRNAQYEWMLNALKLRKVHIWDFARVNFVRTLLSKRKLQWLVDKQVVSNWDDPRFPTVRG 464
                YEW+ + + + +    ++ R+N   T+LSKRK+  LV    VS W+DPR  T+  
Sbjct: 463 LSRESYEWLCDQVHVFRPAQREYGRLNITGTVLSKRKIAKLVTGGYVSGWNDPRLFTLEA 522

Query: 465 VRRRGMTIEGLRNFVLSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTVVTNPVKLHLNG 524
           +RRRG+    + +F+ + G + +  N++     +  +K ++   PR   + +PV++ ++ 
Sbjct: 523 IRRRGVPPGAILSFINTLGVTTSTTNIQVVRFESAIRKYLEDTTPRLMFILDPVEVVVDN 582

Query: 525 ADVPQTPLTEMKPKHKKNPAVGEKKVIYYKDVLIGAED 562
            D     L  + P     P  G++ V + K   I   D
Sbjct: 583 VDEDFVELCNI-PYRPNTPEFGDRTVPFTKRFYIERSD 619

>TPHA0J00550 Chr10 complement(123101..125527) [2427 bp, 808 aa] {ON}
           Anc_6.51 YOR168W
          Length = 808

 Score =  217 bits (553), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 121/356 (33%), Positives = 196/356 (55%), Gaps = 12/356 (3%)

Query: 176 GNVNKKKETHKANFEIDLPDAKI--GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKG 233
           G+++K  E  +A  E+ +   K   G V TRFPPEP+GYLHIGH+KA ++N  +A+ + G
Sbjct: 226 GDLHKAGENPQAYPEMMIEHLKATGGRVQTRFPPEPNGYLHIGHSKAIMVNFGYAKYWNG 285

Query: 234 KLIIRFDDTNPSKERVEFQDSILEDLELLGIKGDRITHSSDYFQEMYDYCVQMIKEGKAY 293
              +RFDDTNP  E  E+ +SI   +  LG K  ++T+SSDYF ++Y+    +IK  K Y
Sbjct: 286 VCYLRFDDTNPEAEAPEYFESIQRMVSWLGFKPWKVTYSSDYFDKLYELAEVLIKNDKGY 345

Query: 294 ---CDDTPTXXXXXXXXXGI------ASARRERSVEENLKIFTEEMKNGTEEGLKNCVRA 344
              C              G       A   R+R +EE+L+ F   M+ G  +  +  +R 
Sbjct: 346 ICHCTAEEIKRGRGIKEDGTPGGERSACKHRDRPIEESLQEF-RNMREGKYQPGEAILRM 404

Query: 345 KRDYAALNKTLKDPVLYRCNLTPHHRTGTAWKIYPTYDFCVPIVDALEGVTHALRTIEYR 404
           K+D  + +  + D + YR   +PH RTG  WKIYPTYDF   +VD+ E ++H+L T E+ 
Sbjct: 405 KQDLTSPSPQMWDLIAYRVLNSPHPRTGDKWKIYPTYDFTHCLVDSFENISHSLCTTEFY 464

Query: 405 DRNAQYEWMLNALKLRKVHIWDFARVNFVRTLLSKRKLQWLVDKQVVSNWDDPRFPTVRG 464
                YEW+ + + + +    ++ R+N   T+LSKRK+  LV+   V  WDDPR  T+  
Sbjct: 465 LSRESYEWLCDQVHVFRPAQREYGRLNITGTVLSKRKIAKLVEGSYVRGWDDPRLYTLEA 524

Query: 465 VRRRGMTIEGLRNFVLSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTVVTNPVKL 520
           +RRRG+    + +F+ + G + +  N++     +  +K ++   PR   + +P+++
Sbjct: 525 IRRRGIPPGAILSFINTLGVTTSTTNIQVARFESAIRKFLEDTTPRLMFILDPIEV 580

>NDAI0A08460 Chr1 (1951121..1952710) [1590 bp, 529 aa] {ON}
           Anc_7.100 YOL033W
          Length = 529

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 76/309 (24%), Positives = 126/309 (40%), Gaps = 49/309 (15%)

Query: 202 VTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKERVEFQDSILEDLEL 261
           +TRF P P+G LH+G  + AL N   A++  GK I+R +DT+ S+   E   +I E L+ 
Sbjct: 43  ITRFAPSPTGLLHLGSLRTALYNYLLARSTNGKFILRLEDTDQSRIHPEAISNIYETLKW 102

Query: 262 LGIKGDR-ITHSSDYFQEMYDYCVQMIKEGKAY-CDDTPTXXXXXXXXXGIASARRERSV 319
            GI  D      SD     + Y   ++  G AY C  T            +   RR+ S 
Sbjct: 103 CGINYDEGFIKQSDRLPIYHKYIKILLDSGAAYHCFCT---------KDRLEQLRRKNSN 153

Query: 320 EENLKIFTEEMKNGTEEGLKNCVRAKRDYAALNKTLKDPVLY---------RCNLTPHHR 370
             N   +     +   E +++ + A   Y      LK P  Y         + ++  + +
Sbjct: 154 TPNSPSYDRNCYHLDTEIVESNLTANLPYTI---RLKSPDRYPPFTDLLHGQVDIQLNQK 210

Query: 371 TGTAW---------KIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALKLRK 421
               W           YPTY F   + D L G+TH +R  E+     ++      + L +
Sbjct: 211 ERGVWFDDPILIKSDGYPTYHFANVVDDHLMGITHVIRGEEWLPSTPKH------VALYQ 264

Query: 422 VHIWDFARVNFVRTLLSKRKLQWLVDKQVVSNWDDPRFPTVRGVRRRGMTIEGLRNF--V 479
           +  WD  +   +  L S      + DK++     D    +V  ++ +G+  E L NF  +
Sbjct: 265 LFGWDMPKFIHIPLLTS------IDDKKLSKRKGD---FSVLSLKEKGVLPEALVNFCAL 315

