Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AFR137C5.473ON36736718250.0
Ecym_23135.473ON37037016130.0
SAKL0G03520g5.473ON36936915470.0
KLLA0E03125g5.473ON36836815290.0
YOR136W (IDH2)5.473ON36936915250.0
Smik_15.3165.473ON36936915090.0
KNAG0B040705.473ON37337315060.0
Suva_8.1885.473ON36936915010.0
Skud_15.3005.473ON36936914950.0
Kwal_55.212735.473ON36836814890.0
KLTH0F15048g5.473ON36836814870.0
NDAI0C014105.473ON36936914820.0
Kpol_440.125.473ON36836814760.0
CAGL0I07227g5.473ON36836914710.0
TDEL0A033705.473ON37137114700.0
NCAS0H022505.473ON42236914670.0
KAFR0B063705.473ON37837814120.0
Kpol_543.85.473ON36835713970.0
TBLA0B022405.473ON37337313960.0
TPHA0J027705.473ON37635913960.0
ZYRO0D11220g5.473ON36836813500.0
TPHA0E014805.473ON37735812421e-171
ADL223W2.278ON3623707195e-92
Smik_14.2902.278ON3603417101e-90
Ecym_33162.278ON3623707092e-90
KLLA0F04103g2.278ON3613397049e-90
KLTH0G10186g2.278ON3603747031e-89
YNL037C (IDH1)2.278ON3603417003e-89
Skud_14.2932.278ON3613416988e-89
SAKL0E07876g2.278ON3613746796e-86
TBLA0B069102.278ON3653696788e-86
ZYRO0D02838g2.278ON3613426762e-85
Kwal_23.50122.278ON3613436762e-85
NDAI0B035902.278ON3593416743e-85
TPHA0D015602.278ON3603416613e-83
CAGL0G02673g2.278ON3583396526e-82
KNAG0A052802.278ON3613756526e-82
Kpol_1039.352.278ON3593416517e-82
NCAS0B062902.278ON3593416394e-80
TDEL0C038402.278ON3613456273e-78
KAFR0J014102.278ON3503715976e-74
Suva_14.3022.278ON3002835451e-66
CAGL0G02585g2.287ON3723854029e-45
TBLA0B059402.287ON3693754021e-44
Kpol_1003.392.287ON3703583966e-44
SAKL0E07656g2.287ON3683903967e-44
YIL094C (LYS12)2.287ON3713663914e-43
KLLA0E08339g2.287ON3693913897e-43
TPHA0C034102.287ON3713923898e-43
KNAG0A054202.287ON3723643899e-43
ADL214C2.287ON3673543871e-42
Suva_9.1052.287ON3713663862e-42
Ecym_33262.287ON3663553853e-42
NDAI0B035502.287ON3723543853e-42
NCAS0B062502.287ON3733553844e-42
Smik_9.852.287ON3713663811e-41
Skud_9.792.287ON3713663767e-41
KAFR0J013602.287ON3733543722e-40
TDEL0G021802.287ON3693773634e-39
KLTH0G10384g2.287ON3673943625e-39
ZYRO0A01914g2.287ON3683523618e-39
Kwal_27.115282.287ON3673903547e-38
AAL012C1.402ON3723512109e-18
Ecym_12961.402ON3632761983e-16
TBLA0C015001.402ON3652701965e-16
KLLA0D04906g1.402ON3623551842e-14
ZYRO0E04796g1.402ON3622661842e-14
Kwal_0.2251.402ON3643551833e-14
SAKL0D08690g1.402ON3642681798e-14
YCL018W (LEU2)1.402ON3642701772e-13
Skud_3.431.402ON3642661753e-13
KAFR0I022001.402ON3652661734e-13
Smik_3.661.402ON3642661735e-13
NDAI0G042301.402ON3633611727e-13
TDEL0B060001.402ON3623571718e-13
CAGL0H03795g1.402ON3653561692e-12
KNAG0I012801.402ON4473511702e-12
Kpol_1048.631.402ON3643581682e-12
Suva_3.31.402ON3643521664e-12
NCAS0C048701.402ON3652721631e-11
KLTH0H12188g1.402ON3643511612e-11
TPHA0B037301.402ON3652661602e-11
Suva_14.303singletonON53511222e-08
Smik_5.871.450ON56044741.2
TDEL0A042205.559ON1334162741.4
KLTH0G12474g8.314ON22992712.1
ADR028W3.425ON83258722.2
Skud_14.2802.260ON40394694.1
TPHA0A014408.352ON88381686.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR137C
         (367 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR137C Chr6 complement(685586..686689) [1104 bp, 367 aa] {ON} S...   707   0.0  
Ecym_2313 Chr2 complement(610493..611605) [1113 bp, 370 aa] {ON}...   625   0.0  
SAKL0G03520g Chr7 (290768..291877) [1110 bp, 369 aa] {ON} highly...   600   0.0  
KLLA0E03125g Chr5 (288825..289931) [1107 bp, 368 aa] {ON} highly...   593   0.0  
YOR136W Chr15 (580250..581359) [1110 bp, 369 aa] {ON}  IDH2Subun...   592   0.0  
Smik_15.316 Chr15 (541618..542727) [1110 bp, 369 aa] {ON} YOR136...   585   0.0  
KNAG0B04070 Chr2 complement(778658..779779) [1122 bp, 373 aa] {O...   584   0.0  
Suva_8.188 Chr8 (335409..336518) [1110 bp, 369 aa] {ON} YOR136W ...   582   0.0  
Skud_15.300 Chr15 (534346..535455) [1110 bp, 369 aa] {ON} YOR136...   580   0.0  
Kwal_55.21273 s55 complement(762121..763227) [1107 bp, 368 aa] {...   578   0.0  
KLTH0F15048g Chr6 complement(1232566..1233672) [1107 bp, 368 aa]...   577   0.0  
NDAI0C01410 Chr3 complement(295178..296287) [1110 bp, 369 aa] {O...   575   0.0  
Kpol_440.12 s440 (32084..33190) [1107 bp, 368 aa] {ON} (32084..3...   573   0.0  
CAGL0I07227g Chr9 complement(696605..697711) [1107 bp, 368 aa] {...   571   0.0  
TDEL0A03370 Chr1 (599855..600970) [1116 bp, 371 aa] {ON} Anc_5.4...   570   0.0  
NCAS0H02250 Chr8 (441692..442960) [1269 bp, 422 aa] {ON} Anc_5.473    569   0.0  
KAFR0B06370 Chr2 complement(1317952..1319088) [1137 bp, 378 aa] ...   548   0.0  
Kpol_543.8 s543 (21411..22517) [1107 bp, 368 aa] {ON} (21411..22...   542   0.0  
TBLA0B02240 Chr2 complement(524111..525232) [1122 bp, 373 aa] {O...   542   0.0  
TPHA0J02770 Chr10 (617727..618857) [1131 bp, 376 aa] {ON} Anc_2....   542   0.0  
ZYRO0D11220g Chr4 (946652..947758) [1107 bp, 368 aa] {ON} highly...   524   0.0  
TPHA0E01480 Chr5 complement(300222..301355) [1134 bp, 377 aa] {O...   483   e-171
ADL223W Chr4 (312893..313981) [1089 bp, 362 aa] {ON} Syntenic ho...   281   5e-92
Smik_14.290 Chr14 (528131..529213) [1083 bp, 360 aa] {ON} YNL037...   278   1e-90
Ecym_3316 Chr3 (608744..609832) [1089 bp, 362 aa] {ON} similar t...   277   2e-90
KLLA0F04103g Chr6 (389159..390244) [1086 bp, 361 aa] {ON} unipro...   275   9e-90
KLTH0G10186g Chr7 (863151..864233) [1083 bp, 360 aa] {ON} highly...   275   1e-89
YNL037C Chr14 complement(557920..559002) [1083 bp, 360 aa] {ON} ...   274   3e-89
Skud_14.293 Chr14 (538202..539287) [1086 bp, 361 aa] {ON} YNL037...   273   8e-89
SAKL0E07876g Chr5 complement(635705..636790) [1086 bp, 361 aa] {...   266   6e-86
TBLA0B06910 Chr2 (1634845..1635942) [1098 bp, 365 aa] {ON}            265   8e-86
ZYRO0D02838g Chr4 (223132..224217) [1086 bp, 361 aa] {ON} simila...   265   2e-85
Kwal_23.5012 s23 (964254..965339) [1086 bp, 361 aa] {ON} YNL037C...   265   2e-85
NDAI0B03590 Chr2 complement(901108..902187) [1080 bp, 359 aa] {O...   264   3e-85
TPHA0D01560 Chr4 complement(321751..322833) [1083 bp, 360 aa] {O...   259   3e-83
CAGL0G02673g Chr7 complement(246455..247531) [1077 bp, 358 aa] {...   255   6e-82
KNAG0A05280 Chr1 (780448..781533) [1086 bp, 361 aa] {ON}              255   6e-82
Kpol_1039.35 s1039 complement(108102..109181) [1080 bp, 359 aa] ...   255   7e-82
NCAS0B06290 Chr2 complement(1186838..1187917) [1080 bp, 359 aa] ...   250   4e-80
TDEL0C03840 Chr3 complement(673007..674092) [1086 bp, 361 aa] {O...   246   3e-78
KAFR0J01410 Chr10 complement(256693..257745) [1053 bp, 350 aa] {...   234   6e-74
Suva_14.302 Chr14 (546468..547370) [903 bp, 300 aa] {ON} YNL037C...   214   1e-66
CAGL0G02585g Chr7 (238931..240049) [1119 bp, 372 aa] {ON} highly...   159   9e-45
TBLA0B05940 Chr2 complement(1402869..1403978) [1110 bp, 369 aa] ...   159   1e-44
Kpol_1003.39 s1003 complement(96083..97195) [1113 bp, 370 aa] {O...   157   6e-44
SAKL0E07656g Chr5 (620028..621134) [1107 bp, 368 aa] {ON} highly...   157   7e-44
YIL094C Chr9 complement(186517..187632) [1116 bp, 371 aa] {ON}  ...   155   4e-43
KLLA0E08339g Chr5 (750670..751779) [1110 bp, 369 aa] {ON} highly...   154   7e-43
TPHA0C03410 Chr3 complement(748639..749754) [1116 bp, 371 aa] {O...   154   8e-43
KNAG0A05420 Chr1 (799521..800639) [1119 bp, 372 aa] {ON}              154   9e-43
ADL214C Chr4 complement(328094..329197) [1104 bp, 367 aa] {ON} S...   153   1e-42
Suva_9.105 Chr9 complement(180626..181741) [1116 bp, 371 aa] {ON...   153   2e-42
Ecym_3326 Chr3 complement(624805..625905) [1101 bp, 366 aa] {ON}...   152   3e-42
NDAI0B03550 Chr2 (891508..892626) [1119 bp, 372 aa] {ON} Anc_2.2...   152   3e-42
NCAS0B06250 Chr2 (1179360..1180481) [1122 bp, 373 aa] {ON} Anc_2...   152   4e-42
Smik_9.85 Chr9 complement(165648..166763) [1116 bp, 371 aa] {ON}...   151   1e-41
Skud_9.79 Chr9 complement(163173..164288) [1116 bp, 371 aa] {ON}...   149   7e-41
KAFR0J01360 Chr10 (249197..250318) [1122 bp, 373 aa] {ON} Anc_2....   147   2e-40
TDEL0G02180 Chr7 complement(428789..429898) [1110 bp, 369 aa] {O...   144   4e-39
KLTH0G10384g Chr7 complement(878375..879478) [1104 bp, 367 aa] {...   144   5e-39
ZYRO0A01914g Chr1 complement(158403..159509) [1107 bp, 368 aa] {...   143   8e-39
Kwal_27.11528 s27 (836437..837540) [1104 bp, 367 aa] {ON} YIL094...   140   7e-38
AAL012C Chr1 complement(320148..321266) [1119 bp, 372 aa] {ON} S...    86   9e-18
Ecym_1296 Chr1 (602530..603621) [1092 bp, 363 aa] {ON} similar t...    81   3e-16
TBLA0C01500 Chr3 complement(347212..348309) [1098 bp, 365 aa] {O...    80   5e-16
KLLA0D04906g Chr4 (420903..421991) [1089 bp, 362 aa] {ON} highly...    75   2e-14
ZYRO0E04796g Chr5 (362881..363969) [1089 bp, 362 aa] {ON} unipro...    75   2e-14
Kwal_0.225 s0 (111017..112111) [1095 bp, 364 aa] {ON} YCL018W (L...    75   3e-14
SAKL0D08690g Chr4 complement(723302..724396) [1095 bp, 364 aa] {...    74   8e-14
YCL018W Chr3 (91324..92418) [1095 bp, 364 aa] {ON}  LEU2Beta-iso...    73   2e-13
Skud_3.43 Chr3 (70293..71387) [1095 bp, 364 aa] {ON} YCL018W (REAL)    72   3e-13
KAFR0I02200 Chr9 (449737..450834) [1098 bp, 365 aa] {ON} Anc_1.4...    71   4e-13
Smik_3.66 Chr3 (89718..90812) [1095 bp, 364 aa] {ON} YCL018W (REAL)    71   5e-13
NDAI0G04230 Chr7 complement(1015689..1016780) [1092 bp, 363 aa] ...    71   7e-13
TDEL0B06000 Chr2 (1060828..1061916) [1089 bp, 362 aa] {ON} Anc_1...    70   8e-13
CAGL0H03795g Chr8 (356535..357632) [1098 bp, 365 aa] {ON}              70   2e-12
KNAG0I01280 Chr9 complement(245603..246946) [1344 bp, 447 aa] {O...    70   2e-12
Kpol_1048.63 s1048 (182096..183190) [1095 bp, 364 aa] {ON} (1820...    69   2e-12
Suva_3.3 Chr3 (1464..2558) [1095 bp, 364 aa] {ON} YCL018W (REAL)       69   4e-12
NCAS0C04870 Chr3 complement(993177..994274) [1098 bp, 365 aa] {O...    67   1e-11
KLTH0H12188g Chr8 (1039347..1040441) [1095 bp, 364 aa] {ON} high...    67   2e-11
TPHA0B03730 Chr2 complement(878199..879296) [1098 bp, 365 aa] {O...    66   2e-11
Suva_14.303 Chr14 (547367..547525) [159 bp, 53 aa] {ON} YNL037C ...    52   2e-08
Smik_5.87 Chr5 complement(124637..126319) [1683 bp, 560 aa] {ON}...    33   1.2  
TDEL0A04220 Chr1 complement(748109..752113) [4005 bp, 1334 aa] {...    33   1.4  
KLTH0G12474g Chr7 (1059087..1059776) [690 bp, 229 aa] {ON} simil...    32   2.1  
ADR028W Chr4 (753946..756444) [2499 bp, 832 aa] {ON} Syntenic ho...    32   2.2  
Skud_14.280 Chr14 (516761..517972) [1212 bp, 403 aa] {ON} YNL051...    31   4.1  
TPHA0A01440 Chr1 (281826..284477) [2652 bp, 883 aa] {ON} Anc_8.3...    31   6.9  

>AFR137C Chr6 complement(685586..686689) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR136W
           (IDH2)
          Length = 367

 Score =  707 bits (1825), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/367 (95%), Positives = 349/367 (95%)

Query: 1   MLRQKLFQGSRRWLASVRQPSIGRYAGKPNAAGKYTVSFIEGDGVGPEISQSVKDIFSAA 60
           MLRQKLFQGSRRWLASVRQPSIGRYAGKPNAAGKYTVSFIEGDGVGPEISQSVKDIFSAA
Sbjct: 1   MLRQKLFQGSRRWLASVRQPSIGRYAGKPNAAGKYTVSFIEGDGVGPEISQSVKDIFSAA 60

Query: 61  SVPVEWEYCDVTPLLVNGLTTIPEPAVASINKNLVALKGPLATPIGKGHRSLNLTLRKTF 120
           SVPVEWEYCDVTPLLVNGLTTIPEPAVASINKNLVALKGPLATPIGKGHRSLNLTLRKTF
Sbjct: 61  SVPVEWEYCDVTPLLVNGLTTIPEPAVASINKNLVALKGPLATPIGKGHRSLNLTLRKTF 120

Query: 121 GLFANVRPAKSIEGYKTTYSDVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITREASER 180
           GLFANVRPAKSIEGYKTTYSDVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITREASER
Sbjct: 121 GLFANVRPAKSIEGYKTTYSDVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITREASER 180