Query: 480 LSQGPSRNV 488
           L   P R++
Sbjct: 316 LGWSPPRDI 324

>NCAS0I00560 Chr9 complement(89020..90603) [1584 bp, 527 aa] {ON}
           Anc_7.100 YOL033W
          Length = 527

 Score = 68.2 bits (165), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 74/303 (24%), Positives = 128/303 (42%), Gaps = 37/303 (12%)

Query: 201 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKERVEFQDSILEDLE 260
           V+TRF P P+G LH+G  + AL N   A+   GK I+R +DT+ ++   E   +I + L+
Sbjct: 46  VITRFAPSPTGLLHLGSLRTALYNYLLAKNTNGKFILRLEDTDQTRLHPEALKNIFDTLK 105

Query: 261 LLGIKGDR-ITHSSDYFQEMYDYCVQMIKEGKAYCDDTPTXXXXXXXXXGIA--SARRER 317
              ++ D      S       +Y  +++K G AY                +A  S   +R
Sbjct: 106 WCNMEYDEGPIEQSQRLPIYQEYIKKLLKSGHAYYCFCSRERLEQLRTGNMAPGSLSYDR 165

Query: 318 SVEENLKIFTEEMKNGTEEGLKNCVRAK--RDYAALNKTLKDPVLYRCNLTPHHRTGTAW 375
                + +  E +K   ++G+   +R K    Y  ++  L   +    N+ P++R G  +
Sbjct: 166 KC---IHLDEETIKVNLDKGIPYTIRMKSPERYPLIHDLLHGEL----NIQPNNREGMWF 218

Query: 376 KI--------YPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALKLRKVHIWDF 427
                     +PTY F   + D L  VTH +R  E+     ++      + L +   W  
Sbjct: 219 DDPILIKSDGFPTYHFANVVDDHLMKVTHVIRGEEWLPSTPKH------VALYQYFGWAI 272

Query: 428 ARVNFVRTLLSKRKLQWLVDKQVVSNWDDPRFPTVRGVRRRGMTIEGLRNF--VLSQGPS 485
            +   +  L S      + DK++     D    +V G++ +G+  E L NF  +L   P 
Sbjct: 273 PKFIHIPLLTS------IDDKKLSKRKGD---FSVFGLKEQGILPEALINFCALLGWSPP 323

Query: 486 RNV 488
           RNV
Sbjct: 324 RNV 326

>KNAG0L00620 Chr12 complement(92148..93701) [1554 bp, 517 aa] {ON}
           Anc_7.100 YOL033W
          Length = 517

 Score = 67.8 bits (164), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 83/312 (26%), Positives = 127/312 (40%), Gaps = 52/312 (16%)

Query: 198 IGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKERVEFQDSILE 257
           +  VVTRF P P+G LH+G  + AL N   A+   GK I+R +DT+  +   E + +IL+
Sbjct: 38  VAPVVTRFAPSPTGLLHLGSLRTALYNYLLAKNTGGKFILRLEDTDRKRYHAEAEQNILD 97

Query: 258 DLELLGIKGD-RITHSSDYFQE-MYD-YCVQMIKEGKAYCDDTPTXXXXXXXXXGIASAR 314
            L+   IK D  +   SD  +E +Y  Y  Q++K G AY               G     
Sbjct: 98  TLDWCHIKWDGPMYRQSDRAREGLYTRYAEQLVKGGFAYKCFCSKERLNNLREEGYDRHC 157

Query: 315 RERSVEE---------NLKIFTEEMKNGTEEGLKNCVR--AKRDYAALNKTLKDPVLYRC 363
              S +E          ++    E+ +  ++ L   VR   +RD    +    DPVL + 
Sbjct: 158 THLSDQEVNAFQGTPYVIRFKAPEVYDAVDDLLHGSVRIQPRRDRHGFD----DPVLLKS 213

Query: 364 NLTPHHRTGTAWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALKL---R 420
           +             +PTY     + D L GVTH +R  E+     ++  M  A      +
Sbjct: 214 DR------------FPTYHLANVVDDHLMGVTHVIRGEEWLPSTPKHIAMYKAFGWSAPQ 261

Query: 421 KVHIWDFARVNFVRTLLSKRKLQWLVDKQVVSNWDDPRFPTVRGVRRRGMTIEGLRNFV- 479
            VHI     V+  +  LSKR+                    V  +++ G+  E L NFV 
Sbjct: 262 YVHIPLLTNVDDDKK-LSKRRGD----------------AAVYQLKQSGILPEALLNFVA 304

Query: 480 -LSQGPSRNVIN 490
            L   P R + N
Sbjct: 305 LLGWSPPRELAN 316

>TBLA0E02180 Chr5 complement(532174..533769) [1596 bp, 531 aa] {ON}
           Anc_7.100 YOL033W
          Length = 531

 Score = 60.8 bits (146), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 79/360 (21%), Positives = 141/360 (39%), Gaps = 80/360 (22%)

Query: 201 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKERVEFQDSILEDLE 260
           V TRF P P+G LH+G  + AL N   A+   G+ I+R +DT+  +     +++I   L+
Sbjct: 44  VRTRFAPSPTGSLHLGSLRTALYNYLLARNTGGQFILRIEDTDQKRLVKGAEENIYSSLK 103

Query: 261 LLGIKGD-------------RITHSSDYFQEMYDYCVQMIKEGKAY---CD--------- 295
            LG++ D             + +  S  +Q+   Y  +++  GKAY   C          
Sbjct: 104 WLGLQFDEGPNGINGPYGPYKQSERSSIYQK---YINELLDNGKAYRCFCSKERLTGLKE 160

Query: 296 -----DTPTXXXXXXXXXGIASARRERSVEENLK--------IFTEEMKNGTEEGLKNCV 342
                  PT          +  ++    +EENLK        + + ++    E+ L   +
Sbjct: 161 SAQKLKPPTTASYDRKCTNLTKSQ----IEENLKNKVPYTVRLLSPDLYPAFEDLLHGKL 216

Query: 343 RAKRDYAALNKTLKDPVLYRC-NLTPHHRTGTAWKIYPTYDFCVPIVDALEGVTHALRTI 401
             +  Y ++++   DPVL +  NL             PTY F   + D L  ++H +R  
Sbjct: 217 NIQPQYNSIDRRFDDPVLMKSDNL-------------PTYHFANVVDDHLMKISHVIRGE 263