Query: 181 VIRYAFEYARTVGRPKVVVVHKSTIQRLADGLFVNVAQELGREYPDIELQTELLDNTVLN 240
           VIRYAFEYARTVGRPKVVVVHKSTIQRLADGLFVNVAQELGREYPDIELQTELLDNTVLN
Sbjct: 181 VIRYAFEYARTVGRPKVVVVHKSTIQRLADGLFVNVAQELGREYPDIELQTELLDNTVLN 240

Query: 241 VVTKPEAYKDVVAVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHQVSIFEAVHGSAPDI 300
           VVTKPEAYKDVVAVCPNLYGDI                  ANIGHQVSIFEAVHGSAPDI
Sbjct: 241 VVTKPEAYKDVVAVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHQVSIFEAVHGSAPDI 300

Query: 301 AGQNRANPTALLLSSVMMLNHMGLHEHAGRIEKAVLSTIASSRENRTADLAGTASTSSFT 360
           AGQNRANPTALLLSSVMMLNHMGLHEHAGRIEKAVLSTIASSRENRTADLAGTASTSSFT
Sbjct: 301 AGQNRANPTALLLSSVMMLNHMGLHEHAGRIEKAVLSTIASSRENRTADLAGTASTSSFT 360

Query: 361 NAVIERL 367
           NAVIERL
Sbjct: 361 NAVIERL 367

>Ecym_2313 Chr2 complement(610493..611605) [1113 bp, 370 aa] {ON}
           similar to Ashbya gossypii AFR137C
          Length = 370

 Score =  625 bits (1613), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/370 (82%), Positives = 328/370 (88%), Gaps = 3/370 (0%)

Query: 1   MLRQKLFQGSRRWLASV--RQPSIGRYAGKPN-AAGKYTVSFIEGDGVGPEISQSVKDIF 57
           M +Q +F+GSRR+LAS   +QPSIGR+ GKPN   GKYTVSFIEGDG+GPEISQSVKDIF
Sbjct: 1   MFKQSIFKGSRRYLASASRKQPSIGRFTGKPNPKTGKYTVSFIEGDGIGPEISQSVKDIF 60

Query: 58  SAASVPVEWEYCDVTPLLVNGLTTIPEPAVASINKNLVALKGPLATPIGKGHRSLNLTLR 117
           SAA VPVEWEYCDVTP+ +NGLTTIP+PAV SINKNLVALKGPLATPIGKGHRSLNLTLR
Sbjct: 61  SAAKVPVEWEYCDVTPIFINGLTTIPDPAVQSINKNLVALKGPLATPIGKGHRSLNLTLR 120

Query: 118 KTFGLFANVRPAKSIEGYKTTYSDVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITREA 177
           KTFGLFANVRPAKSIEG+KTTY +VDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITR+A
Sbjct: 121 KTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITRDA 180

Query: 178 SERVIRYAFEYARTVGRPKVVVVHKSTIQRLADGLFVNVAQELGREYPDIELQTELLDNT 237
           SERVIRYAFEYAR VGRPKVVVVHKSTIQRLADGLFVNVAQE+G+EYPDIELQ EL+DNT
Sbjct: 181 SERVIRYAFEYARAVGRPKVVVVHKSTIQRLADGLFVNVAQEVGKEYPDIELQPELIDNT 240

Query: 238 VLNVVTKPEAYKDVVAVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHQVSIFEAVHGSA 297
           VLNVV+KPE Y D VAVCPNLYGDI                  ANIGH VSIFEAVHGSA
Sbjct: 241 VLNVVSKPEKYSDSVAVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHTVSIFEAVHGSA 300

Query: 298 PDIAGQNRANPTALLLSSVMMLNHMGLHEHAGRIEKAVLSTIASSRENRTADLAGTASTS 357
           PDIAGQN ANPTALLLSSVMMLNHMGLHEHA +IE AVL+T+AS ++NRTADLAGTA+TS
Sbjct: 301 PDIAGQNCANPTALLLSSVMMLNHMGLHEHADQIESAVLATVASDKKNRTADLAGTATTS 360

Query: 358 SFTNAVIERL 367
           SFT AVIERL
Sbjct: 361 SFTKAVIERL 370

>SAKL0G03520g Chr7 (290768..291877) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 369

 Score =  600 bits (1547), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/369 (80%), Positives = 323/369 (87%), Gaps = 2/369 (0%)

Query: 1   MLR-QKLFQGSRRWLASVRQPSIGRYAGKPN-AAGKYTVSFIEGDGVGPEISQSVKDIFS 58
           MLR Q L Q  RR+L+S +QPSIGR+ GKPN + GKYTVSFIEGDGVGPEIS+SVKDIF+
Sbjct: 1   MLRSQVLRQLPRRFLSSKKQPSIGRFTGKPNPSTGKYTVSFIEGDGVGPEISKSVKDIFA 60

Query: 59  AASVPVEWEYCDVTPLLVNGLTTIPEPAVASINKNLVALKGPLATPIGKGHRSLNLTLRK 118
           AA VPVEWE CDVTPL +NGLTTIP+PAV SINKNL+ALKGPLATPIGKGHRSLNLTLRK
Sbjct: 61  AAEVPVEWESCDVTPLFINGLTTIPQPAVDSINKNLIALKGPLATPIGKGHRSLNLTLRK 120

Query: 119 TFGLFANVRPAKSIEGYKTTYSDVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITREAS 178
           TFGLFANVRPAKS+EG+KTTY +VDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITR+AS
Sbjct: 121 TFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITRDAS 180

Query: 179 ERVIRYAFEYARTVGRPKVVVVHKSTIQRLADGLFVNVAQELGREYPDIELQTELLDNTV 238
           ERVIRYAFEYAR VGRPKV+VVHKSTIQRLADGLFV+VA+EL  EYPDI+LQ +LLDNTV
Sbjct: 181 ERVIRYAFEYARAVGRPKVMVVHKSTIQRLADGLFVDVAKELSSEYPDIQLQLQLLDNTV 240

Query: 239 LNVVTKPEAYKDVVAVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHQVSIFEAVHGSAP 298
           LNVV+ P AY D V+VCPNLYGDI                  ANIGH+VSIFEAVHGSAP
Sbjct: 241 LNVVSNPGAYADTVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAP 300

Query: 299 DIAGQNRANPTALLLSSVMMLNHMGLHEHAGRIEKAVLSTIASSRENRTADLAGTASTSS 358
           DIAGQN+ANPTALLLSSVMMLNHMGL+E A  IEKAVLSTIAS  ENRTADLAG+ASTSS
Sbjct: 301 DIAGQNKANPTALLLSSVMMLNHMGLYEKADSIEKAVLSTIASGPENRTADLAGSASTSS 360

Query: 359 FTNAVIERL 367
           FT AVI+RL
Sbjct: 361 FTEAVIKRL 369

>KLLA0E03125g Chr5 (288825..289931) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 368

 Score =  593 bits (1529), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/368 (79%), Positives = 317/368 (86%), Gaps = 1/368 (0%)

Query: 1   MLRQKLFQGSRRWLASVRQPSIGRYAGKPN-AAGKYTVSFIEGDGVGPEISQSVKDIFSA 59
           M RQ + + S R+LA+ +QPSIGRY GKPN   GKYTVSFIEGDGVGPEIS+SVK IFSA
Sbjct: 1   MFRQSIVKQSCRFLATKKQPSIGRYTGKPNPKTGKYTVSFIEGDGVGPEISKSVKAIFSA 60

Query: 60  ASVPVEWEYCDVTPLLVNGLTTIPEPAVASINKNLVALKGPLATPIGKGHRSLNLTLRKT 119
           A VP+EWE CDV+P+ VNGLTTIP+PAVASINKNL+ALKGPLATPIGKGHRSLNLTLRKT
Sbjct: 61  AKVPIEWESCDVSPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNLTLRKT 120

Query: 120 FGLFANVRPAKSIEGYKTTYSDVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITREASE 179
           FGLFANVRPAKSIEGYKTTY +V+LVLIRENTEGEYSGIEHVV+PGVVQSIKLIT++ASE
Sbjct: 121 FGLFANVRPAKSIEGYKTTYENVNLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDASE 180

Query: 180 RVIRYAFEYARTVGRPKVVVVHKSTIQRLADGLFVNVAQELGREYPDIELQTELLDNTVL 239
           RVIRYAFEYAR V R KV+VVHKSTIQRLADGLFV+VA++L  EYPDIELQTELLDNTVL
Sbjct: 181 RVIRYAFEYARAVDRSKVLVVHKSTIQRLADGLFVDVAKKLSSEYPDIELQTELLDNTVL 240

Query: 240 NVVTKPEAYKDVVAVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHQVSIFEAVHGSAPD 299
             V  PEAY DVV VCPNLYGDI                  ANIGH VSIFEAVHGSAPD
Sbjct: 241 KTVQHPEAYDDVVVVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHTVSIFEAVHGSAPD 300

Query: 300 IAGQNRANPTALLLSSVMMLNHMGLHEHAGRIEKAVLSTIASSRENRTADLAGTASTSSF 359
           IAGQN+ANPTALLLSSVMMLNHMGL EHA +IEKAVL+TIAS  +NRT DL G+ASTSSF
Sbjct: 301 IAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSSF 360

Query: 360 TNAVIERL 367
           T+AVIERL
Sbjct: 361 TDAVIERL 368

>YOR136W Chr15 (580250..581359) [1110 bp, 369 aa] {ON}  IDH2Subunit
           of mitochondrial NAD(+)-dependent isocitrate
           dehydrogenase, which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle;
           phosphorylated
          Length = 369

 Score =  592 bits (1525), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/369 (77%), Positives = 320/369 (86%), Gaps = 2/369 (0%)

Query: 1   MLRQKLFQG-SRRWLASVRQPSIGRYAGKPN-AAGKYTVSFIEGDGVGPEISQSVKDIFS 58
           MLR   F+  SRR+LA+V+QPSIGRY GKPN + GKYTVSFIEGDG+GPEIS+SVK IFS
Sbjct: 1   MLRNTFFRNTSRRFLATVKQPSIGRYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKIFS 60

Query: 59  AASVPVEWEYCDVTPLLVNGLTTIPEPAVASINKNLVALKGPLATPIGKGHRSLNLTLRK 118
           AA+VP+EWE CDV+P+ VNGLTTIP+PAV SI KNLVALKGPLATPIGKGHRSLNLTLRK
Sbjct: 61  AANVPIEWESCDVSPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRK 120

Query: 119 TFGLFANVRPAKSIEGYKTTYSDVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITREAS 178
           TFGLFANVRPAKSIEG+KTTY +VDLVLIRENTEGEYSGIEH+V PGVVQSIKLITR+AS
Sbjct: 121 TFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDAS 180

Query: 179 ERVIRYAFEYARTVGRPKVVVVHKSTIQRLADGLFVNVAQELGREYPDIELQTELLDNTV 238
           ERVIRYAFEYAR +GRP+V+VVHKSTIQRLADGLFVNVA+EL +EYPD+ L+TEL+DN+V
Sbjct: 181 ERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDLTLETELIDNSV 240

Query: 239 LNVVTKPEAYKDVVAVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHQVSIFEAVHGSAP 298
           L VVT P AY D V+VCPNLYGDI                  ANIGH++SIFEAVHGSAP
Sbjct: 241 LKVVTNPSAYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFEAVHGSAP 300

Query: 299 DIAGQNRANPTALLLSSVMMLNHMGLHEHAGRIEKAVLSTIASSRENRTADLAGTASTSS 358
           DIAGQ++ANPTALLLSSVMMLNHMGL  HA +I+ AVLSTIAS  ENRT DLAGTA+TSS
Sbjct: 301 DIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSS 360

Query: 359 FTNAVIERL 367
           FT AVI+RL
Sbjct: 361 FTEAVIKRL 369

>Smik_15.316 Chr15 (541618..542727) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  585 bits (1509), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/369 (76%), Positives = 319/369 (86%), Gaps = 2/369 (0%)

Query: 1   MLRQKLFQG-SRRWLASVRQPSIGRYAGKPN-AAGKYTVSFIEGDGVGPEISQSVKDIFS 58
           MLR   F+  SRR+LA+V+QPSIG+Y GKPN + GKYTVSFIEGDG+GPEIS+SVK IFS
Sbjct: 1   MLRNTFFRNTSRRFLATVKQPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKIFS 60

Query: 59  AASVPVEWEYCDVTPLLVNGLTTIPEPAVASINKNLVALKGPLATPIGKGHRSLNLTLRK 118
           AA+VP+EWE+CDV P+ VNGLTTIP+PAV SI KNLVALKGPLATPIGKGHRSLNLTLRK
Sbjct: 61  AANVPIEWEFCDVNPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRK 120

Query: 119 TFGLFANVRPAKSIEGYKTTYSDVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITREAS 178
           TFGLFANVRPAKS+EG+KTTY +VDLVLIRENTEGEYSGIEH+V PGVVQSIKLITR+AS
Sbjct: 121 TFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDAS 180

Query: 179 ERVIRYAFEYARTVGRPKVVVVHKSTIQRLADGLFVNVAQELGREYPDIELQTELLDNTV 238
           ERVIRYAFEYAR +GRP+V+VVHKSTIQRLADGLFVNVA+EL +EYPDI L+TEL+DN+V
Sbjct: 181 ERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDITLETELIDNSV 240

Query: 239 LNVVTKPEAYKDVVAVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHQVSIFEAVHGSAP 298
           L VVT P AY + V+VCPNLYGDI                  ANIGH++SIFEAVHGSAP
Sbjct: 241 LKVVTNPSAYTNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFEAVHGSAP 300

Query: 299 DIAGQNRANPTALLLSSVMMLNHMGLHEHAGRIEKAVLSTIASSRENRTADLAGTASTSS 358
           DIAGQ++ANPTALLLSSVMMLNHMGL  +A +I+ AVLSTIAS  ENRT DLAG A+TSS
Sbjct: 301 DIAGQDKANPTALLLSSVMMLNHMGLTNYADQIQNAVLSTIASGPENRTGDLAGAATTSS 360

Query: 359 FTNAVIERL 367
           FT AVI+RL
Sbjct: 361 FTEAVIKRL 369

>KNAG0B04070 Chr2 complement(778658..779779) [1122 bp, 373 aa] {ON}
           Anc_5.473 YOR136W
          Length = 373

 Score =  584 bits (1506), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/373 (76%), Positives = 323/373 (86%), Gaps = 6/373 (1%)

Query: 1   MLRQKLFQGS---RRWLA-SVR-QPSIGRYAGKPN-AAGKYTVSFIEGDGVGPEISQSVK 54
           MLR  L + S   RR+LA SV+ QPSIGR+ GKPN A GK+ VSFIEGDG+GPEISQSVK
Sbjct: 1   MLRNSLLRNSFTARRFLATSVKNQPSIGRFTGKPNPATGKFDVSFIEGDGIGPEISQSVK 60

Query: 55  DIFSAASVPVEWEYCDVTPLLVNGLTTIPEPAVASINKNLVALKGPLATPIGKGHRSLNL 114
           DIF AA VP+ WE+CDVTP+ VNGLTTIP+PAVASINKNL+ALKGPLATPIGKGHRSLNL
Sbjct: 61  DIFKAAEVPINWEFCDVTPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNL 120

Query: 115 TLRKTFGLFANVRPAKSIEGYKTTYSDVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLIT 174
           TLRKTF LFANVRPAKSIEG+KTTYSDVDLVLIRENTEGEYSGIEHVV+PGVVQSIKLIT
Sbjct: 121 TLRKTFNLFANVRPAKSIEGFKTTYSDVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLIT 180

Query: 175 REASERVIRYAFEYARTVGRPKVVVVHKSTIQRLADGLFVNVAQELGREYPDIELQTELL 234
           R+ASERVIRYAFEYA+ +GRP+VVVVHKSTIQRLADGLFVNVA+EL +EYP+I+L+TEL+
Sbjct: 181 RDASERVIRYAFEYAKAIGRPRVVVVHKSTIQRLADGLFVNVAKELSKEYPEIKLETELI 240

Query: 235 DNTVLNVVTKPEAYKDVVAVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHQVSIFEAVH 294
           DNTVLNVV+ P  Y D V+VCPNLYGDI                  ANIG+++SIFEAVH
Sbjct: 241 DNTVLNVVSNPAGYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGNEISIFEAVH 300

Query: 295 GSAPDIAGQNRANPTALLLSSVMMLNHMGLHEHAGRIEKAVLSTIASSRENRTADLAGTA 354
           GSAPDIAGQN+ANPTALLLSSVMMLNHMGL + A RIE+AVL+TIASS +NRT DL G+A
Sbjct: 301 GSAPDIAGQNKANPTALLLSSVMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGGSA 360

Query: 355 STSSFTNAVIERL 367
           +TSSFT+AVI+ L
Sbjct: 361 TTSSFTDAVIKNL 373

>Suva_8.188 Chr8 (335409..336518) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  582 bits (1501), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/369 (76%), Positives = 316/369 (85%), Gaps = 2/369 (0%)

Query: 1   MLRQKLFQG-SRRWLASVRQPSIGRYAGKPN-AAGKYTVSFIEGDGVGPEISQSVKDIFS 58
           MLR    +  SRR+L++V+QPSIGRY GKP+ + G+YTVSFIEGDG+GPEIS+SVK IFS
Sbjct: 1   MLRNTFLRNTSRRFLSTVKQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVKKIFS 60

Query: 59  AASVPVEWEYCDVTPLLVNGLTTIPEPAVASINKNLVALKGPLATPIGKGHRSLNLTLRK 118
           AA VP+ WE+CDV P+ VNGLTTIP+PAV SI KNLVALKGPLATPIGKGHRSLNLTLRK
Sbjct: 61  AADVPINWEFCDVNPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNLTLRK 120

Query: 119 TFGLFANVRPAKSIEGYKTTYSDVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITREAS 178
           TFGLFANVRPAKSIEG+KTTY +VDLVLIRENTEGEYSGIEH+V PGVVQSIKLITREAS
Sbjct: 121 TFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITREAS 180

Query: 179 ERVIRYAFEYARTVGRPKVVVVHKSTIQRLADGLFVNVAQELGREYPDIELQTELLDNTV 238
           ERVIRYAFEYAR +GRP+++VVHKSTIQRLADGLFVNVA+EL +EYPDI  +TEL+DN V
Sbjct: 181 ERVIRYAFEYARAIGRPRIIVVHKSTIQRLADGLFVNVAKELSKEYPDITFETELIDNKV 240

Query: 239 LNVVTKPEAYKDVVAVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHQVSIFEAVHGSAP 298
           LNVVT P AY + V+VCPNLYGDI                  ANIGH+VSIFEAVHGSAP
Sbjct: 241 LNVVTNPSAYTNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAP 300

Query: 299 DIAGQNRANPTALLLSSVMMLNHMGLHEHAGRIEKAVLSTIASSRENRTADLAGTASTSS 358
           DIAG+++ANPTALLLSSVMMLNHMGL  HA +I+ AVLSTIAS  ENRT DLAGTA+TSS
Sbjct: 301 DIAGKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATTSS 360

Query: 359 FTNAVIERL 367
           FT AVI+RL
Sbjct: 361 FTEAVIKRL 369

>Skud_15.300 Chr15 (534346..535455) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  580 bits (1495), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/369 (75%), Positives = 318/369 (86%), Gaps = 2/369 (0%)

Query: 1   MLRQKLFQG-SRRWLASVRQPSIGRYAGKPN-AAGKYTVSFIEGDGVGPEISQSVKDIFS 58
           MLR  LF+  SRR+LA+V+QPSIGR+ GKPN + G+YTVSFIEGDG+GPEIS+SVK IF+
Sbjct: 1   MLRSNLFRNTSRRFLATVKQPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVKKIFN 60

Query: 59  AASVPVEWEYCDVTPLLVNGLTTIPEPAVASINKNLVALKGPLATPIGKGHRSLNLTLRK 118
           AA+VP+EWE CDV P+ VNGLTTIP+ AV SI  NL+ALKGPLATPIGKGHRSLNLTLRK
Sbjct: 61  AANVPIEWESCDVNPIFVNGLTTIPDAAVQSITNNLIALKGPLATPIGKGHRSLNLTLRK 120

Query: 119 TFGLFANVRPAKSIEGYKTTYSDVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITREAS 178
           TFGLFANVRPAKS+EG+KTTY +VDLVLIRENTEGEYSGIEH+V PGVVQSIKLITR+AS
Sbjct: 121 TFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLITRDAS 180

Query: 179 ERVIRYAFEYARTVGRPKVVVVHKSTIQRLADGLFVNVAQELGREYPDIELQTELLDNTV 238
           ERVIRYAFEYAR +GRP+V+VVHKSTIQRLADGLFVNVA+EL +EYPDI L+TEL+DN+V
Sbjct: 181 ERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDIILETELIDNSV 240

Query: 239 LNVVTKPEAYKDVVAVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHQVSIFEAVHGSAP 298
           L VVT P AY + V+VCPNLYGDI                  ANIGH++SIFEAVHGSAP
Sbjct: 241 LKVVTNPSAYTNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFEAVHGSAP 300

Query: 299 DIAGQNRANPTALLLSSVMMLNHMGLHEHAGRIEKAVLSTIASSRENRTADLAGTASTSS 358
           DIAGQ++ANPTALLLSSVMMLNHMGL  HA +I+ AVLSTIAS  ENRT DLAGTA+TSS
Sbjct: 301 DIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSS 360

Query: 359 FTNAVIERL 367
           FT AVI+RL
Sbjct: 361 FTEAVIKRL 369

>Kwal_55.21273 s55 complement(762121..763227) [1107 bp, 368 aa] {ON}
           YOR136W (IDH2) - NAD+-dependent isocitrate dehydrogenase
           [contig 130] FULL
          Length = 368

 Score =  578 bits (1489), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/368 (76%), Positives = 312/368 (84%), Gaps = 1/368 (0%)

Query: 1   MLRQKLFQGSRRWLASVRQPSIGRYAGKPN-AAGKYTVSFIEGDGVGPEISQSVKDIFSA 59
           M R +  + + R+ A+ +QPSIGRY GKP+ A GKYTVSFIEGDGVGPEIS++VKDIF+A
Sbjct: 1   MFRSQFGRNTLRFFATKKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDIFAA 60

Query: 60  ASVPVEWEYCDVTPLLVNGLTTIPEPAVASINKNLVALKGPLATPIGKGHRSLNLTLRKT 119
           A  P++WE CDVTPL +NGLTTIP+PA  SINKNL+ALKGPLATPIGKGHRSLNLTLRKT
Sbjct: 61  AKAPIQWETCDVTPLFINGLTTIPQPAQDSINKNLIALKGPLATPIGKGHRSLNLTLRKT 120

Query: 120 FGLFANVRPAKSIEGYKTTYSDVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITREASE 179
           FGLFANVRPAKSI+G+KT Y +VDLVLIRENTEGEYSGIEHVV+PGVVQSIKLIT++ASE
Sbjct: 121 FGLFANVRPAKSIQGFKTAYDNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDASE 180

Query: 180 RVIRYAFEYARTVGRPKVVVVHKSTIQRLADGLFVNVAQELGREYPDIELQTELLDNTVL 239
           RVIRYAFEYAR V RPKV+VVHKSTIQRLADGLFV+VA++L +EYPDIELQTEL+DNTVL
Sbjct: 181 RVIRYAFEYARAVERPKVLVVHKSTIQRLADGLFVSVAEKLAKEYPDIELQTELIDNTVL 240

Query: 240 NVVTKPEAYKDVVAVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHQVSIFEAVHGSAPD 299
           + V  P  Y DVV VCPNLYGDI                  ANIGH+VSIFEAVHGSAPD
Sbjct: 241 HTVRDPLKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAPD 300

Query: 300 IAGQNRANPTALLLSSVMMLNHMGLHEHAGRIEKAVLSTIASSRENRTADLAGTASTSSF 359
           IAGQN+ANPTALLLSSVMMLNHMGL EHA +IEKAV STIAS  ENRT DLAG+ASTSSF
Sbjct: 301 IAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVFSTIASGPENRTGDLAGSASTSSF 360

Query: 360 TNAVIERL 367
             AVI RL
Sbjct: 361 AEAVISRL 368

>KLTH0F15048g Chr6 complement(1232566..1233672) [1107 bp, 368 aa]
           {ON} highly similar to uniprot|P28241 Saccharomyces
           cerevisiae YOR136W IDH2 Subunit of mitochondrial NAD( )-
           dependent isocitrate dehydrogenase which catalyzes the
           oxidation of isocitrate to alpha-ketoglutarate in the
           TCA cycle
          Length = 368

 Score =  577 bits (1487), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/368 (75%), Positives = 311/368 (84%), Gaps = 1/368 (0%)

Query: 1   MLRQKLFQGSRRWLASVRQPSIGRYAGKPN-AAGKYTVSFIEGDGVGPEISQSVKDIFSA 59
           M +    + S R+LA+ +QPSIGRY GKP+ A GKYTVSFIEGDGVGPEIS++VKDIF+A
Sbjct: 1   MFKSSFVRNSARFLATKKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDIFAA 60

Query: 60  ASVPVEWEYCDVTPLLVNGLTTIPEPAVASINKNLVALKGPLATPIGKGHRSLNLTLRKT 119
           A  P++WE CDV+PL +NGLTTIP+PA  SINKNL+ALKGPLATPIGKGHRSLNLTLRKT
Sbjct: 61  AKAPIQWESCDVSPLFINGLTTIPQPAQDSINKNLIALKGPLATPIGKGHRSLNLTLRKT 120

Query: 120 FGLFANVRPAKSIEGYKTTYSDVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITREASE 179
           FGLFANVRPAKS++GYKT Y +VDLVLIRENTEGEYSGIEHVVSPGVVQSIKLIT++ASE
Sbjct: 121 FGLFANVRPAKSVQGYKTAYDNVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITQDASE 180

Query: 180 RVIRYAFEYARTVGRPKVVVVHKSTIQRLADGLFVNVAQELGREYPDIELQTELLDNTVL 239
           RVIRYAFEYAR V RPKVVVVHKSTIQRLADGLFV+VA++L +EYPDIELQTEL+DNTVL
Sbjct: 181 RVIRYAFEYARAVERPKVVVVHKSTIQRLADGLFVSVAEQLSKEYPDIELQTELIDNTVL 240

Query: 240 NVVTKPEAYKDVVAVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHQVSIFEAVHGSAPD 299
           + V  P  Y DVV VCPNLYGDI                  ANIGH+VSIFEAVHGSAPD
Sbjct: 241 HTVRDPTKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAPD 300

Query: 300 IAGQNRANPTALLLSSVMMLNHMGLHEHAGRIEKAVLSTIASSRENRTADLAGTASTSSF 359
           IAGQN+ANPTALLLSSVMMLNHMGL EHA +IEKAV +TIA+  E+RT DL G+ASTSSF
Sbjct: 301 IAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVFTTIAAGPESRTGDLGGSASTSSF 360

Query: 360 TNAVIERL 367
             AVI RL
Sbjct: 361 AEAVISRL 368

>NDAI0C01410 Chr3 complement(295178..296287) [1110 bp, 369 aa] {ON}
           Anc_5.473
          Length = 369

 Score =  575 bits (1482), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/369 (75%), Positives = 317/369 (85%), Gaps = 2/369 (0%)

Query: 1   MLRQKLFQGS-RRWLASVRQPSIGRYAGKPN-AAGKYTVSFIEGDGVGPEISQSVKDIFS 58
           M R  + + + RR+L+   QPSIG++ GKPN + GK+TVSFIEGDG+GPEISQSVK IF 
Sbjct: 1   MFRNIILRNTTRRFLSVKNQPSIGKFTGKPNPSTGKFTVSFIEGDGIGPEISQSVKQIFD 60

Query: 59  AASVPVEWEYCDVTPLLVNGLTTIPEPAVASINKNLVALKGPLATPIGKGHRSLNLTLRK 118
           AA VP++WE CDV+PL +NGLTTIPEPAV SINKNLVALKGPLATPIGKGHRSLNLTLRK
Sbjct: 61  AAKVPIDWEPCDVSPLFINGLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRK 120

Query: 119 TFGLFANVRPAKSIEGYKTTYSDVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITREAS 178
           TFGLFANVRPAKSIEG+KT Y +VDLV+IRENTEGEYSGIEHVV+PGVVQSIKLITR+AS
Sbjct: 121 TFGLFANVRPAKSIEGFKTIYDNVDLVIIRENTEGEYSGIEHVVTPGVVQSIKLITRDAS 180

Query: 179 ERVIRYAFEYARTVGRPKVVVVHKSTIQRLADGLFVNVAQELGREYPDIELQTELLDNTV 238
           ERVIRYA+EYAR +GRP+V+VVHKSTIQRLADGLFV+VA+EL +EYPDI+L+TEL+DNTV
Sbjct: 181 ERVIRYAYEYARAIGRPRVIVVHKSTIQRLADGLFVDVAKELSQEYPDIQLETELIDNTV 240

Query: 239 LNVVTKPEAYKDVVAVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHQVSIFEAVHGSAP 298
           LNVV+ P +Y + V+VCPNLYGDI                  ANIGH+VSIFEAVHGSAP
Sbjct: 241 LNVVSNPSSYSNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAP 300

Query: 299 DIAGQNRANPTALLLSSVMMLNHMGLHEHAGRIEKAVLSTIASSRENRTADLAGTASTSS 358
           DIAGQN+ANPTALLLSSVMMLNHMGL+ HA +IEKAVLSTIAS  E RT DLAG A+TSS
Sbjct: 301 DIAGQNKANPTALLLSSVMMLNHMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKATTSS 360

Query: 359 FTNAVIERL 367
           FT+AVI RL
Sbjct: 361 FTDAVIGRL 369

>Kpol_440.12 s440 (32084..33190) [1107 bp, 368 aa] {ON}
           (32084..33190) [1107 nt, 369 aa]
          Length = 368

 Score =  573 bits (1476), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/368 (75%), Positives = 312/368 (84%), Gaps = 1/368 (0%)

Query: 1   MLRQKLFQGSRRWLASVRQPSIGRYAGKPN-AAGKYTVSFIEGDGVGPEISQSVKDIFSA 59
           MLR  +++GS   + +  QP+IGR+ GKPN   GKYTV FIEGDGVGPEIS+SVKDIF+A
Sbjct: 1   MLRNTIYRGSFARMMTTGQPNIGRFTGKPNPVTGKYTVPFIEGDGVGPEISKSVKDIFAA 60

Query: 60  ASVPVEWEYCDVTPLLVNGLTTIPEPAVASINKNLVALKGPLATPIGKGHRSLNLTLRKT 119
           A VP+EWE CDV P+ VNGLTTIP+ AV SINK+LVALKGPLATPIGKGHRSLNLTLRKT
Sbjct: 61  AKVPIEWEPCDVGPIFVNGLTTIPDAAVQSINKHLVALKGPLATPIGKGHRSLNLTLRKT 120

Query: 120 FGLFANVRPAKSIEGYKTTYSDVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITREASE 179
           F LFANVRPA+S+  YKTTY +VDLVLIRENTEGEYSGIEHV+SPGV+QSIKLIT++ASE
Sbjct: 121 FNLFANVRPARSVPNYKTTYQNVDLVLIRENTEGEYSGIEHVISPGVIQSIKLITKDASE 180

Query: 180 RVIRYAFEYARTVGRPKVVVVHKSTIQRLADGLFVNVAQELGREYPDIELQTELLDNTVL 239
           RVIRYAFEY R +GRP++VVVHKSTIQR+ADGLFVNVA+EL  EYPDIELQTEL+DNT+L
Sbjct: 181 RVIRYAFEYTRAIGRPRLVVVHKSTIQRMADGLFVNVAKELASEYPDIELQTELIDNTIL 240

Query: 240 NVVTKPEAYKDVVAVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHQVSIFEAVHGSAPD 299
           NVVT PE+Y D V+VCPNLYGDI                  ANIG +VSIFEAVHGSAPD
Sbjct: 241 NVVTHPESYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGSAPD 300

Query: 300 IAGQNRANPTALLLSSVMMLNHMGLHEHAGRIEKAVLSTIASSRENRTADLAGTASTSSF 359
           IAGQN+ANPTALLLSSVMMLNHMGL+EHA +IE A+LSTIAS  ENRT DLAGTA+TSSF
Sbjct: 301 IAGQNKANPTALLLSSVMMLNHMGLNEHATKIENAILSTIASGSENRTGDLAGTATTSSF 360

Query: 360 TNAVIERL 367
           T AVI +L
Sbjct: 361 TEAVINKL 368

>CAGL0I07227g Chr9 complement(696605..697711) [1107 bp, 368 aa] {ON}
           highly similar to uniprot|P28241 Saccharomyces
           cerevisiae YOR136w IDH2 isocitrate dehydrogenase
          Length = 368