Query: 402 EYRDRNAQYEWMLNALKLRK---VHIWDFARVNFVRTLLSKRK-----LQW--------- 444
           E+     ++  +  A   +    +HI     +N  +  LSKRK     LQ          
Sbjct: 264 EWLPSTPKHIAIYEAFGWKPPKYIHIPLLTTLNDKK--LSKRKGSASILQLKEDGVLPEA 321

Query: 445 LVDKQVVSNWDDPRFPTVRGVRRRGMTIEGLRNFVLSQGPSRNVINLEWNLIWAFNKKVI 504
           L++  V+  W  PR   +        T+    N    +  ++    ++   +W FNK  +
Sbjct: 322 LINFSVLFGWCPPR--ELTSTNHECFTLREFENIFDLRYLTKGNAKVDEKKLWFFNKHYL 379

>Skud_15.122 Chr15 (222353..223951) [1599 bp, 532 aa] {ON} YOL033W
           (REAL)
          Length = 532

 Score = 58.2 bits (139), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 97/427 (22%), Positives = 158/427 (37%), Gaps = 94/427 (22%)

Query: 141 VYVNVSRWYTTLELIPAFGGAHEFLAKSLKELKAAGNVNKKKETHKANFEIDLPDAKIGE 200
           + + + R +  L L P  G     L KSL   K       K++ H ++            
Sbjct: 2   ILLRIPRRFYCLSLKPTKGVGPSSLNKSLLSRKT------KEDIHPSS-----------P 44

Query: 201 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKERVEFQDSILEDLE 260
           V TRF P P+G+LH+G  + AL N   A+   G+ ++R +DT+  +     +++I + L+
Sbjct: 45  VRTRFAPSPTGFLHLGSLRTALYNYLLARNTNGQFLLRLEDTDQKRLIPGAEENIYDVLK 104

Query: 261 LLGIKGDRITHSSDYFQEMYD-YCVQMIKEGKAY---CD----DTPTXXXXXXXXXGIAS 312
              I  D         + +YD Y   ++  G AY   C     +             +AS
Sbjct: 105 WCKINYDETAVKQSERKPIYDKYVKILLSSGMAYRCFCSKERLNELRRSAMELKPPSMAS 164

Query: 313 ARRERSVEENLKIFTEEMKNGTEEGLKNCVRAK--RDYAALNKTLKDPVLYRCNLTPH-- 368
             R  S      +  EE+ +   +G+   VR K    Y      L   +    NL P   
Sbjct: 165 YDRCCSY-----LGEEEVNSKLSQGMPFTVRFKSPEKYPLFADLLHGEI----NLQPQVN 215

Query: 369 ---HRTGTAWKI----YPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALKLRK 421
               R      +     PTY     + D L G+TH +R  E+     ++  + NA     
Sbjct: 216 FNDRRYDDLILVKSDKLPTYHLANVVDDHLMGITHVIRGEEWLPSTPKHIALYNAFG--- 272

Query: 422 VHIWDFARVNFVRTLLSKRKLQWLVDKQVVSNWDDPRFPTVRGVRRRGMTIEGLRNFVLS 481
              WD  +  F+   L    L  + DK++     D    ++  ++++G+  E L NF   
Sbjct: 273 ---WDCPK--FIHIPL----LTTVGDKKLSKRKGD---MSISSLKKQGVLPEALVNFCAL 320

Query: 482 QG--PSRN----------------VINLEW----------NLIWAFNKKVIDPIAPRHTV 513
            G  P RN                + NL W            +W FNK  +         
Sbjct: 321 FGWSPPRNLASKKHECFSMKELEKLFNLNWLTKGNAKVDDKKLWFFNKHFL------QER 374

Query: 514 VTNPVKL 520
           ++NPV L
Sbjct: 375 ISNPVML 381

>Suva_15.134 Chr15 (235964..237571) [1608 bp, 535 aa] {ON} YOL033W
           (REAL)
          Length = 535

 Score = 58.2 bits (139), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 80/356 (22%), Positives = 135/356 (37%), Gaps = 58/356 (16%)

Query: 201 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKERVEFQDSILEDLE 260
           V TRF P P+G+LH+G  + AL N   A+  KG+ ++R +DT+  +     +++I E L+
Sbjct: 45  VRTRFAPSPTGFLHLGSLRTALYNYLLARNTKGQFLLRLEDTDQKRLVPGAEENIYEVLK 104

Query: 261 LLGIKGDRITHSSDYFQEMYD-YCVQMIKEGKAY-C----DDTPTXXXXXXXXXGIASAR 314
              I  D         + +YD Y   ++  G AY C    +               + A 
Sbjct: 105 WCKISYDETPVKQSERKSVYDKYVKILLSSGMAYRCFCSKERLNDLRRSAMELKPPSMAS 164

Query: 315 RERSVEENLKIFTEEMKNGTEEGLKNCVRAK--RDYAALNKTLKDPVLYRCNLTPH---- 368
            +R      K   EE+++   + +   VR K    Y      L   +    NL P     
Sbjct: 165 YDRCCAHLAK---EEIESKLAQDMPFTVRFKSPEQYPTFTDVLHGEI----NLQPQVNYN 217

Query: 369 -HRTGTAWKI----YPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALKLRKVH 423
             R      +     PTY     + D L G+TH +R  E+     ++  + NA       
Sbjct: 218 DRRYDDLILVKSDKLPTYHLANVVDDHLMGITHVIRGEEWLPSTPKHIALYNAFG----- 272

Query: 424 IWDFARVNFVRTL-------LSKRK--------------LQWLVDKQVVSNWDDPRFPTV 462
            WD+ +   +  L       LSKRK               + LV+   +  W  PR   +
Sbjct: 273 -WDYPKFIHIPLLTTVGDKKLSKRKGDMSISSLKNQGILPEALVNFCALFGWSPPR--DL 329

Query: 463 RGVRRRGMTIEGLRNFVLSQGPSRNVINLEWNLIWAFNK-----KVIDPIAPRHTV 513
              +    ++E L       G ++    ++   +W FNK     ++ DP+  +  V
Sbjct: 330 ASKKHECFSMEDLEKLFNLNGLTKGNAKVDDKKLWFFNKHFLQERISDPVMLKELV 385

>Kpol_1044.12 s1044 complement(21668..23278) [1611 bp, 536 aa] {ON}
           complement(21668..23278) [1611 nt, 537 aa]
          Length = 536

 Score = 57.4 bits (137), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 76/310 (24%), Positives = 128/310 (41%), Gaps = 44/310 (14%)

Query: 198 IGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKERVEFQDSILE 257
           I  V TRF P P+G+LH+G  + AL N   A+   G+ ++R +DT+  +   + +++I E
Sbjct: 38  ISPVRTRFAPSPTGFLHLGSLRTALYNYLLAKNTGGQFLLRLEDTDRKRLVKDAEENIYE 97

Query: 258 DLELLGIKGDRITHS----------SDYFQEMYDYCVQMIKEGKAYCDDTPTXXXXXXXX 307
            L+  GI  D   +S          SD  +    Y  +++  G AY    P         
Sbjct: 98  SLKWCGIDYDEGPNSQNQQFGPYRQSDRTKIYQKYIDKLLDNGHAYRCFCPKERLDSLRD 157

Query: 308 XGIASARRER-----SVEEN-LKIFTEEMKNGTEEGLKNCVRAKRD--YAALNKTLKDPV 359
               SA++ +     S + N L +  +E++N    G+   VR K    Y   +  L   +
Sbjct: 158 ----SAQKLQPPTTVSYDRNCLHLNHDEIQNNINNGVSYTVRMKSPEIYPPFDDLLHGHI 213

Query: 360 LYRCNLTPHHRTGTAWKIY-----PTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWML 414
             +  +  + R      +      PTY F   I D L  +TH +R  E+     ++    
Sbjct: 214 NIQPQINSNDRRYDDPILMKSDNLPTYHFANVIDDHLMKITHVIRGEEWLPSTPKH---- 269

Query: 415 NALKLRKVHIWDFARVNFVRT-LLSKRKLQWLVDKQVVSNWDDPRFPTVRGVRRRGMTIE 473
             + L +   WD  +  FV   LL+    Q L  ++  S        +V  +R +G+  E
Sbjct: 270 --IALYEAFGWDSPK--FVHLPLLTSTNDQKLSKRKGDS--------SVLSLRDKGILPE 317

Query: 474 GLRNFVLSQG 483
            L NF +  G
Sbjct: 318 ALVNFSVLFG 327

>CAGL0F01133g Chr6 complement(114888..116486) [1599 bp, 532 aa] {ON}
           similar to uniprot|P48525 Saccharomyces cerevisiae
           YOL033w MSE1
          Length = 532

 Score = 57.0 bits (136), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 71/344 (20%), Positives = 130/344 (37%), Gaps = 59/344 (17%)

Query: 202 VTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKERVEFQDSILEDLEL 261
           VTRF P P+G LH+G  + AL N   A+   GK I+R +DT+ S+ +    D+I   L+ 
Sbjct: 47  VTRFAPSPTGMLHLGSLRTALYNYLLAKKTGGKFILRIEDTDRSRLKDGAMDNIYNSLKW 106

Query: 262 LGIKGDR----ITHSSDYFQEMYDYCVQMIKEGKAYC-----DDTPTXXXXXXXXXGIAS 312
             +K D      +  +D +++  ++ ++  +  + +C     DD             ++ 
Sbjct: 107 CNLKWDEGPYLQSERTDIYRKHINHLIETGRAYRCFCTKERLDDLRQSALRLVPPTNVSY 166

Query: 313 ARRERSVEENLKIFTEEMKNGTEEGLKNCVR--AKRDYAALNKTLKDPVLYRCNLTPHHR 370
            R    + E       E+K+  ++G+   VR  A   Y      L      + +L P   
Sbjct: 167 DRHCAHLSEG------EIKSKLDQGIPFTVRFKAPEKYPPFEDLLHG----KIDLQPQQN 216

Query: 371 TG---------TAWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALKLRK 421
                           YPTY     I D    ++H +R  E+     ++      + L +
Sbjct: 217 PSDIRYDDPILMKSDNYPTYHLANVIDDHDMKISHVIRGEEWLPSTPKH------IALYE 270

Query: 422 VHIWD---FARVNFVRTL----LSKRK--------------LQWLVDKQVVSNWDDPRFP 460
              W+   F  +  + T     LSKR+               + LV+  V+  W  PR  
Sbjct: 271 AFGWEPPKFTHLPLLTTTEDKKLSKRRNDMSVMSLKEQGILPEALVNFSVLFGWSPPR-- 328

Query: 461 TVRGVRRRGMTIEGLRNFVLSQGPSRNVINLEWNLIWAFNKKVI 504
            +        T++   N       ++    ++   +W FNK+ +
Sbjct: 329 ELASKNHECFTLQEFENLFDLDSLTKGNAKVDMKKLWFFNKQFL 372

>YOL033W Chr15 (263475..265085) [1611 bp, 536 aa] {ON}
           MSE1Mitochondrial glutamyl-tRNA synthetase, predicted to
           be palmitoylated
          Length = 536

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 80/356 (22%), Positives = 137/356 (38%), Gaps = 58/356 (16%)

Query: 201 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKERVEFQDSILEDLE 260
           V TRF P P+G+LH+G  + AL N   A+   G+ ++R +DT+  +     +++I E L+
Sbjct: 45  VRTRFAPSPTGFLHLGSLRTALYNYLLARNTNGQFLLRLEDTDQKRLIEGAEENIYEILK 104

Query: 261 LLGIKGDRITHSSDYFQEMYD-YCVQMIKEGKAYCDDTPTXXXXXXXXXGI-----ASAR 314
              I  D         + +YD Y   ++  GKAY                +     + A 
Sbjct: 105 WCNINYDETPIKQSERKLIYDKYVKILLSSGKAYRCFCSKERLNDLRHSAMELKPPSMAS 164