 Score =  571 bits (1471), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/369 (75%), Positives = 315/369 (85%), Gaps = 3/369 (0%)

Query: 1   MLRQKLFQ-GSRRWLASVRQPSIGRYAGKPN-AAGKYTVSFIEGDGVGPEISQSVKDIFS 58
           ML  + F+  +RR+LA+  QPSIGR+ GKPN + GK+TVSFIEGDG+GPEIS SVK IF 
Sbjct: 1   MLGIRSFRLNARRFLATA-QPSIGRFTGKPNPSTGKFTVSFIEGDGIGPEISSSVKRIFQ 59

Query: 59  AASVPVEWEYCDVTPLLVNGLTTIPEPAVASINKNLVALKGPLATPIGKGHRSLNLTLRK 118
           AA VPVEWE CDVTP+ VNGLTTIP+PAV SINKNLVALKGPLATPIGKGHRSLNLTLRK
Sbjct: 60  AADVPVEWETCDVTPIFVNGLTTIPDPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRK 119

Query: 119 TFGLFANVRPAKSIEGYKTTYSDVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITREAS 178
           TF LFANVRPAKSIEG+KTTY +VDLVLIRENTEGEYSGIEH+VSPGVVQSIKLITR+AS
Sbjct: 120 TFNLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHLVSPGVVQSIKLITRDAS 179

Query: 179 ERVIRYAFEYARTVGRPKVVVVHKSTIQRLADGLFVNVAQELGREYPDIELQTELLDNTV 238
           ERVIRYA+EYAR +GRP+++VVHKSTIQRLADGLFVNVA+EL  EYPDI+L+TEL+DNT 
Sbjct: 180 ERVIRYAYEYARAIGRPRLIVVHKSTIQRLADGLFVNVAKELAAEYPDIQLETELIDNTC 239

Query: 239 LNVVTKPEAYKDVVAVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHQVSIFEAVHGSAP 298
           LNVV+ P +Y D V+VCPNLYGDI                  ANIGH+VSIFEAVHGSAP
Sbjct: 240 LNVVSNPSSYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAP 299

Query: 299 DIAGQNRANPTALLLSSVMMLNHMGLHEHAGRIEKAVLSTIASSRENRTADLAGTASTSS 358
           DIAGQN+ANPTALLLSSVMMLNHMG+ EHA RIEKAVL TIA   E RT DL G+AST+S
Sbjct: 300 DIAGQNKANPTALLLSSVMMLNHMGMTEHADRIEKAVLGTIAGGSEYRTGDLGGSASTTS 359

Query: 359 FTNAVIERL 367
           FT+A+I++L
Sbjct: 360 FTDAIIKKL 368

>TDEL0A03370 Chr1 (599855..600970) [1116 bp, 371 aa] {ON} Anc_5.473
           YOR136W
          Length = 371

 Score =  570 bits (1470), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/371 (76%), Positives = 314/371 (84%), Gaps = 4/371 (1%)

Query: 1   MLRQKLFQGS-RRWLASV--RQPSIGRYAGKPN-AAGKYTVSFIEGDGVGPEISQSVKDI 56
           MLR ++ + +  R LAS   +QPSIG+Y GKP+   GKYTVSFIEGDGVGPEIS+SVKDI
Sbjct: 1   MLRSQICRRTVNRMLASATHKQPSIGKYTGKPDPKTGKYTVSFIEGDGVGPEISKSVKDI 60

Query: 57  FSAASVPVEWEYCDVTPLLVNGLTTIPEPAVASINKNLVALKGPLATPIGKGHRSLNLTL 116
           F+AA VP+ WE C VTPLLVNG+TTIPE A  SIN+NLVALKGPLATPIGKGHRS+NLTL
Sbjct: 61  FAAAKVPIVWESCPVTPLLVNGVTTIPEQAQESINRNLVALKGPLATPIGKGHRSMNLTL 120

Query: 117 RKTFGLFANVRPAKSIEGYKTTYSDVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITRE 176
           RKTFGLFANVRPAKS+EG+KTTY DVDLVLIRENTEGEY+GIEHV+ PGVVQSIKLITRE
Sbjct: 121 RKTFGLFANVRPAKSVEGFKTTYEDVDLVLIRENTEGEYAGIEHVIVPGVVQSIKLITRE 180

Query: 177 ASERVIRYAFEYARTVGRPKVVVVHKSTIQRLADGLFVNVAQELGREYPDIELQTELLDN 236
           ASERVIRYA+EYAR VGRPK+VVVHKSTIQRLADGLFV VA+EL  E+PDI+LQTEL+DN
Sbjct: 181 ASERVIRYAYEYARAVGRPKLVVVHKSTIQRLADGLFVTVAKELAHEFPDIQLQTELIDN 240

Query: 237 TVLNVVTKPEAYKDVVAVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHQVSIFEAVHGS 296
           TVLNVV+ P  Y DVV VCPNLYGDI                   NIGH+VSIFEAVHGS
Sbjct: 241 TVLNVVSNPSKYSDVVYVCPNLYGDILSDLNSGLSAGSLGLTPSGNIGHKVSIFEAVHGS 300

Query: 297 APDIAGQNRANPTALLLSSVMMLNHMGLHEHAGRIEKAVLSTIASSRENRTADLAGTAST 356
           APDIAGQN+ANPTALLLSSVMMLNHMGL EHA +IEKAVL+TIA+  E+RT DLAG+AST
Sbjct: 301 APDIAGQNKANPTALLLSSVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSAST 360

Query: 357 SSFTNAVIERL 367
           SSFT AVI RL
Sbjct: 361 SSFTEAVISRL 371

>NCAS0H02250 Chr8 (441692..442960) [1269 bp, 422 aa] {ON} Anc_5.473
          Length = 422

 Score =  569 bits (1467), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/369 (74%), Positives = 315/369 (85%), Gaps = 2/369 (0%)

Query: 1   MLRQKLFQGSRRWLASVR-QPSIGRYAGKPN-AAGKYTVSFIEGDGVGPEISQSVKDIFS 58
           M R  + + + R L SV+ QPSIG+Y GKPN + GKYTVSFIEGDG+GPEIS SVK IFS
Sbjct: 54  MFRSSILRTTTRRLLSVKHQPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISNSVKQIFS 113

Query: 59  AASVPVEWEYCDVTPLLVNGLTTIPEPAVASINKNLVALKGPLATPIGKGHRSLNLTLRK 118
           AA VP+EWE CDVTPL ++GLTTIPEPAV SINKNLVALKGPLATPIGKGHRSLNLTLRK
Sbjct: 114 AAKVPIEWETCDVTPLFIDGLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNLTLRK 173

Query: 119 TFGLFANVRPAKSIEGYKTTYSDVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITREAS 178
           TFGLFANVRPA+S++G+KTTY +VDLVLIRENTEGEYSGIEHVV+PGVVQSIKLITREAS
Sbjct: 174 TFGLFANVRPARSVKGFKTTYPNVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLITREAS 233

Query: 179 ERVIRYAFEYARTVGRPKVVVVHKSTIQRLADGLFVNVAQELGREYPDIELQTELLDNTV 238
           ERVIRYAFEY R +GRP++VVVHKSTIQRL+DGLFVNVA+EL +EYPDI+ +TEL+DNTV
Sbjct: 234 ERVIRYAFEYCRAIGRPRLVVVHKSTIQRLSDGLFVNVAKELSKEYPDIQFETELIDNTV 293

Query: 239 LNVVTKPEAYKDVVAVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHQVSIFEAVHGSAP 298
           L VV+ P +Y D V+VCPNLYGDI                   NIG+++SIFEAVHGSAP
Sbjct: 294 LKVVSNPSSYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSGNIGNEISIFEAVHGSAP 353

Query: 299 DIAGQNRANPTALLLSSVMMLNHMGLHEHAGRIEKAVLSTIASSRENRTADLAGTASTSS 358
           DIAG+N ANPTALLLSSVMMLNHMGL +HA +IE AVLSTIAS  E+RT DLAGTA+TS+
Sbjct: 354 DIAGKNMANPTALLLSSVMMLNHMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTST 413

Query: 359 FTNAVIERL 367
           FT+AVI++L
Sbjct: 414 FTDAVIKKL 422

>KAFR0B06370 Chr2 complement(1317952..1319088) [1137 bp, 378 aa]
           {ON} Anc_5.473 YOR136W
          Length = 378

 Score =  548 bits (1412), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/378 (71%), Positives = 312/378 (82%), Gaps = 11/378 (2%)

Query: 1   MLRQKLFQGSR------RWLA--SVRQPSIGRYAGKPN-AAGKYTVSFIEGDGVGPEISQ 51
           MLRQ +   +R      R+L+  + RQPSIGR+ GKP+ A GKYTVSFIEGDG+GPEIS+
Sbjct: 1   MLRQAMLGRARYTIPTKRFLSMQAPRQPSIGRFTGKPDHATGKYTVSFIEGDGIGPEISR 60

Query: 52  SVKDIFSAASVPVEWEYCDVTPLLVNGLTTIPEPAVASINKNLVALKGPLATPIGKGHRS 111
           SVKDIF AASVP+ WE CDV+P+LV+GLTTIP+ AV SINKNLV LKGPLATPIGKGHRS
Sbjct: 61  SVKDIFQAASVPITWETCDVSPILVDGLTTIPDEAVKSINKNLVGLKGPLATPIGKGHRS 120

Query: 112 LNLTLRKTFGLFANVRPAKSIEGYKTTYSDVDLVLIRENTEGEYSGIEHVVSPGVVQSIK 171
           LNLTLRKTF LFANVRPAKS+ G+KTTY +VDLVLIRENTEGEYSGIEHVV+PGVVQSIK
Sbjct: 121 LNLTLRKTFNLFANVRPAKSVRGFKTTYDNVDLVLIRENTEGEYSGIEHVVTPGVVQSIK 180

Query: 172 LITREASERVIRYAFEYARTVGRPKVVVVHKSTIQRLADGLFVNVAQELGRE--YPDIEL 229
           LITR+ASERVIRYAFEYA+ +GRPKV+VVHKSTIQRL+DGLFVNVA+EL +E  + +IEL
Sbjct: 181 LITRDASERVIRYAFEYAKAIGRPKVIVVHKSTIQRLSDGLFVNVAKELQKEKNFQNIEL 240

Query: 230 QTELLDNTVLNVVTKPEAYKDVVAVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHQVSI 289
            TEL+DNTVLNVV  P  Y D V VCPNLYGDI                  ANIG ++SI
Sbjct: 241 DTELIDNTVLNVVMNPSKYSDAVFVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKISI 300

Query: 290 FEAVHGSAPDIAGQNRANPTALLLSSVMMLNHMGLHEHAGRIEKAVLSTIASSRENRTAD 349
           FEAVHGSAPDIAGQN+ANPTALLLSSVMML+HMGL+E+  +IE AVL TIA+S +NRT D
Sbjct: 301 FEAVHGSAPDIAGQNKANPTALLLSSVMMLHHMGLNEYGDKIENAVLKTIAASSKNRTGD 360

Query: 350 LAGTASTSSFTNAVIERL 367
           L GTA+T+SFT AVI+ L
Sbjct: 361 LGGTATTTSFTEAVIDNL 378

>Kpol_543.8 s543 (21411..22517) [1107 bp, 368 aa] {ON}
           (21411..22517) [1107 nt, 369 aa]
          Length = 368

 Score =  542 bits (1397), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/357 (73%), Positives = 301/357 (84%), Gaps = 2/357 (0%)

Query: 12  RWLASVRQPSIGRYAGKPN-AAGKYTVSFIEGDGVGPEISQSVKDIFSAASVPVEWEYCD 70
           R+L S  QPSIGR+ GKP+ A GK+TV FIEGDGVGPEIS+SVK IFSAA VP+EW  CD
Sbjct: 13  RFL-STGQPSIGRFTGKPDPATGKFTVPFIEGDGVGPEISESVKKIFSAAKVPIEWVPCD 71

Query: 71  VTPLLVNGLTTIPEPAVASINKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPAK 130
           V P+ VNG TTIPEPAV  INK+L+ALKGPLATPIGKGHRSLNLTLRKTF LFANVRPA+
Sbjct: 72  VGPIFVNGQTTIPEPAVELINKHLIALKGPLATPIGKGHRSLNLTLRKTFNLFANVRPAR 131

Query: 131 SIEGYKTTYSDVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITREASERVIRYAFEYAR 190
           SI  YK+TY +VDLVLIRENTEGEYSGIEHV++PGV+QSIKLITREA+ERV+RYAFEY +
Sbjct: 132 SIPNYKSTYENVDLVLIRENTEGEYSGIEHVITPGVIQSIKLITREATERVVRYAFEYTQ 191

Query: 191 TVGRPKVVVVHKSTIQRLADGLFVNVAQELGREYPDIELQTELLDNTVLNVVTKPEAYKD 250
            +GRP+++V+HKSTIQR+ADGLFV VA+EL  EYPDI+L+TE++D ++LNVV+KPE Y D
Sbjct: 192 AIGRPRLLVIHKSTIQRMADGLFVKVAEELASEYPDIKLETEIIDKSILNVVSKPELYSD 251

Query: 251 VVAVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHQVSIFEAVHGSAPDIAGQNRANPTA 310
            V+VCPNLYGDI                  ANIG +VSIFEAVHGSAPDIAGQN+ANPTA
Sbjct: 252 AVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGSAPDIAGQNKANPTA 311

Query: 311 LLLSSVMMLNHMGLHEHAGRIEKAVLSTIASSRENRTADLAGTASTSSFTNAVIERL 367
           LLLSSVMML HMGL EHA +IE AVL+TIAS  ENRTADL+GTASTSSFT  VI+RL
Sbjct: 312 LLLSSVMMLKHMGLDEHANKIENAVLTTIASGSENRTADLSGTASTSSFTEEVIQRL 368

>TBLA0B02240 Chr2 complement(524111..525232) [1122 bp, 373 aa] {ON}
           Anc_5.473 YOR136W
          Length = 373

 Score =  542 bits (1396), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/373 (71%), Positives = 306/373 (82%), Gaps = 6/373 (1%)

Query: 1   MLRQKLFQGSRRWLASVRQP-----SIGRYAGKPN-AAGKYTVSFIEGDGVGPEISQSVK 54
           MLR    + S R L S          +G+Y G PN + G++TV FIEGDGVGPEIS+SVK
Sbjct: 1   MLRTIAAKQSARRLFSTSSTLRVSGQVGKYKGSPNPSTGRFTVPFIEGDGVGPEISKSVK 60

Query: 55  DIFSAASVPVEWEYCDVTPLLVNGLTTIPEPAVASINKNLVALKGPLATPIGKGHRSLNL 114
           DIF AA VPV+WEYCDV+PLL+NGLTTIPEPAV  INK+ +ALKGPLATPIGKGHRSLNL
Sbjct: 61  DIFKAAQVPVDWEYCDVSPLLINGLTTIPEPAVQQINKHKIALKGPLATPIGKGHRSLNL 120

Query: 115 TLRKTFGLFANVRPAKSIEGYKTTYSDVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLIT 174
           TLRKTFGLFANVRPA+SI GY+TTY +VDLVLIRENTEGEYSGIEHVV+PGVVQSIKLIT
Sbjct: 121 TLRKTFGLFANVRPARSIRGYETTYKNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLIT 180

Query: 175 REASERVIRYAFEYARTVGRPKVVVVHKSTIQRLADGLFVNVAQELGREYPDIELQTELL 234
           R+ASERVIRYA+EYAR +GRP++VVVHKSTIQ+LADGLFVN+A+EL  E+PDI+L+TEL+
Sbjct: 181 RDASERVIRYAYEYARAIGRPRLVVVHKSTIQKLADGLFVNIAKELAPEFPDIKLETELI 240

Query: 235 DNTVLNVVTKPEAYKDVVAVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHQVSIFEAVH 294
           DNTVLNVV  P +Y D V VCPNLYGDI                  ANIG++VSIFEAVH
Sbjct: 241 DNTVLNVVRDPPSYTDAVTVCPNLYGDILSDLNSGLSAGSLGLTPSANIGNEVSIFEAVH 300

Query: 295 GSAPDIAGQNRANPTALLLSSVMMLNHMGLHEHAGRIEKAVLSTIASSRENRTADLAGTA 354
           GSAPDIAGQN+ANPTALLLSS MMLN+MGL  ++ +IE A+L+TIAS  ENRT DLAGTA
Sbjct: 301 GSAPDIAGQNKANPTALLLSSCMMLNYMGLESYSNKIENAILNTIASGSENRTGDLAGTA 360