Query: 315 RERSVEENLKIFTEEMKNGTEEGLKNCVRAKRDYAALNKTLKDPVLYRCNLTPHHRTGTA 374
            +R       +  EE+K+   +G+   VR K        T  D +  + NL P  +    
Sbjct: 165 YDRCCAH---LGEEEIKSKLAQGIPFTVRFKS--PERYPTFTDLLHGQINLQP--QVNFN 217

Query: 375 WKIY-----------PTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALKLRKVH 423
            K Y           PTY     + D L G+TH +R  E+     ++  + NA       
Sbjct: 218 DKRYDDLILVKSDKLPTYHLANVVDDHLMGITHVIRGEEWLPSTPKHIALYNAFG----- 272

Query: 424 IW---DFARVNFVRTL----LSKRK--------------LQWLVDKQVVSNWDDPRFPTV 462
            W    F  +  + T+    LSKRK               + L++   +  W  PR   +
Sbjct: 273 -WACPKFIHIPLLTTVGDKKLSKRKGDMSISDLKRQGVLPEALINFCALFGWSPPR--DL 329

Query: 463 RGVRRRGMTIEGLRNFVLSQGPSRNVINLEWNLIWAFN-----KKVIDPIAPRHTV 513
              +    ++E L       G ++    ++   +W FN     K++++P   R  V
Sbjct: 330 ASKKHECFSMEELETIFNLNGLTKGNAKVDDKKLWFFNKHFLQKRILNPSTLRELV 385

>TPHA0L00590 Chr12 complement(100345..102021) [1677 bp, 558 aa] {ON}
           Anc_7.100 YOL033W
          Length = 558

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 76/315 (24%), Positives = 130/315 (41%), Gaps = 48/315 (15%)

Query: 201 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKERVEFQDSILEDLE 260
           V TRF P P+G++H+G  + AL N   A++  G+ ++R +DT+  +     ++ I E L+
Sbjct: 46  VRTRFAPSPTGFMHLGSLRTALYNYLLAKSTGGQFLLRLEDTDQKRLVEGAEEDIYETLK 105

Query: 261 LLGIKGDR--ITHSSDY--FQE-----MYDYCVQMIKEG----KAYC--DDTPTXXXXXX 305
             GI+ D     +S  Y  F++     +Y   ++++ E     K +C  +          
Sbjct: 106 WCGIEYDEGPNVNSEAYGPFRQSERTKIYAKHIKVLLENGDAYKCFCTKERLDEMKESAQ 165

Query: 306 XXXGIASARRERSVEENLKIFTEEMKNGTEEGLKNCVRAK--RDYAALNKTLKDPVLYRC 363
                +SA  +R     L +  EE+K          +R K    Y      L   +  + 
Sbjct: 166 KLNPPSSASYDRHC---LHLNEEEIKQKELLNSPYTIRLKSPEKYPEFEDLLHGKLSIQI 222

Query: 364 NLTPHHRTGTAWKI-----YPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNAL- 417
              PH +T     +      PTY F   + D L  +TH +R  E+     ++  M NAL 
Sbjct: 223 QYNPHKKTYDDPILIKSDGLPTYHFANVVDDHLMKITHVIRGEEWLPSTPKHISMYNALG 282

Query: 418 --KLRKVHIWDFARVNFVRTLLSKRKLQWLVDKQVVSNWDDPRFPTVRGVRRRGMTIEGL 475
               + +HI     +N  +  LSKRK     D  ++S            +++ G+  E L
Sbjct: 283 WQAPKYIHIPLLTSINDKK--LSKRK----GDSSILS------------MKKNGVLPEAL 324

Query: 476 RNFVLSQG--PSRNV 488
            NF +  G  P R +
Sbjct: 325 LNFSVLFGWSPPRKL 339

>KAFR0D01320 Chr4 complement(262226..263770) [1545 bp, 514 aa] {ON}
           Anc_7.100 YOL033W
          Length = 514

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 50/95 (52%), Gaps = 1/95 (1%)

Query: 200 EVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKERVEFQDSILEDL 259
            VVTRF P P+G LHIG  + AL N   A++  GK I+R +DT+ ++ +   +  I + L
Sbjct: 39  RVVTRFAPSPTGLLHIGSLRTALYNFLLARSTNGKFILRIEDTDRTRLKSGAEQDICDIL 98

Query: 260 ELLGIKGD-RITHSSDYFQEMYDYCVQMIKEGKAY 293
               +K D      SD      +Y  ++++ G AY
Sbjct: 99  NWCNLKYDVGPIRQSDRIPIYEEYANKLLETGAAY 133

>AEL338C Chr5 complement(12870..14471) [1602 bp, 533 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL033W
           (MSE1)
          Length = 533

 Score = 54.3 bits (129), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 40/65 (61%)

Query: 203 TRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKERVEFQDSILEDLELL 262
           TRF P P+GYLH+G  + AL N   A+   G+ ++R +DT+  +   + + +I + L+ L
Sbjct: 45  TRFAPSPTGYLHLGSLRTALYNYLLARNTNGQFLLRLEDTDQKRLVSDAEQNIYDTLQWL 104

Query: 263 GIKGD 267
           GI+ D
Sbjct: 105 GIQFD 109

>TDEL0H03500 Chr8 (582143..583747) [1605 bp, 534 aa] {ON} Anc_7.100
           YOL033W
          Length = 534

 Score = 54.3 bits (129), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 71/325 (21%), Positives = 125/325 (38%), Gaps = 68/325 (20%)

Query: 201 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKERVEFQDSILEDLE 260
           V TRF P P+G LHIG  + AL N   A+  +G+ ++R +DT+ ++     +++I + L+
Sbjct: 41  VRTRFAPSPTGMLHIGSLRTALYNYLLAKNTRGQFLLRLEDTDQNRLIQGAEENIYDSLK 100