Query: 355 STSSFTNAVIERL 367
           +TSSFT +VI+ L
Sbjct: 361 TTSSFTESVIKNL 373

>TPHA0J02770 Chr10 (617727..618857) [1131 bp, 376 aa] {ON} Anc_2.278
           YNL037C
          Length = 376

 Score =  542 bits (1396), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/359 (72%), Positives = 302/359 (84%), Gaps = 2/359 (0%)

Query: 9   GSRRWLASVRQPSIGRYAGKPNAAGKYTVSFIEGDGVGPEISQSVKDIFSAASVPVEWEY 68
           GS R +++  QP+IGR+ GK N++G YTV FIEGDGVGPEIS+SVKDIFSAA+VP++W+ 
Sbjct: 20  GSTRSISN--QPTIGRFTGKTNSSGTYTVPFIEGDGVGPEISKSVKDIFSAANVPIQWQP 77

Query: 69  CDVTPLLVNGLTTIPEPAVASINKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRP 128
           CDV P+ VNGLTTIPEPAV +I ++LVALKGPLATP+GKGHRSLNLTLRKTF LFANVRP
Sbjct: 78  CDVGPIFVNGLTTIPEPAVKAIKESLVALKGPLATPVGKGHRSLNLTLRKTFDLFANVRP 137

Query: 129 AKSIEGYKTTYSDVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITREASERVIRYAFEY 188
           AKS+  YK+TY +VDLVLIRENTEGEYSGIEH+V+PGVVQSIKLITREASE+VIRYA+EY
Sbjct: 138 AKSVPNYKSTYENVDLVLIRENTEGEYSGIEHIVTPGVVQSIKLITREASEKVIRYAYEY 197

Query: 189 ARTVGRPKVVVVHKSTIQRLADGLFVNVAQELGREYPDIELQTELLDNTVLNVVTKPEAY 248
           A  VGRP+++VVHKSTIQRL DGLFV +A EL  EYP I+L+T++LDNTVLNVV+ P  Y
Sbjct: 198 AIAVGRPRLIVVHKSTIQRLGDGLFVQIANELQSEYPSIKLETQILDNTVLNVVSNPTLY 257

Query: 249 KDVVAVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHQVSIFEAVHGSAPDIAGQNRANP 308
           KD V+VCPNLYGDI                  ANIG +VSIFEAVHGSAPDIAGQN+ANP
Sbjct: 258 KDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGSAPDIAGQNKANP 317

Query: 309 TALLLSSVMMLNHMGLHEHAGRIEKAVLSTIASSRENRTADLAGTASTSSFTNAVIERL 367
           TALLLSSVMMLNHMGL EHA RIE AVLSTIAS  E+RT DL G+A+TSSFT  VI++L
Sbjct: 318 TALLLSSVMMLNHMGLEEHASRIENAVLSTIASGPESRTGDLGGSATTSSFTECVIKKL 376

>ZYRO0D11220g Chr4 (946652..947758) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 368

 Score =  524 bits (1350), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 251/368 (68%), Positives = 303/368 (82%), Gaps = 1/368 (0%)

Query: 1   MLRQKLFQGSRRWLASVRQPSIGRYAGKPN-AAGKYTVSFIEGDGVGPEISQSVKDIFSA 59
           M + ++ + +   + S +QPSIG++ GKP+   G Y VSFIEGDG+GPEIS+SVKDIF+A
Sbjct: 1   MFKSQVCRRAVARMFSSKQPSIGKFTGKPDPKTGNYKVSFIEGDGIGPEISKSVKDIFAA 60

Query: 60  ASVPVEWEYCDVTPLLVNGLTTIPEPAVASINKNLVALKGPLATPIGKGHRSLNLTLRKT 119
           A VPV++E   V P+LVNG+T+IPE A  SIN NLVALKGPLATP+GKGHRS+NLTLRKT
Sbjct: 61  AKVPVDFESVVVKPILVNGVTSIPEEAQKSINTNLVALKGPLATPVGKGHRSMNLTLRKT 120

Query: 120 FGLFANVRPAKSIEGYKTTYSDVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITREASE 179
           FGLFAN+RPAKS+EG+KT Y +V+LVLIRENTEGEY+GIEH + PGVVQSIKLITREASE
Sbjct: 121 FGLFANLRPAKSVEGFKTIYDNVNLVLIRENTEGEYAGIEHAIVPGVVQSIKLITREASE 180

Query: 180 RVIRYAFEYARTVGRPKVVVVHKSTIQRLADGLFVNVAQELGREYPDIELQTELLDNTVL 239
           RVIR+A+EYAR   RP+++VVHKSTIQRL+DGLFV+VA+EL  E+PDI+L+TEL+DN VL
Sbjct: 181 RVIRFAYEYARAAERPRLIVVHKSTIQRLSDGLFVDVAKELQSEFPDIKLETELIDNAVL 240

Query: 240 NVVTKPEAYKDVVAVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHQVSIFEAVHGSAPD 299
           N VT P  Y D V+VCPNLYGDI                   NIGH+VSIFEAVHGSAPD
Sbjct: 241 NTVTDPTKYSDAVSVCPNLYGDILSDMNSGLSAGSLGLTPSGNIGHKVSIFEAVHGSAPD 300

Query: 300 IAGQNRANPTALLLSSVMMLNHMGLHEHAGRIEKAVLSTIASSRENRTADLAGTASTSSF 359
           IAG+++ANPTALLLSSVMML+HMGLHEHA +IEKAVL+TIA+  E+RT DL G+ASTSSF
Sbjct: 301 IAGKDKANPTALLLSSVMMLHHMGLHEHASQIEKAVLTTIAAGPESRTGDLKGSASTSSF 360

Query: 360 TNAVIERL 367
           T AVI++L
Sbjct: 361 TEAVIKKL 368

>TPHA0E01480 Chr5 complement(300222..301355) [1134 bp, 377 aa] {ON}
           Anc_5.473 YOR136W
          Length = 377

 Score =  483 bits (1242), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 232/358 (64%), Positives = 280/358 (78%), Gaps = 2/358 (0%)

Query: 11  RRWLASVRQPSIGRYAGKPNA-AGKYTVSFIEGDGVGPEISQSVKDIFSAASVPVEWEYC 69
           R ++ +  + SIG + GKPN   G YTV FIEGDGVGPEIS+SV+ IF AA VP++W  C
Sbjct: 20  RYFMTAADKISIGNFKGKPNPETGNYTVPFIEGDGVGPEISKSVRTIFKAAKVPIDWVNC 79

Query: 70  DVTPLLVNGLTTIPEPAVASINKNLVALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPA 129
           D+ PLL+NG TTIP+ AV  IN +L+ALKGPLATP+G+GHRS+NLTLRKTFGLFANVRPA
Sbjct: 80  DIGPLLINGETTIPQTAVDQINNSLIALKGPLATPVGQGHRSINLTLRKTFGLFANVRPA 139

Query: 130 KSIEGYKTTYSDVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITREASERVIRYAFEYA 189
           KSI    +TY +VDL++IRENTEGEYSGIEH + PGVVQSIKLITR+ASE+VI+YAFEY 
Sbjct: 140 KSIPNLASTYENVDLIVIRENTEGEYSGIEHEIVPGVVQSIKLITRKASEKVIKYAFEYT 199

Query: 190 RTVGRPKVVVVHKSTIQRLADGLFVNVAQELGREYPDIELQTELLDNTVLNVVTKPEAYK 249
           R++GR  ++VVHK+TIQR  DGLFV  AQE+  +YPD+ L+ EL+DNTVLN +  PE Y 
Sbjct: 200 RSIGRSNLIVVHKATIQRRGDGLFVQTAQEMADKYPDVNLKLELIDNTVLNCIMNPEKYA 259

Query: 250 DVVAVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHQVSIFEAVHGSAPDIAGQNRANPT 309
           D V+VCPNLYGDI                  ANIG  V ++EAVHGSAPDIAGQ++ANPT
Sbjct: 260 DSVSVCPNLYGDILSDLNSGLSTGSLGLTPSANIGETV-LYEAVHGSAPDIAGQDKANPT 318

Query: 310 ALLLSSVMMLNHMGLHEHAGRIEKAVLSTIASSRENRTADLAGTASTSSFTNAVIERL 367
           ALLLSSVMMLNHMGL ++A  IE AVL+TI S +E RTADL G+A+T+SFT AVIE L
Sbjct: 319 ALLLSSVMMLNHMGLQKYADMIETAVLTTITSGKEFRTADLGGSATTTSFTKAVIENL 376

>ADL223W Chr4 (312893..313981) [1089 bp, 362 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL037C (IDH1)
          Length = 362

 Score =  281 bits (719), Expect = 5e-92,   Method: Compositional matrix adjust.
 Identities = 160/370 (43%), Positives = 222/370 (60%), Gaps = 14/370 (3%)

Query: 1   MLRQKLFQGSRRWLASVRQPSIGRYAGKPNAAGKYTVSFIEGDGVGPEISQSVKDIFSAA 60
           M R  L   ++R  A+ R+  + +  G     G+YTV+ I GDG+G E++ SV  IF A 
Sbjct: 1   MFRNTLSHITKRGYAAGREQLLPKKYG-----GRYTVTLIPGDGIGKEVTDSVVQIFEAE 55

Query: 61  SVPVEWEYCDVTPLLVNGLTTIPEPAVASINKNLVALKGPLATPIGK-GHRSLNLTLRKT 119
           +VPV+WE  +++ L  N      + AV S+ +N V LKG   TP  + GH SLN+  RK 
Sbjct: 56  NVPVDWESVELSALEENHEGV--QKAVESLKRNKVGLKGIWHTPADQTGHGSLNVAFRKQ 113

Query: 120 FGLFANVRPAKSIEGYKTTYSDVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITREASE 179
             +FANV   KS  G KT   DVDLV+IRENTEGEYSG+EH   PGVV+S+K++T+  SE
Sbjct: 114 LDIFANVALFKSFPGVKTKLQDVDLVIIRENTEGEYSGLEHESVPGVVESLKIMTKAKSE 173

Query: 180 RVIRYAFEYARTVGRPKVVVVHKSTIQRLADGLFVNVAQELG-REYPDIELQTELLDNTV 238
           R+ R+AF++A    R  V  VHK+ I +L DGLF N   E+G +EYP++ + + ++DN  
Sbjct: 174 RIARFAFDFALKNNRKAVCAVHKANIMKLGDGLFRNTVSEIGAKEYPEVNVSSIIVDNAS 233

Query: 239 LNVVTKPEAYKDVVAVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHQVSIFE-AVHGSA 297
           +  V KP  +   V V PNLYG I                  AN G + ++FE       
Sbjct: 234 MQAVAKPHQFD--VLVTPNLYGSI-LGNIGAALIGGPGLVPGANFGREYAVFEPGCRHVG 290

Query: 298 PDIAGQNRANPTALLLSSVMMLNHMGLHEHAGRIEKAVLSTIASSRENRTADLAGTASTS 357
            DI GQ+ ANPTA++LSS +ML H+GL+E+A RI +A   TIA  +   T D+ GTA+T+
Sbjct: 291 LDIKGQDVANPTAMILSSTLMLRHLGLNEYADRISRATYETIAEGKRT-TKDIGGTATTT 349

Query: 358 SFTNAVIERL 367
            FTNAVI++L
Sbjct: 350 EFTNAVIDKL 359

>Smik_14.290 Chr14 (528131..529213) [1083 bp, 360 aa] {ON} YNL037C
           (REAL)
          Length = 360

 Score =  278 bits (710), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 153/341 (44%), Positives = 216/341 (63%), Gaps = 14/341 (4%)

Query: 32  AGKYTVSFIEGDGVGPEISQSVKDIFSAASVPVEWEYCDVTPLLVNGLTTIPEPAVASIN 91
            G++TV+ I GDGVG EI+ SVK IF A  +PV+WE  ++     +    + E AV S+ 
Sbjct: 26  GGRFTVTLIPGDGVGKEITDSVKTIFEAEKIPVDWETVNIKQ--TDHKEGVYE-AVESLK 82

Query: 92  KNLVALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPAKSIEGYKTTYSDVDLVLIREN 150
           +N + LKG   TP  + GH SLN+ LRK   ++ANV   KS++G KT   D+DL++IREN
Sbjct: 83  RNKIGLKGLWHTPADQTGHGSLNVALRKQLDIYANVALFKSLKGVKTRIPDIDLIVIREN 142

Query: 151 TEGEYSGIEHVVSPGVVQSIKLITREASERVIRYAFEYARTVGRPKVVVVHKSTIQRLAD 210
           TEGE+SG+EH   PGVV+S+K++TR  +ER+ R+AF++A+   R  V  VHK+ I +L D
Sbjct: 143 TEGEFSGLEHESVPGVVESLKIMTRPKTERIARFAFDFAKKYNRKAVTAVHKANIMKLGD 202

Query: 211 GLFVNVAQELG-REYPDIELQTELLDNTVLNVVTKPEAYKDVVAVCPNLYGDIXXXXXXX 269
           GLF N+  E+G +EYPDI++ + ++DN  +  V KP  +   V V P++YG I       
Sbjct: 203 GLFRNIITEIGQKEYPDIDVSSIIVDNASMQAVAKPHQFD--VLVTPSMYGTI-LGNIGA 259

Query: 270 XXXXXXXXXXXANIGHQVSIFEAVHGS---APDIAGQNRANPTALLLSSVMMLNHMGLHE 326
                      AN G   ++FE   GS     DI GQN ANPTA++LSSV+MLNH+GL+E
Sbjct: 260 ALIGGPGLVAGANFGRDYAVFEP--GSRHVGLDIKGQNVANPTAMILSSVLMLNHLGLNE 317

Query: 327 HAGRIEKAVLSTIASSRENRTADLAGTASTSSFTNAVIERL 367
           +A RI KAV  TIA  +   T D+ G++ST+ FTN +I +L
Sbjct: 318 YATRISKAVHETIAEGKHT-TKDIGGSSSTTDFTNEIINKL 357

>Ecym_3316 Chr3 (608744..609832) [1089 bp, 362 aa] {ON} similar to
           Ashbya gossypii ADL223W
          Length = 362

 Score =  277 bits (709), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 158/370 (42%), Positives = 221/370 (59%), Gaps = 14/370 (3%)

Query: 1   MLRQKLFQGSRRWLASVRQPSIGRYAGKPNAAGKYTVSFIEGDGVGPEISQSVKDIFSAA 60
           MLR    Q S+R  A      + +  G     G+YTV+ I GDGVG E++ SV +IF A 
Sbjct: 1   MLRNTFVQISKRRFALASGQLLPKKYG-----GRYTVTLIPGDGVGKEVTDSVVNIFEAE 55

Query: 61  SVPVEWEYCDVTPLLVNGLTTIPEPAVASINKNLVALKGPLATPIGK-GHRSLNLTLRKT 119
           +VP++WE  +++ L  N      + AV S+ +N V LKG  +TP  + GH SLN+  RK 
Sbjct: 56  NVPIDWESVELSGLEEN--MEGVQKAVESLKRNKVGLKGIWSTPADQTGHGSLNVAFRKQ 113

Query: 120 FGLFANVRPAKSIEGYKTTYSDVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITREASE 179
             +FANV   KS  G KT   DVDLV+IRENTEGEYSG+EH   PGVV+S+K++T+  SE
Sbjct: 114 LDIFANVALFKSFPGVKTKLKDVDLVIIRENTEGEYSGLEHESVPGVVESLKIMTKAKSE 173

Query: 180 RVIRYAFEYARTVGRPKVVVVHKSTIQRLADGLFVNVAQELG-REYPDIELQTELLDNTV 238
           R+ R+AF++A    R  V  VHK+ I +L DGLF N   E+G +EYP++E+++ ++DN  
Sbjct: 174 RIARFAFDFALKNNRRSVCAVHKANIMKLGDGLFRNTVNEIGAKEYPELEVKSIIVDNAS 233

Query: 239 LNVVTKPEAYKDVVAVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHQVSIFE-AVHGSA 297
           +  V KP  +   V V PNLYG I                  AN G + ++FE       
Sbjct: 234 MQAVAKPHQFD--VLVTPNLYGSI-LGNVGAALIGSPGLVPGANFGREYAVFEPGSRHVG 290