Query: 261 LLGIKGD-------------RITHSSDYFQEMYDYCVQMIKEGKAY---CD--------- 295
             GI+ D             R +  ++ +Q+  D    ++K G AY   C          
Sbjct: 101 WCGIEYDEGPGVNDEKFGPYRQSERTEIYQQHVD---GLLKSGHAYRCFCSKERLDGLRE 157

Query: 296 -----DTPTXXXXXXXXXGIASA----RRERSVEENLKIFTEEMKNGTEEGLKNCVRAKR 346
                  PT          ++      R  + +   +++   E      + L   V  + 
Sbjct: 158 SAKRLKPPTTVTYDRKCESLSQGEIEERLAQQIPHTIRLKAPERYPAFHDLLHGTVDIQP 217

Query: 347 DYAALNKTLKDPVLYRC-NLTPHHRTGTAWKIYPTYDFCVPIVDALEGVTHALRTIEYRD 405
                ++   DP+L +  NL             PTY F   I D L  +TH +R  E+  
Sbjct: 218 QVNVNDRRYDDPILIKSDNL-------------PTYHFANVIDDHLMKITHVIRGEEWLP 264

Query: 406 RNAQYEWMLNALKLRKVHIWDFARVNFVRTLLSKRKLQWLVDKQVVSNWDDPRFPTVRGV 465
              ++      + L +   WD      +  L S        DK++     D    +V  +
Sbjct: 265 STQKH------IALYRAFGWDPPSFIHIPLLTSTN------DKKLSKRRGD---ASVWNM 309

Query: 466 RRRGMTIEGLRNFVLSQG--PSRNV 488
           +  G+  E L NF +  G  P R++
Sbjct: 310 KSNGILPEALVNFCVLFGWSPPRDL 334

>Ecym_2626 Chr2 (1212098..1213819) [1722 bp, 573 aa] {ON} similar to
           Ashbya gossypii AEL338C
          Length = 573

 Score = 54.3 bits (129), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 68/314 (21%), Positives = 122/314 (38%), Gaps = 63/314 (20%)

Query: 203 TRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKERVEFQDSILEDLELL 262
           TRF P P+G+LH+G  + AL N   A+   G+ ++R +DT+ ++     + ++ +  + L
Sbjct: 62  TRFAPSPTGFLHLGSLRTALFNYLLAKKTGGQFLLRLEDTDRTRLVPGSEQNLYDSFKWL 121

Query: 263 GIKGDR---------ITHSSDYFQEMYDYCVQMIKEGKAY---CD--------------D 296
           GI+ D              SD  +    Y  Q+I  G AY   C                
Sbjct: 122 GIQYDEGPGVNETYGPYRQSDRTEIYKKYSDQLISTGHAYRCFCSKERLKGLRDSAMALK 181

Query: 297 TPTXXXXXXXXXGIAS----ARRERSVEENLKIFTEEMKNGTEEGLKNCVRAKRDYAALN 352
            PT          ++     ++ +  V   +++ + E+    E+ L N +  +     ++
Sbjct: 182 PPTNVTYDRHCAKLSKEDIRSKIKMGVPYTIRLKSPEIYEPFEDLLHNEINLQPQINPID 241

Query: 353 KTLKDPVLYRCNLTPHHRTGTAWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEW 412
               DP+L +        +G      PTY F   I D L  +TH +R  E+     ++  
Sbjct: 242 VRYDDPILIKS-------SGL-----PTYHFAHVIDDHLMEITHVIRGQEWLPATPKHIV 289

Query: 413 MLNAL---KLRKVHIWDFARVNFVRTLLSKRKLQWLVDKQVVSNWDDPRFPTVRGVRRRG 469
           +  A      + +H+   A  N  +  LSKRK                    ++ +R +G
Sbjct: 290 LYKAFGWNPPQFIHLPLLASTNNKK--LSKRKGD----------------TNIQQLREKG 331

Query: 470 MTIEGLRNFVLSQG 483
           +  E L NF +  G
Sbjct: 332 ILPEALINFCVLFG 345

>KLLA0F07975g Chr6 complement(746708..748336) [1629 bp, 542 aa] {ON}
           similar to uniprot|P48525 Saccharomyces cerevisiae
           YOL033W MSE1 Mitochondrial glutamyl-tRNA synthetase
           encoded by a nuclear gene
          Length = 542

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 74/313 (23%), Positives = 119/313 (38%), Gaps = 67/313 (21%)

Query: 201 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKERVEFQDSILEDLE 260
           V TRF P P+G+LH+G  + AL N   A+   G+ ++R +DT+  +     + S+ + L+
Sbjct: 51  VRTRFAPSPTGFLHMGSLRTALYNYLLAKNTGGEFLLRLEDTDQKRLVPGAEQSLYDALK 110

Query: 261 LLGIKGD------------RITHSSDYFQEMYDYCVQMIKEGKAYCD------------- 295
              IK D            R +  +  +QE  +  V+     K +C              
Sbjct: 111 WCNIKYDEGPGVNEIYGPYRQSDRTKIYQEYINTLVEKGDAYKCFCSKERLDALRESAQK 170

Query: 296 -DTPTXXXXXXXXXGIASARRERSVEENLKI---FTEEMKNGT-----EEGLKNCVRAKR 346
              PT            S   ++ VE NLK    FT   K+       E+ L   +  + 
Sbjct: 171 LQPPTTVSYDRH----CSKLSDQEVEANLKAGIPFTVRFKSPDKYPPFEDLLHGKLDIQP 226

Query: 347 DYAALNKTLKDPVLYRC-NLTPHHRTGTAWKIYPTYDFCVPIVDALEGVTHALRTIEYRD 405
               L+    DP+L +  NL             PTY F   I D L  +TH +R  E+  
Sbjct: 227 QVNPLDIRYDDPILMKSDNL-------------PTYHFANVIDDHLMKITHVIRGEEWLP 273

Query: 406 RNAQYEWMLNALKLRKVHIWDFARVNFVRTLLSKRKLQWLVDKQVVSNWDDPRFPTVRGV 465
              ++  +  A        + +   ++V   L    L    DK++     D     VR +
Sbjct: 274 STPKHTALYEA--------YGWTPPHYVHIPL----LTTTSDKKLSKRKGD---ADVRAM 318

Query: 466 RRRGMTIEGLRNF 478
           R +G+  E L NF
Sbjct: 319 RAKGILPEALINF 331

>Smik_15.132 Chr15 (229667..231274) [1608 bp, 535 aa] {ON} YOL033W
           (REAL)
          Length = 535

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 84/362 (23%), Positives = 135/362 (37%), Gaps = 67/362 (18%)

Query: 201 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKERVEFQDSILEDLE 260
           V TRF P P+G LH+G  + AL N   A+   G+ ++R +DT+  +     +  I + L 
Sbjct: 45  VRTRFAPSPTGLLHLGSLRTALYNYLLARNTNGQFLLRLEDTDQKRLVPGAEKDIYDVLN 104

Query: 261 LLGIKGDRITHSSDYFQEMYD-YCVQMIKEGKAY---CD----DTPTXXXXXXXXXGIAS 312
              I+ D         + +YD Y   ++  G AY   C     +             +AS
Sbjct: 105 WCKIEYDETVVRQSERKLVYDKYVKILLSSGMAYRCFCSKERLNDLRHSAMELKPPSMAS 164

Query: 313 ARRERSVEENLKIFTEEMKNGTEEGLKNCVRAK--RDYAALNKTLKDPVLYRCNLTPHHR 370
             R      +LK   EE+ +   +G+   VR K    Y      L   V    NL P  +
Sbjct: 165 YDR---CCAHLK--EEEINSNLTQGIPFTVRFKSPEQYPVFTDLLHGEV----NLQP--Q 213

Query: 371 TGTAWKIY-----------PTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALKL 419
                K Y           PTY     + D L G+TH +R  E+     ++  + NA   
Sbjct: 214 VNFNDKRYDDLILVKSDKLPTYHLANVVDDHLMGITHVIRGEEWLPSTPKHIALYNAFG- 272

Query: 420 RKVHIW---DFARVNFVRTL----LSKRK--------------LQWLVDKQVVSNWDDPR 458
                W    F  +  + T+    LSKRK               + L++   +  W  PR
Sbjct: 273 -----WVCPKFIHIPLLTTVGDKKLSKRKGDMSISSLKKQGVLPEALINFCALFGWSPPR 327

Query: 459 FPTVRGVRRRGMTIEGLRNFVLSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTVVTNPV 518
              +   R    ++E L N     G ++    ++   +W FNK  +         ++NP+
Sbjct: 328 --DLASKRHECFSMEELENLFNLNGLTKGNAKVDDKKLWFFNKHFL------QKRISNPL 379

Query: 519 KL 520
            L
Sbjct: 380 ML 381

>SAKL0B09548g Chr2 (809247..810911) [1665 bp, 554 aa] {ON} similar
           to uniprot|P48525 Saccharomyces cerevisiae YOL033W MSE1
           Mitochondrial glutamyl-tRNA synthetase encoded by a
           nuclear gene
          Length = 554

 Score = 51.2 bits (121), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 69/306 (22%), Positives = 112/306 (36%), Gaps = 62/306 (20%)

Query: 201 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKERVEFQDSILEDLE 260
           V TRF P P+G LH+G  + AL N   A++  G+ ++R +DT+  +     + +I + L+
Sbjct: 61  VRTRFAPSPTGLLHMGSLRTALYNYLLARSTGGQFLLRLEDTDQKRLVPGAEQNIYDSLK 120

Query: 261 LLGIKGDR----------ITHSSDYFQEMYDYCVQMIKEGKAY-CDDTPTXXXXXXXXXG 309
             G++ D               SD  +    Y  Q++  G AY C  +            
Sbjct: 121 WCGVEYDEGPGVNEDKFGPYRQSDRTEIYQHYIKQLLNSGHAYRCFCSKERLDGLRSSAQ 180

Query: 310 IASARRERSVEENLKIFTE-EMKNGTEEGLKNCVRAK--RDYAALNKTLK---------- 356
                   S + +    TE E+    ++G+   VR K  + Y      L           
Sbjct: 181 QLQPPTTASYDRHCTELTEDEIAENLKKGVPCTVRLKAPKKYPPFEDLLHGQLDMQIQIN 240

Query: 357 -------DPVLYRCNLTPHHRTGTAWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQ 409
                  DP+L + +              PTY F   + D L  +TH +R  E+     +
Sbjct: 241 MNDIRYDDPILMKSD------------GLPTYHFANVVDDHLMRITHVIRGEEWLPSTPK 288

Query: 410 YEWMLNALKLRK---VHIWDFARVNFVRTLLSKRK--------------LQWLVDKQVVS 452
           +  + NA        +HI      N  +  LSKRK               + LV+  V+ 
Sbjct: 289 HIALYNAFGWNPPQFIHIPLLTSTNDKK--LSKRKGDADVMQLKAKGILPEALVNFSVLF 346

Query: 453 NWDDPR 458
            W  PR
Sbjct: 347 GWSPPR 352

>Kwal_26.7202 s26 complement(261450..263153) [1704 bp, 567 aa] {ON}
           YOL033W (MSE1) - Mitochondrial glutamyl-tRNA synthetase
           [contig 47] FULL
          Length = 567

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 38/65 (58%)

Query: 203 TRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKERVEFQDSILEDLELL 262
           TRF P P+G LHIG  + AL N   A++  G+ ++R +DT+  +     ++SI E L+  
Sbjct: 54  TRFAPSPTGLLHIGSLRTALYNYLLAKSTGGEFLLRLEDTDQKRLVPGAEESIYESLKWC 113

Query: 263 GIKGD 267
           G+  D
Sbjct: 114 GLSFD 118

>KLTH0D02794g Chr4 complement(270516..272156) [1641 bp, 546 aa] {ON}
           similar to uniprot|P48525 Saccharomyces cerevisiae
           YOL033W MSE1 Mitochondrial glutamyl-tRNA synthetase
           encoded by a nuclear gene
          Length = 546

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 67/299 (22%), Positives = 115/299 (38%), Gaps = 42/299 (14%)