Query: 298 PDIAGQNRANPTALLLSSVMMLNHMGLHEHAGRIEKAVLSTIASSRENRTADLAGTASTS 357
            DI GQ+ ANPTA++LSS +ML H+GL+++A RI KA    IA  +   T D+ G AST+
Sbjct: 291 LDIKGQDVANPTAMILSSTLMLRHLGLNDYADRISKATYEVIAEGKHT-TKDIGGHASTT 349

Query: 358 SFTNAVIERL 367
            FT A++++L
Sbjct: 350 QFTKAIVDKL 359

>KLLA0F04103g Chr6 (389159..390244) [1086 bp, 361 aa] {ON}
           uniprot|O94229 Kluyveromyces lactis KLLA0F04103g IDH1
           Isocitrate dehydrogenase subunit 1
          Length = 361

 Score =  275 bits (704), Expect = 9e-90,   Method: Compositional matrix adjust.
 Identities = 153/339 (45%), Positives = 209/339 (61%), Gaps = 10/339 (2%)

Query: 32  AGKYTVSFIEGDGVGPEISQSVKDIFSAASVPVEWEYCDVTPLLVNGLTTIPEPAVASIN 91
            G+YTV+ I GDGVG E++ SV  IF   ++P++WE  D++ L     T   + AV S+ 
Sbjct: 27  GGRYTVTLIPGDGVGKEVTDSVVKIFENENIPIDWETIDISGLEN---TENVQRAVESLK 83

Query: 92  KNLVALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPAKSIEGYKTTYSDVDLVLIREN 150
           +N V LKG   TP  + GH SLN+ LRK   +FANV   KSI G KT  +++D+V+IREN
Sbjct: 84  RNKVGLKGIWHTPADQTGHGSLNVALRKQLDIFANVALFKSIPGVKTRLNNIDMVIIREN 143

Query: 151 TEGEYSGIEHVVSPGVVQSIKLITREASERVIRYAFEYARTVGRPKVVVVHKSTIQRLAD 210
           TEGEYSG+EH   PGVV+S+K++TR  SER+ R+AF++A    R  V  VHK+ I +L D
Sbjct: 144 TEGEYSGLEHESVPGVVESLKIMTRAKSERIARFAFDFALKNNRKSVCAVHKANIMKLGD 203

Query: 211 GLFVNVAQELG-REYPDIELQTELLDNTVLNVVTKPEAYKDVVAVCPNLYGDIXXXXXXX 269
           GLF N   E+G  EYP+++++  ++DN  +  V KP  +   V V PNLYG I       
Sbjct: 204 GLFRNTVNEIGANEYPELDVKNIIVDNASMQAVAKPHQFD--VLVTPNLYGSI-LGNIGS 260

Query: 270 XXXXXXXXXXXANIGHQVSIFE-AVHGSAPDIAGQNRANPTALLLSSVMMLNHMGLHEHA 328
                      AN G + ++FE        DI GQN ANPTA++LSS +ML H+GL+ +A
Sbjct: 261 ALIGGPGLVPGANFGREYAVFEPGSRHVGLDIKGQNVANPTAMILSSTLMLRHLGLNAYA 320

Query: 329 GRIEKAVLSTIASSRENRTADLAGTASTSSFTNAVIERL 367
            RI KA    I+  +   T D+ G+ASTS FTNAVIE+L
Sbjct: 321 DRISKATYDVISEGKST-TRDIGGSASTSEFTNAVIEKL 358

>KLTH0G10186g Chr7 (863151..864233) [1083 bp, 360 aa] {ON} highly
           similar to uniprot|P28834 Saccharomyces cerevisiae
           YNL037C IDH1 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 360

 Score =  275 bits (703), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 163/374 (43%), Positives = 229/374 (61%), Gaps = 24/374 (6%)

Query: 1   MLRQKLFQGSRRWLASVRQPSIGRYAGKPNAAGKYTVSFIEGDGVGPEISQSVKDIFSAA 60
           MLR   F  S+R LA+V +  + +  G     G+YTV+ I GDGVG E++ SV  IF + 
Sbjct: 1   MLRNG-FGISKRSLATVAEQLLPKKYG-----GRYTVTLIPGDGVGKEVTDSVVSIFESE 54

Query: 61  SVPVEWEYCDVTPLLVNGLTTIP--EPAVASINKNLVALKGPLATPIGK-GHRSLNLTLR 117
           +VP++WE  +++     GL      + AV S+ +N V LKG   TP  + GH SLN+ LR
Sbjct: 55  NVPIDWETVEIS-----GLDNEEGVQKAVDSLKRNKVGLKGIWHTPSDQTGHGSLNVALR 109

Query: 118 KTFGLFANVRPAKSIEGYKTTYSDVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITREA 177
           K   +FANV   K++ G  + +S+VDLV+IRENTEGEYSG+EH   PGVV+S+K++T+  
Sbjct: 110 KQLDIFANVALFKTVPGVPSRHSNVDLVVIRENTEGEYSGLEHESVPGVVESLKIMTKAK 169

Query: 178 SERVIRYAFEYARTVGRPKVVVVHKSTIQRLADGLFVNVAQELG-REYPDIELQTELLDN 236
           S+R+ R+AF++A    R  V  VHK+ I +L DGLF N   E+G +EYP+IE++  ++DN
Sbjct: 170 SDRIGRFAFDFALKNNRKSVCAVHKANIMKLGDGLFRNCINEIGAKEYPEIEVKNIIVDN 229

Query: 237 TVLNVVTKPEAYKDVVAVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHQVSIFEAVHGS 296
             +  V KP  +   V V PNLYG I                  AN G + ++FE   GS
Sbjct: 230 ASMQAVAKPHQFD--VLVTPNLYGSI-LGNIGAALIGGPGLVPGANFGREFAVFEP--GS 284

Query: 297 ---APDIAGQNRANPTALLLSSVMMLNHMGLHEHAGRIEKAVLSTIASSRENRTADLAGT 353
                DI GQN ANPTA++LSS +ML H+GL+ +A RI KA    IA ++ N T D+ G+
Sbjct: 285 RHVGLDIKGQNVANPTAMILSSALMLRHLGLNSYADRISKATYDVIAEAK-NTTKDIGGS 343

Query: 354 ASTSSFTNAVIERL 367
           AST+ FT A+IE+L
Sbjct: 344 ASTTDFTQAIIEKL 357

>YNL037C Chr14 complement(557920..559002) [1083 bp, 360 aa] {ON}
           IDH1Subunit of mitochondrial NAD(+)-dependent isocitrate
           dehydrogenase, which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 360

 Score =  274 bits (700), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 150/341 (43%), Positives = 216/341 (63%), Gaps = 14/341 (4%)

Query: 32  AGKYTVSFIEGDGVGPEISQSVKDIFSAASVPVEWEYCDVTPLLVNGLTTIPEPAVASIN 91
            G++TV+ I GDGVG EI+ SV+ IF A ++P++WE  ++     +    + E AV S+ 
Sbjct: 26  GGRFTVTLIPGDGVGKEITDSVRTIFEAENIPIDWETINIKQ--TDHKEGVYE-AVESLK 82

Query: 92  KNLVALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPAKSIEGYKTTYSDVDLVLIREN 150
           +N + LKG   TP  + GH SLN+ LRK   ++ANV   KS++G KT   D+DL++IREN
Sbjct: 83  RNKIGLKGLWHTPADQTGHGSLNVALRKQLDIYANVALFKSLKGVKTRIPDIDLIVIREN 142

Query: 151 TEGEYSGIEHVVSPGVVQSIKLITREASERVIRYAFEYARTVGRPKVVVVHKSTIQRLAD 210
           TEGE+SG+EH   PGVV+S+K++TR  +ER+ R+AF++A+   R  V  VHK+ I +L D
Sbjct: 143 TEGEFSGLEHESVPGVVESLKVMTRPKTERIARFAFDFAKKYNRKSVTAVHKANIMKLGD 202

Query: 211 GLFVNVAQELG-REYPDIELQTELLDNTVLNVVTKPEAYKDVVAVCPNLYGDIXXXXXXX 269
           GLF N+  E+G +EYPDI++ + ++DN  +  V KP  +   V V P++YG I       
Sbjct: 203 GLFRNIITEIGQKEYPDIDVSSIIVDNASMQAVAKPHQFD--VLVTPSMYGTI-LGNIGA 259

Query: 270 XXXXXXXXXXXANIGHQVSIFEAVHGS---APDIAGQNRANPTALLLSSVMMLNHMGLHE 326
                      AN G   ++FE   GS     DI GQN ANPTA++LSS +MLNH+GL+E
Sbjct: 260 ALIGGPGLVAGANFGRDYAVFEP--GSRHVGLDIKGQNVANPTAMILSSTLMLNHLGLNE 317

Query: 327 HAGRIEKAVLSTIASSRENRTADLAGTASTSSFTNAVIERL 367
           +A RI KAV  TIA  +   T D+ G++ST+ FTN +I +L
Sbjct: 318 YATRISKAVHETIAEGKHT-TRDIGGSSSTTDFTNEIINKL 357

>Skud_14.293 Chr14 (538202..539287) [1086 bp, 361 aa] {ON} YNL037C
           (REAL)
          Length = 361

 Score =  273 bits (698), Expect = 8e-89,   Method: Compositional matrix adjust.
 Identities = 152/341 (44%), Positives = 216/341 (63%), Gaps = 14/341 (4%)

Query: 32  AGKYTVSFIEGDGVGPEISQSVKDIFSAASVPVEWEYCDVTPLLVNGLTTIPEPAVASIN 91
            G++TV+ I GDGVG EI+ SV+ IF A  +PV+WE  ++     +    + E AV S+ 
Sbjct: 26  GGRFTVTLIPGDGVGKEITDSVRTIFEAERIPVDWETINIKQ--TDHKEGVYE-AVESLK 82

Query: 92  KNLVALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPAKSIEGYKTTYSDVDLVLIREN 150
           +N + LKG   TP  + GH SLN+ LRK   ++ANV   KS++G KT   D+DL++IREN
Sbjct: 83  RNKIGLKGLWHTPADQTGHGSLNVALRKQLDIYANVALFKSLKGVKTRIPDIDLIVIREN 142

Query: 151 TEGEYSGIEHVVSPGVVQSIKLITREASERVIRYAFEYARTVGRPKVVVVHKSTIQRLAD 210
           TEGE+SG+EH   PGVV+S+K++T+  +ER+ R+AF++A+   R  V  VHK+ I +L D
Sbjct: 143 TEGEFSGLEHESVPGVVESLKVMTKPKTERIARFAFDFAKKYNRKAVTAVHKANIMKLGD 202

Query: 211 GLFVNVAQELGR-EYPDIELQTELLDNTVLNVVTKPEAYKDVVAVCPNLYGDIXXXXXXX 269
           GLF N+  E+G+ EYPDI++ + ++DN  +  V KP  +   V V P++YG I       
Sbjct: 203 GLFRNIITEIGQTEYPDIDVSSIIVDNASMQAVAKPHQFD--VLVTPSMYGTI-LGNIGA 259

Query: 270 XXXXXXXXXXXANIGHQVSIFEAVHGS---APDIAGQNRANPTALLLSSVMMLNHMGLHE 326
                      AN G   ++FE   GS     DI GQN ANPTA++LSSV+MLNH+GL+E
Sbjct: 260 ALIGGPGLVAGANFGRDYAVFEP--GSRHVGLDIKGQNVANPTAMILSSVLMLNHLGLNE 317

Query: 327 HAGRIEKAVLSTIASSRENRTADLAGTASTSSFTNAVIERL 367
           +A RI KAV  TIA  +   T D+ G++ST+ FTN VI +L
Sbjct: 318 NATRISKAVHETIAEGKHT-TRDIGGSSSTTDFTNEVINKL 357

>SAKL0E07876g Chr5 complement(635705..636790) [1086 bp, 361 aa] {ON}
           highly similar to uniprot|P28834 Saccharomyces
           cerevisiae YNL037C IDH1 Subunit of mitochondrial NAD( )-
           dependent isocitrate dehydrogenase which catalyzes the
           oxidation of isocitrate to alpha-ketoglutarate in the
           TCA cycle
          Length = 361

 Score =  266 bits (679), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 158/374 (42%), Positives = 224/374 (59%), Gaps = 23/374 (6%)

Query: 1   MLRQKLFQGSRRWLASVRQPSI--GRYAGKPNAAGKYTVSFIEGDGVGPEISQSVKDIFS 58
           M R   F  S+R LA+V    +   +Y G+      YTV+ I GDGVG E++ SV  IF 
Sbjct: 1   MFRNT-FAVSKRSLATVATEQLLPKKYGGR------YTVTLIPGDGVGKEVTDSVVSIFE 53

Query: 59  AASVPVEWEYCDVTPLLVNGLTTIPEPAVASINKNLVALKGPLATPIGK-GHRSLNLTLR 117
           A +VP++WE  ++T   V+    + + AV S+ +N + LKG   TP  + GH SLN+  R
Sbjct: 54  AENVPIDWETINITG--VDSEEGV-QKAVESLKRNKIGLKGIWHTPADQTGHGSLNVAFR 110

Query: 118 KTFGLFANVRPAKSIEGYKTTYSDVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITREA 177
           K   +FANV   K++ G KT  S++DLV+IRENTEGEYSG+EH   PGVV+S+K+IT+  
Sbjct: 111 KQLDIFANVALFKNVPGVKTKLSNIDLVVIRENTEGEYSGLEHESVPGVVESLKIITKAK 170

Query: 178 SERVIRYAFEYARTVGRPKVVVVHKSTIQRLADGLFVNVAQELG-REYPDIELQTELLDN 236
           SER+ R+AF++A    R  V  VHK+ I +L DGLF N   E+G  EYP+I+++  ++DN
Sbjct: 171 SERIARFAFDFALKNNRKSVCAVHKANIMKLGDGLFRNTVNEVGASEYPEIDVKNIIVDN 230

Query: 237 TVLNVVTKPEAYKDVVAVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHQVSIFEAVHGS 296
             +  V KP  +   V V PNLYG I                  AN G + ++FE   GS
Sbjct: 231 ASMQAVAKPHQFD--VLVTPNLYGSI-LGNIGAALIGGPGLVPGANFGREYAVFEP--GS 285

Query: 297 ---APDIAGQNRANPTALLLSSVMMLNHMGLHEHAGRIEKAVLSTIASSRENRTADLAGT 353
                DI G++ ANPTA++LSS +ML H+GL+ +A RI KA    IA  +   T D+ G+
Sbjct: 286 RHVGLDIKGKDLANPTAMILSSTLMLRHLGLNGYADRISKATYDVIAEGKHT-TKDIGGS 344

Query: 354 ASTSSFTNAVIERL 367
           +ST+ FT +VI++L
Sbjct: 345 SSTTEFTKSVIDKL 358

>TBLA0B06910 Chr2 (1634845..1635942) [1098 bp, 365 aa] {ON} 
          Length = 365

 Score =  265 bits (678), Expect = 8e-86,   Method: Compositional matrix adjust.
 Identities = 160/369 (43%), Positives = 226/369 (61%), Gaps = 24/369 (6%)

Query: 10  SRRWLASVRQPSIGRYAGKPNA-----AGKYTVSFIEGDGVGPEISQSVKDIFSAASVPV 64
           ++R LA+V  P+ G + G  N       G+YTV+ I GDGVG E++ SV  IF+A ++P+
Sbjct: 7   AKRGLATV--PATG-FRGFLNPLPKEYGGRYTVTLIPGDGVGKEVTDSVVSIFNAENLPI 63

Query: 65  EWEYCDVTPL-LVNGLTTIPEPAVASINKNLVALKGPLATPIGKG-HRSLNLTLRKTFGL 122
           +WE  D++ L    G+    E AV S+ +N + LKG   T  G+  H SLN+ LRK   +
Sbjct: 64  DWERVDISGLDHEEGV----EAAVNSLKRNKIGLKGIWHTSAGQSDHGSLNVALRKQLDI 119

Query: 123 FANVRPAKSIEGYKTTYSDVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITREASERVI 182
           +ANV   K++ G KT   DVDLV+IRENTEGEYSG+EH   PGVV+S+K+IT+E SER+ 
Sbjct: 120 YANVAHFKTLPGVKTRIPDVDLVIIRENTEGEYSGLEHESVPGVVESLKIITKEKSERIA 179

Query: 183 RYAFEYARTVGRPKVVVVHKSTIQRLADGLFVNVAQELGR-EYPDIELQTELLDNTVLNV 241
           R+AF++A+   R  V  VHK+ I +L DGLF N    +G  EYPDI++ + ++DN  +  
Sbjct: 180 RFAFDFAKRFDRKLVTAVHKANIMKLGDGLFRNSVTSIGETEYPDIKVSSIIVDNASMQS 239

Query: 242 VTKPEAYKDVVAVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHQVSIFEAVHGS---AP 298
           V KP  +   V V P++YG I                  AN G + ++FE   GS     
Sbjct: 240 VAKPHQFD--VLVTPSMYGTI-LGNIGAALIGGPGLVPGANYGTECAVFEP--GSRHVGL 294

Query: 299 DIAGQNRANPTALLLSSVMMLNHMGLHEHAGRIEKAVLSTIASSRENRTADLAGTASTSS 358
           DI GQN ANPTA++LSS ++L H+GL+  A +IE AV  TIA  +   T D+ G+AST+ 
Sbjct: 295 DIKGQNVANPTAMILSSTLLLKHLGLNNEAKKIEDAVYKTIAEGKVT-TRDIGGSASTTE 353

Query: 359 FTNAVIERL 367
           FTN +I++L
Sbjct: 354 FTNEIIKKL 362

>ZYRO0D02838g Chr4 (223132..224217) [1086 bp, 361 aa] {ON} similar
           to uniprot|P28834 Saccharomyces cerevisiae YNL037C IDH1
           Subunit of mitochondrial NAD( )-dependent isocitrate
           dehydrogenase which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 361

 Score =  265 bits (676), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 153/342 (44%), Positives = 217/342 (63%), Gaps = 15/342 (4%)

Query: 32  AGKYTVSFIEGDGVGPEISQSVKDIFSAASVPVEWEYCDVTPLLVNGLTTIPEPAVASIN 91
            G+YTV+ I GDGVG E++ SV  IF A +VPV+W+  D++   V+    + + AV S+ 
Sbjct: 26  GGRYTVTLIPGDGVGKEVTDSVVSIFKAENVPVDWDRVDISG--VDRAEDV-KSAVESLK 82

Query: 92  KNLVALKGPLAT-PIGK-GHRSLNLTLRKTFGLFANVRPAKSIEGYKTTYSDVDLVLIRE 149
           +N + LKG   T P  + GH SLN+ LRK   ++ANV   KSI G +    DVDLV+IRE
Sbjct: 83  RNRIGLKGIWHTSPADQAGHGSLNVALRKELDIYANVARFKSIPGVQVKIPDVDLVVIRE 142

Query: 150 NTEGEYSGIEHVVSPGVVQSIKLITREASERVIRYAFEYARTVGRPKVVVVHKSTIQRLA 209
           NTEGE+SG+EH   PGVV+S+K++T++  ER+ R+AF+YA+   R +VV VHK+ I ++ 
Sbjct: 143 NTEGEFSGLEHESVPGVVESLKIMTQDNIERIARFAFDYAKKNDRKQVVAVHKANIMKMG 202

Query: 210 DGLFVNVAQELG-REYPDIELQTELLDNTVLNVVTKPEAYKDVVAVCPNLYGDIXXXXXX 268
           DGLF N+ QE+G +EYP++++   ++DN  +  V  P  +   V V P++YG I      
Sbjct: 203 DGLFKNLVQEVGEKEYPELQVGNIIVDNASMQTVANPHQFD--VLVTPSMYGTI-LGNIG 259

Query: 269 XXXXXXXXXXXXANIGHQVSIFEAVHGS---APDIAGQNRANPTALLLSSVMMLNHMGLH 325
                       AN G  V++FE   GS     DI GQN ANPTA++LSSV++LNH+GL+
Sbjct: 260 AALIGGPGLVAGANYGRDVALFEP--GSRHVGLDIKGQNVANPTAMILSSVLLLNHLGLN 317

Query: 326 EHAGRIEKAVLSTIASSRENRTADLAGTASTSSFTNAVIERL 367
             A RI KAV + IA  + + T D+ GTAST+ FT AVI +L
Sbjct: 318 TSADRISKAVHAVIAEGK-SVTRDIGGTASTTEFTEAVINKL 358

>Kwal_23.5012 s23 (964254..965339) [1086 bp, 361 aa] {ON} YNL037C
           (IDH1) - alpha-4-beta-4 subunit of mitochondrial
           isocitrate dehydrogenase 1 [contig 7] FULL
          Length = 361

 Score =  265 bits (676), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 150/343 (43%), Positives = 212/343 (61%), Gaps = 18/343 (5%)

Query: 32  AGKYTVSFIEGDGVGPEISQSVKDIFSAASVPVEWEYCDVTPLLVNGLTTIP--EPAVAS 89
            G+YTV+ I GDGVG E++ SV  IF + ++P++WE  +++     GL      + AV S
Sbjct: 27  GGRYTVTLIPGDGVGKEVTDSVVSIFESENIPIDWETVEIS-----GLDNQEGVQKAVES 81

Query: 90  INKNLVALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPAKSIEGYKTTYSDVDLVLIR 148
           + +N V LKG   TP  + GH SLN+ LRK   +FANV   KS+ G  + +S+VD+V+IR
Sbjct: 82  LKRNKVGLKGIWHTPSDQTGHGSLNVALRKQLDIFANVALFKSVPGVPSRHSNVDMVVIR 141

Query: 149 ENTEGEYSGIEHVVSPGVVQSIKLITREASERVIRYAFEYARTVGRPKVVVVHKSTIQRL 208
           ENTEGEYSG+EH   PGVV+S+K++T+  SER+ R+AF++A    R  V  VHK+ I +L
Sbjct: 142 ENTEGEYSGLEHESVPGVVESLKIMTKAKSERIGRFAFDFAVKNNRKSVCAVHKANIMKL 201

Query: 209 ADGLFVNVAQELG-REYPDIELQTELLDNTVLNVVTKPEAYKDVVAVCPNLYGDIXXXXX 267
            DGLF N   E+G +EYP+I+++  ++DN  +  V KP  +   V V PNLYG I     
Sbjct: 202 GDGLFRNCINEVGAKEYPEIDVKNIIVDNASMQAVAKPHQFD--VLVTPNLYGSI-LGNI 258

Query: 268 XXXXXXXXXXXXXANIGHQVSIFEAVHGS---APDIAGQNRANPTALLLSSVMMLNHMGL 324
                        AN G + ++FE   GS     DI GQN ANPTA++LSS +ML H+GL
Sbjct: 259 GAALIGGPGLVPGANFGREYAVFEP--GSRHVGLDIKGQNVANPTAMILSSSLMLRHLGL 316

Query: 325 HEHAGRIEKAVLSTIASSRENRTADLAGTASTSSFTNAVIERL 367
           + +A RI KA    IA ++   T D+ G+AST+ FT A+I +L
Sbjct: 317 NAYADRISKATYDVIAEAK-TTTQDIGGSASTTEFTEAIISKL 358

>NDAI0B03590 Chr2 complement(901108..902187) [1080 bp, 359 aa] {ON}
           Anc_2.278
          Length = 359

 Score =  264 bits (674), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 149/341 (43%), Positives = 209/341 (61%), Gaps = 14/341 (4%)

Query: 32  AGKYTVSFIEGDGVGPEISQSVKDIFSAASVPVEWEYCDVTPLLVNGLTTIPEPAVASIN 91
            G++TV+ + GDGVG EI+ SV  IF + +VP++WE  D++ L     T   + AV S+ 
Sbjct: 25  GGRFTVTLLPGDGVGKEITDSVVSIFKSENVPIDWETVDISGL---DHTEGVKAAVDSLK 81

Query: 92  KNLVALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPAKSIEGYKTTYSDVDLVLIREN 150
           +N + LKG   TP  + GH SLN+  RK   ++ANV   KSIEG KT   +VDLV+IREN
Sbjct: 82  RNKIGLKGIWHTPADQVGHGSLNVAFRKQLDIYANVAIFKSIEGVKTKIPNVDLVVIREN 141

Query: 151 TEGEYSGIEHVVSPGVVQSIKLITREASERVIRYAFEYARTVGRPKVVVVHKSTIQRLAD 210
           TEGEYSG+EH   PGVV+S+K+IT+  SER+ R+AF++A+   R  V  VHK+ I +L+D
Sbjct: 142 TEGEYSGLEHESVPGVVESLKIITKSKSERIARFAFDFAKRNNRKSVTAVHKANIMKLSD 201

Query: 211 GLFVNVAQELG-REYPDIELQTELLDNTVLNVVTKPEAYKDVVAVCPNLYGDIXXXXXXX 269
           GLF N   ++G  EYP+I+  + ++DN  +  V KP  +   V V P++YG I       
Sbjct: 202 GLFRNTVSKIGEEEYPEIQTSSIIVDNASMQAVAKPHQFD--VMVTPSMYGTI-VGNIGA 258

Query: 270 XXXXXXXXXXXANIGHQVSIFEAVHGS---APDIAGQNRANPTALLLSSVMMLNHMGLHE 326
                       N G   ++FE   GS     DI GQN ANPTA+LLS+ ++L+H+GL +
Sbjct: 259 ALIGGPGLVPGVNYGRDYAVFEP--GSRHVGLDIKGQNVANPTAMLLSATLLLDHLGLEK 316

Query: 327 HAGRIEKAVLSTIASSRENRTADLAGTASTSSFTNAVIERL 367
            A RI+ AV   IA  +   T D+ G+AST+ FT AVI +L
Sbjct: 317 SANRIKSAVYDVIAEGKAT-TQDIGGSASTTEFTQAVINKL 356

>TPHA0D01560 Chr4 complement(321751..322833) [1083 bp, 360 aa] {ON}
           Anc_2.278 YNL037C
          Length = 360

 Score =  259 bits (661), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 149/341 (43%), Positives = 210/341 (61%), Gaps = 14/341 (4%)

Query: 32  AGKYTVSFIEGDGVGPEISQSVKDIFSAASVPVEWEYCDVTPLLVNGLTTIPEPAVASIN 91
            G+YTV+ I GDG+G E++ SV  IF++  +P++WE  DV P + N      + AV S+ 
Sbjct: 26  GGRYTVTLIPGDGIGKEVTDSVVKIFASQGLPIDWERIDV-PGMSN--ENEVKKAVESLK 82

Query: 92  KNLVALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPAKSIEGYKTTYSDVDLVLIREN 150
           +N + LKG   T   + G+ SLN+ LRK   +FANV   KS++G KT   DVDLV+IREN
Sbjct: 83  RNKIGLKGIWHTSADQTGYGSLNVALRKQLDIFANVAIFKSLKGVKTKIPDVDLVVIREN 142

Query: 151 TEGEYSGIEHVVSPGVVQSIKLITREASERVIRYAFEYARTVGRPKVVVVHKSTIQRLAD 210
           TEGEYSG+EH   PGVV+S+K+IT+  +ER+ R+AF++A    R  V  VHK+ I +L+D
Sbjct: 143 TEGEYSGLEHESVPGVVESLKIITKPKTERIARFAFDFALENNRSTVTAVHKANIMKLSD 202

Query: 211 GLFVNVAQELG-REYPDIELQTELLDNTVLNVVTKPEAYKDVVAVCPNLYGDIXXXXXXX 269
           GLF N   E+G +EYPDI++ T ++DN  +  V KP  +   V V P++YG I       
Sbjct: 203 GLFKNTVAEVGEKEYPDIKVNTIIVDNASMQAVAKPHQFD--VMVTPSMYGTI-LGNIGA 259

Query: 270 XXXXXXXXXXXANIGHQVSIFEAVHGS---APDIAGQNRANPTALLLSSVMMLNHMGLHE 326
                      AN G + ++FE   GS     DI  QN ANPTA++LS+ +MLN +GL E
Sbjct: 260 ALIGGPGLIPGANYGREHAVFEP--GSRHVGLDIENQNIANPTAMILSATLMLNQLGLRE 317

Query: 327 HAGRIEKAVLSTIASSRENRTADLAGTASTSSFTNAVIERL 367
            + RI  AV + I   +   T D+ G AST+ FT+AVI++L
Sbjct: 318 ESKRISNAVYAVIEEGK-TTTKDIGGNASTTEFTDAVIDKL 357

>CAGL0G02673g Chr7 complement(246455..247531) [1077 bp, 358 aa] {ON}
           highly similar to uniprot|P28834 Saccharomyces
           cerevisiae YNL037c IDH1 or uniprot|P28241 Saccharomyces
           cerevisiae YOR136w IDH2
          Length = 358

 Score =  255 bits (652), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 146/339 (43%), Positives = 204/339 (60%), Gaps = 10/339 (2%)

Query: 32  AGKYTVSFIEGDGVGPEISQSVKDIFSAASVPVEWEYCDVTPLLVNGLTTIPEPAVASIN 91
            G+YTV+ I GDGVG EI+ SV  IF A ++PV+WE  D++    + +  + + AV S+ 
Sbjct: 24  GGRYTVTLIPGDGVGKEITDSVVSIFEAENIPVDWERVDIST--SDNIQDVSQ-AVESLK 80

Query: 92  KNLVALKGPLATPIG-KGHRSLNLTLRKTFGLFANVRPAKSIEGYKTTYSDVDLVLIREN 150
           +N + LKG   T      H S N+ LRK   +FA+V   KS+ G KT   +VDLV+IREN
Sbjct: 81  RNKIGLKGIWHTSADIADHGSFNVALRKQLDMFAHVAFFKSVPGVKTKIPNVDLVVIREN 140

Query: 151 TEGEYSGIEHVVSPGVVQSIKLITREASERVIRYAFEYARTVGRPKVVVVHKSTIQRLAD 210
           TEGEYSG+EH   PGVV+S+K+IT+  SER+ R+AF++A+   R  V  VHK+ I ++ D
Sbjct: 141 TEGEYSGLEHESVPGVVESLKIITKAKSERIARFAFDFAKKYNRKSVCAVHKANIMKMGD 200

Query: 211 GLFVNVAQELG-REYPDIELQTELLDNTVLNVVTKPEAYKDVVAVCPNLYGDIXXXXXXX 269
           GLF N   E+G  EYPDI+  + ++DN  +  V KP  +   V V P++YG I       
Sbjct: 201 GLFRNTVTEIGANEYPDIQTSSIIVDNASMQAVAKPHQFD--VMVTPSMYGTI-IGNIGA 257

Query: 270 XXXXXXXXXXXANIGHQVSIFE-AVHGSAPDIAGQNRANPTALLLSSVMMLNHMGLHEHA 328
                      A+ G + ++FE        DI G+N ANPTA++LSS +ML H+GL E A
Sbjct: 258 ALIGGPGLVAGAHYGREHAVFEPGSQHVGLDIKGKNVANPTAMILSSTLMLQHLGLTESA 317

Query: 329 GRIEKAVLSTIASSRENRTADLAGTASTSSFTNAVIERL 367
            RI KA    I S  +  T D+ G+AST+ FT A+I+RL
Sbjct: 318 KRIAKATHDVI-SLGQVTTKDIGGSASTTEFTEAIIKRL 355

>KNAG0A05280 Chr1 (780448..781533) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score =  255 bits (652), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 158/375 (42%), Positives = 219/375 (58%), Gaps = 27/375 (7%)

Query: 1   MLRQKLFQGSRRWLASVRQPSIGRYAGKPNA-AGKYTVSFIEGDGVGPEISQSVKDIFSA 59
           MLR+ +   S+R LA++ +         PN   G+YTV+ + GDGVG E + SV  +F+A
Sbjct: 1   MLRRLV---SKRSLATLPETLF------PNKYGGRYTVTLLPGDGVGKECTDSVVSVFNA 51

Query: 60  ASVPVEWEYCDVTPL-LVNGLTTIPEPAVASINKNLVALKGPLATPIGK--GHRSLNLTL 116
            ++P++WE  +++ L    G+      AV S+ +N + LKG   T      GH SLN+  
Sbjct: 52  ENIPIDWEIVNISGLDHKEGVAA----AVQSLRRNKIGLKGLWHTSNADQSGHGSLNVAF 107

Query: 117 RKTFGLFANVRPAKSIEGYKTTYSDVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITRE 176
           RK   ++ANV   KS++G KT   DVDLV+IRENTEGE+SG+EH    GVV+S+K+ T  
Sbjct: 108 RKQLDIYANVAVFKSLKGVKTMIPDVDLVVIRENTEGEFSGLEHESVEGVVESLKVTTLP 167

Query: 177 ASERVIRYAFEYARTVGRPKVVVVHKSTIQRLADGLFVNVAQELG-REYPDIELQTELLD 235
            +ER+ R+AF YA+  GR  V  VHK+ I +L DGLF N    +G +EYPDIE  + ++D
Sbjct: 168 KTERIARFAFNYAQKNGRKAVCAVHKANIMKLGDGLFRNTVTSIGEKEYPDIETSSIIVD 227