Query: 203 TRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKERVEFQDSILEDLELL 262
           TRF P P+G LHIG  + AL N   A++  G  ++R +DT+ ++     + +I E L   
Sbjct: 47  TRFAPSPTGLLHIGSLRTALYNYLLAKSTGGSFLLRLEDTDQNRLVPGAEKNIYESLSWC 106

Query: 263 GIKGD-------------RITHSSDYFQEMYDYCVQMIKEGKAY-CDDTPTXXXXXXXXX 308
           GI  D             R +  ++ +Q+   Y  +++  G AY C  T           
Sbjct: 107 GIHYDEGPGVNDKKNGPFRQSDRTEIYQQ---YTNKLLDSGHAYRCFCTKERLDGLRESA 163

Query: 309 GIASARRERSVEENLKIFTE-EMKNGTEEGLKNCVRAK--RDYAALNKTLKDPVLYRCNL 365
                    S + +    +E E++   ++ +   +R K    Y      L   +  +  +
Sbjct: 164 QKLQPPTTASYDRHCSHLSEGEIREKLDQKVPFTIRLKSPERYPPFEDLLHGKLDMQPQV 223

Query: 366 TPHHR-----TGTAWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALK-L 419
            P+ R             PTY F   + D L  +TH +R           EW+ +  K +
Sbjct: 224 NPNDRRYDDPILVKSDALPTYHFANVVDDHLMDITHVVRG---------EEWLPSTPKHI 274

Query: 420 RKVHIWDFARVNFVRTLLSKRKLQWLVDKQVVSNWDDPRFPTVRGVRRRGMTIEGLRNF 478
              H + +    F+   L    L  + DK++     D     V  +R +G+  E L NF
Sbjct: 275 ALYHAFGWNPPEFIHIPL----LTSVTDKKLSKRRGD---ADVMALRAKGVLPEALVNF 326

>ZYRO0D05808g Chr4 complement(493474..495075) [1602 bp, 533 aa] {ON}
           similar to uniprot|P48525 Saccharomyces cerevisiae
           YOL033W MSE1 Mitochondrial glutamyl-tRNA synthetase
           encoded by a nuclear gene
          Length = 533

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 29/46 (63%)

Query: 201 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSK 246
           V TRF P P+G LH+G  + AL N   A+   G+ I+R +DT+ S+
Sbjct: 40  VRTRFAPSPTGLLHMGSLRTALYNYLLAKNTGGQFILRLEDTDQSR 85

>KLLA0F10395g Chr6 complement(959120..960238) [1119 bp, 372 aa] {ON}
           similar to uniprot|P46672 Saccharomyces cerevisiae
           YGL105W ARC1 Protein that binds tRNA and methionyl- and
           glutamyl-tRNA synthetases (Mes1p and Gus1p) delivering
           tRNA to them stimulating catalysis and ensuring their
           localization to the cytoplasm also binds quadruplex
           nucleic acids
          Length = 372

 Score = 39.7 bits (91), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 23/32 (71%)

Query: 93  LSGSLEKLDAHLNLRTFVLGGMQPTVADVAVW 124
           + GS E+L+ HL   TFVLG  QPTV+DV ++
Sbjct: 39  IQGSFEELNLHLRDHTFVLGTAQPTVSDVTLF 70

>Smik_12.469 Chr12 complement(820772..823459) [2688 bp, 895 aa] {ON}
           YLR382C (REAL)
          Length = 895

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 36/67 (53%), Gaps = 2/67 (2%)

Query: 168 SLKELKAAGNVNKKKETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYF 227
           ++K+L A G   K+K T +   E D P      ++ +FP  PSG LHIGH +  +++   
Sbjct: 20  AVKKLIAIGKKWKQK-TIRGPIEHDTPKKGSKYILCQFP-YPSGALHIGHLRVYVISDSL 77

Query: 228 AQAYKGK 234
            + YK +
Sbjct: 78  NRFYKQR 84

>Kpol_2001.9 s2001 (28658..29905) [1248 bp, 415 aa] {ON}
           (28658..29905) [1248 nt, 416 aa]
          Length = 415

 Score = 31.6 bits (70), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 53/230 (23%), Positives = 91/230 (39%), Gaps = 46/230 (20%)

Query: 315 RERSVEENLKIFTEEMKNGTEEGLKNCVRAKRDYAALNKTLKDPVLYRCNLTPHHRTGTA 374
           R RSV + LK+ T    +G  E  KN                DP       TP  +  T 
Sbjct: 45  RRRSVTQKLKLSTNTYDDGALEDAKN-------------FRNDPT------TPVKQNATL 85

Query: 375 WKIYPTYDFCVPIVDALEGVTHALRTIEYR-DRNAQYEW-MLNALKLRKVHIWDFARVNF 432
             +   ++        ++G   ++R++E R ++   Y+W  LN +   KV I        
Sbjct: 86  LMLVRNWE--------VQGALQSMRSLEDRFNKEYNYDWTFLNDVPFDKVFIE------- 130

Query: 433 VRTLLSKRKLQWLVDKQVVSNWDDPRFPTVRGVRRRGMTIEGLRNFVLSQGPSRNVINL- 491
             T ++  K  + V  +   +WD P +      +R   +++ ++   +  G SR+  N+ 
Sbjct: 131 ATTAMASGKTNYAVIPK--EDWDCPEWI---DQKRFNQSLQLMQEENIVYGNSRSYRNMC 185

Query: 492 EWNLIWAFNKKVIDPIAPRHTVVTNPVKLHLNGADVPQTPLTEMKPKHKK 541
           ++N  + F +KV+D       V  N         D P  P   MK K+KK
Sbjct: 186 KFNSGYFFRQKVLDNYDYYFRVEPNVEYF----CDFPYDPFKIMKEKNKK 231

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 76,383,807
Number of extensions: 3431690
Number of successful extensions: 9559
Number of sequences better than 10.0: 63
Number of HSP's gapped: 9780
Number of HSP's successfully gapped: 65
Length of query: 707
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 590
Effective length of database: 40,065,477
Effective search space: 23638631430
Effective search space used: 23638631430
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)