Query: 236 NTVLNVVTKPEAYKDVVAVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHQVSIFEAVHG 295
           N  +  V KP  +   V V P++YG I                  AN G + ++FE   G
Sbjct: 228 NASMQAVAKPHQFD--VLVTPSMYGTI-IGNIGAALIGGPGLVAGANFGREYAVFEP--G 282

Query: 296 S---APDIAGQNRANPTALLLSSVMMLNHMGLHEHAGRIEKAVLSTIASSRENRTADLAG 352
           S     DI GQN ANPTA+LLSS +MLNH+GL +   RI  AV   IA   + RT D+ G
Sbjct: 283 SRHVGLDIKGQNIANPTAMLLSSALMLNHLGLTKSGKRISDAVREVIAEG-DVRTKDIGG 341

Query: 353 TASTSSFTNAVIERL 367
            A+T+ FT AVIE+L
Sbjct: 342 DATTTEFTQAVIEKL 356

>Kpol_1039.35 s1039 complement(108102..109181) [1080 bp, 359 aa]
           {ON} complement(108102..109181) [1080 nt, 360 aa]
          Length = 359

 Score =  255 bits (651), Expect = 7e-82,   Method: Compositional matrix adjust.
 Identities = 146/341 (42%), Positives = 204/341 (59%), Gaps = 15/341 (4%)

Query: 32  AGKYTVSFIEGDGVGPEISQSVKDIFSAASVPVEWEYCDVTPLLVNGLTTIPEPAVASIN 91
            G+YTV+ + GDGVG EI+ SV  IF A ++P++WE  +++ L    + T    AV S+ 
Sbjct: 26  GGRYTVTLLPGDGVGREITDSVVSIFEAENLPIDWERVELSGLEQEDVHT----AVESLK 81

Query: 92  KNLVALKGPLATPIG-KGHRSLNLTLRKTFGLFANVRPAKSIEGYKTTYSDVDLVLIREN 150
           +N + LKG   T     GH S N+ LRK   ++ANV   KS +G  T   DVDLV+IREN
Sbjct: 82  RNKIGLKGIWHTSADHDGHTSWNVALRKELDIYANVAIFKSFKGVDTRIPDVDLVIIREN 141

Query: 151 TEGEYSGIEHVVSPGVVQSIKLITREASERVIRYAFEYARTVGRPKVVVVHKSTIQRLAD 210
           TEGEYSG+EH   PGVV+S+K++T + +ER+ R+AF+YA    R  V  VHK+ I +L D
Sbjct: 142 TEGEYSGLEHESVPGVVESLKIMTAQKTERIARFAFDYAMKYNRKSVTAVHKANIMKLGD 201

Query: 211 GLFVNVAQELG-REYPDIELQTELLDNTVLNVVTKPEAYKDVVAVCPNLYGDIXXXXXXX 269
           GLF N+  E+G +EYP++ + + ++DN  +  V KP  +   V V P++YG I       
Sbjct: 202 GLFRNLVTEIGAKEYPEVGVSSIIVDNASMQAVAKPHQFD--VMVAPSMYGTI-LGNIGA 258

Query: 270 XXXXXXXXXXXANIGHQVSIFEAVHGS---APDIAGQNRANPTALLLSSVMMLNHMGLHE 326
                      AN G   ++FE   GS     DI  QN ANPTA++LS+ +MLNH+G   
Sbjct: 259 ALIGGPGLVPGANYGRDYAVFEP--GSRHVGLDIENQNIANPTAMILSATLMLNHLGFRN 316

Query: 327 HAGRIEKAVLSTIASSRENRTADLAGTASTSSFTNAVIERL 367
            A RI KAV   IA  +   T D+ G+A+T+ FTNAVI +L
Sbjct: 317 DAARISKAVHEVIAEGKTT-TRDIGGSATTTEFTNAVIAKL 356

>NCAS0B06290 Chr2 complement(1186838..1187917) [1080 bp, 359 aa]
           {ON} Anc_2.278
          Length = 359

 Score =  250 bits (639), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 145/341 (42%), Positives = 202/341 (59%), Gaps = 15/341 (4%)

Query: 32  AGKYTVSFIEGDGVGPEISQSVKDIFSAASVPVEWEYCDVTPL-LVNGLTTIPEPAVASI 90
            G+ TV+ + GDGVG EI+ SV  IF A +VP++WE  D++ L   +G+      AV S+
Sbjct: 26  GGRMTVTLLPGDGVGKEITDSVVSIFQAENVPIDWETVDISQLDHEDGVNA----AVESL 81

Query: 91  NKNLVALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPAKSIEGYKTTYSDVDLVLIRE 149
            +N + LKG   T   + GH SLN+  RK   ++ANV   KSI G KT   +VDLV+IRE
Sbjct: 82  KRNKIGLKGIWHTSADQVGHGSLNVAFRKQLDIYANVAFCKSIPGVKTKIPNVDLVIIRE 141

Query: 150 NTEGEYSGIEHVVSPGVVQSIKLITREASERVIRYAFEYARTVGRPKVVVVHKSTIQRLA 209
           NTEGEYSG+EH   PGVV+S+K++T+  SER+ ++AF++A    R  V  VHK+ I +L+
Sbjct: 142 NTEGEYSGLEHESVPGVVESLKIVTKVNSERIAKFAFDFAMRHDRKMVTAVHKANIMKLS 201

Query: 210 DGLFVNVAQELGREYPDIELQTELLDNTVLNVVTKPEAYKDVVAVCPNLYGDIXXXXXXX 269
           DGLF N    +G  YP I+  + ++DN  +  V KP  +   V V P++YG I       
Sbjct: 202 DGLFRNTVARVGEAYPQIKNDSIIVDNASMQAVAKPHQFD--VMVTPSMYGTI-LGNIGA 258

Query: 270 XXXXXXXXXXXANIGHQVSIFEAVHGS---APDIAGQNRANPTALLLSSVMMLNHMGLHE 326
                       N G + ++FE   GS     DI GQN ANPTA++LSS ++L H+GL++
Sbjct: 259 ALIGGPGLVPGVNYGREYAVFEP--GSRHVGLDIKGQNVANPTAMILSSTLLLQHLGLND 316

Query: 327 HAGRIEKAVLSTIASSRENRTADLAGTASTSSFTNAVIERL 367
            A RI KAV   I       T D+ G AST+ FT AVI++L
Sbjct: 317 TASRISKAVYDVIKEGNAT-TKDIGGNASTTEFTKAVIDKL 356

>TDEL0C03840 Chr3 complement(673007..674092) [1086 bp, 361 aa] {ON}
           Anc_2.278 YNL037C
          Length = 361

 Score =  246 bits (627), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 144/345 (41%), Positives = 209/345 (60%), Gaps = 21/345 (6%)

Query: 32  AGKYTVSFIEGDGVGPEISQSVKDIFSAASVPVEWEYCDVTPL-LVNGLTTIPEPAVASI 90
            G++ V+ I GDGVG E++ SV  IF A ++P++W+  D++ L    G+    + AV S+
Sbjct: 26  GGRFVVTLIPGDGVGKEVTDSVVSIFEAENLPIDWDRVDISGLDHEEGV----QAAVDSL 81

Query: 91  NKNLVALKG----PLATPIGKGHRSLNLTLRKTFGLFANVRPAKSIEGYKTTYSDVDLVL 146
            +N + LKG      A   GKG  SLN+ LRK   ++ANV   KS+ G KT   +VDLV+
Sbjct: 82  KRNKIGLKGIWHTSAADQAGKG--SLNVALRKELDIYANVALFKSVPGVKTKIPNVDLVV 139

Query: 147 IRENTEGEYSGIEHVVSPGVVQSIKLITREASERVIRYAFEYARTVGRPKVVVVHKSTIQ 206
           IRENTEGEYSG+EH   PGVV+S+K++T + +ER+ R+AF++A+   R  V  VHK+ I 
Sbjct: 140 IRENTEGEYSGLEHESVPGVVESLKIMTEDKTERIARFAFDFAKKYNRHAVTAVHKANIM 199

Query: 207 RLADGLFVNVAQELG-REYPDIELQTELLDNTVLNVVTKPEAYKDVVAVCPNLYGDIXXX 265
           +L DGLF NV   +G +EYPD+++ + ++DN  +  V KP  +   V V P++YG I   
Sbjct: 200 KLGDGLFRNVVTRVGEQEYPDVKVGSIIVDNASMQTVAKPHQFD--VLVTPSMYGTI-LG 256

Query: 266 XXXXXXXXXXXXXXXANIGHQVSIFEAVHGS---APDIAGQNRANPTALLLSSVMMLNHM 322
                          AN G + ++FE   GS     DI  +N ANPTA++LS+ +ML+H+
Sbjct: 257 NIGAALIGGPGLVAGANYGREYAVFEP--GSRHVGLDIKDKNIANPTAMILSASLMLDHL 314

Query: 323 GLHEHAGRIEKAVLSTIASSRENRTADLAGTASTSSFTNAVIERL 367
           GL   A +I  AV   IA  +   T D+ G+AST+ FT AVIE+L
Sbjct: 315 GLSTSATKISNAVHQVIAEGKST-TPDIGGSASTTEFTQAVIEKL 358

>KAFR0J01410 Chr10 complement(256693..257745) [1053 bp, 350 aa] {ON}
           Anc_2.278 YNL037C
          Length = 350

 Score =  234 bits (597), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 146/371 (39%), Positives = 211/371 (56%), Gaps = 29/371 (7%)

Query: 1   MLRQKLFQGSRRWLASVRQPSIGRYAGKPNAAGKYTVSFIEGDGVGPEISQSVKDIFSAA 60
           MLR  L    RR ++++     G         G++ ++ I G+G+G E++ SV+ IF A 
Sbjct: 1   MLRNTLL---RRSISTISPKKYG---------GRFQITLIPGNGIGKEVTDSVRSIFQAE 48

Query: 61  SVPVEWEYCDVTPLLVNGLTTIPEPAVASINKNLVALKGPLATPIGKGHRSLNLTLRKTF 120
           ++P++WE  ++     +G+ T    AV SI +N +ALKG  ++    G  SLN+ LRK  
Sbjct: 49  NLPIDWEIVNIESHR-DGIKT----AVDSIKRNKIALKGIWSSDPIDG--SLNVALRKQL 101

Query: 121 GLFANVRPAKSIEGYKTTYSDVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLITREASER 180
            +FANV   KS +   T   +VDLV+IRENTEGE+SG+EH    GVV+S+K++T+  +ER
Sbjct: 102 DIFANVAIFKSFDNVNTRIPNVDLVVIRENTEGEFSGLEHESVDGVVESLKIVTKPKTER 161

Query: 181 VIRYAFEYARTVGRPKVVVVHKSTIQRLADGLFVNVAQELG-REYPDIELQTELLDNTVL 239
           + R+AF++A+   R  V  VHK+ I +L DGLF N+   +G  EYP+I+  + ++DN  +
Sbjct: 162 IARFAFDFAKKHNRNHVTAVHKANIMKLGDGLFKNIVAHIGNNEYPEIKNSSIIVDNASM 221

Query: 240 NVVTKPEAYKDVVAVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHQVSIFEAVHGS--- 296
             V KP  +   V V P++YG I                  AN G   ++FE   GS   
Sbjct: 222 QAVAKPHQFD--VLVSPSMYGTI-LGNIGAALIGGPGLVPGANFGRDYAVFEP--GSRHV 276

Query: 297 APDIAGQNRANPTALLLSSVMMLNHMGLHEHAGRIEKAVLSTIASSRENRTADLAGTAST 356
             DI GQN ANPTA++LS+  ML H+GL   A RI  AV   IA      T D+ GTAST
Sbjct: 277 GLDIKGQNVANPTAMILSATWMLRHLGLTSPAERITNAVKHVIAQG-TTVTKDIGGTAST 335

Query: 357 SSFTNAVIERL 367
           + FT+AVI  L
Sbjct: 336 TEFTDAVINEL 346

>Suva_14.302 Chr14 (546468..547370) [903 bp, 300 aa] {ON} YNL037C
           (REAL)
          Length = 300

 Score =  214 bits (545), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 119/283 (42%), Positives = 173/283 (61%), Gaps = 13/283 (4%)

Query: 32  AGKYTVSFIEGDGVGPEISQSVKDIFSAASVPVEWEYCDVTPLLVNGLTTIPEPAVASIN 91
            G++TV+ I GDGVG E++ SVK IF A ++P++WE  ++     +    + E AV S+ 
Sbjct: 26  GGRFTVTLIPGDGVGKEVTDSVKTIFEAENIPIDWETINIKQ--TDHKEGVNE-AVESLR 82

Query: 92  KNLVALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPAKSIEGYKTTYSDVDLVLIREN 150
           +N + LKG   TP  + GH SLN+ LRK   ++ANV   KS++G KT   D+DL++IREN
Sbjct: 83  RNKIGLKGLWHTPADQTGHGSLNVALRKQLDIYANVALFKSLKGVKTRIPDIDLIVIREN 142

Query: 151 TEGEYSGIEHVVSPGVVQSIKLITREASERVIRYAFEYARTVGRPKVVVVHKSTIQRLAD 210
           TEGE+SG+EH   PGVV+S+K++T+  +ER+ R+AF++A+   R  V  VHK+ I +L D
Sbjct: 143 TEGEFSGLEHESVPGVVESLKIMTKPKTERIARFAFDFAKKYNRKAVTAVHKANIMKLGD 202

Query: 211 GLFVNVAQELG-REYPDIELQTELLDNTVLNVVTKPEAYKDVVAVCPNLYGDIXXXXXXX 269
           GLF N+  E+G +EYPDI++ + ++DN  +  V KP  +   V V P++YG I       
Sbjct: 203 GLFRNIITEIGQKEYPDIDVSSIIVDNASMQAVAKPHQFD--VLVTPSMYGTI-LGNIGA 259

Query: 270 XXXXXXXXXXXANIGHQVSIFEAVHGS---APDIAGQNRANPT 309
                      AN G   ++FE   GS     DI GQN ANPT
Sbjct: 260 ALIGGPGLVAGANFGRDYAVFEP--GSRHVGLDIKGQNVANPT 300

>CAGL0G02585g Chr7 (238931..240049) [1119 bp, 372 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094c LYS12 homo-isocitrate dehydrogenase
          Length = 372

 Score =  159 bits (402), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 125/385 (32%), Positives = 194/385 (50%), Gaps = 36/385 (9%)

Query: 6   LFQGSRRWLASVRQPSIGRYAGKPNAAGKYTVSFIEGDGVGPEISQSVKDIFS--AASVP 63
           + +GS   L ++R  S  R A K       T+  I GDG+G E+  + K I         
Sbjct: 1   MLRGSATRLTAMRGFSSTRLAQK-----ALTIGLIPGDGIGKEVIPAGKQILEKVGPKFD 55

Query: 64  VEWEYCDVTP---LLVNGLTTIPEPAVASINKNLV-ALKGPLATPIGK--GHRSLNLTLR 117
           +++++ D+        N    +P+  V  + ++   AL G + +P  K  G+ S  + LR
Sbjct: 56  LDFKFIDLHAGWETFQNTGKALPDETVEVLRRDCQGALFGAVQSPTTKVEGYSSPIVALR 115

Query: 118 KTFGLFANVRPAKSIEGYKTTYSDVDLVLIRENTEGEYSGIEHVVS-PG----VVQSIKL 172
           K  GLFANVRP K++EG  T    VD+V++RENTE  Y  IE   + P     V ++ K 
Sbjct: 116 KAMGLFANVRPVKAVEG--TNDRPVDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKR 173

Query: 173 ITREASERVIRYAFEYA----RTVGRPKVVVVHKSTIQRLADGLFVNVAQEL----GREY 224
           I+  A+ R+   A + A    ++ G   + V HKS +   +DGLF  + +++      +Y
Sbjct: 174 ISEVATRRIATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKY 233

Query: 225 PDIELQTELLDNTVLNVVTKPEAYKDVVAVCPNLYGDIXXXXXXXXXXXXXXXXXXANIG 284
             I+   +++D+ V  +  +PE +  VVA  PNLYGDI                  AN+G
Sbjct: 234 GKIQYNEQIVDSMVYRMFREPECFDVVVA--PNLYGDILSDGAAALVGSLGVVPS-ANVG 290

Query: 285 HQVSIFEAVHGSAPDIAGQNRANPTALLLSSVMMLNHMGLHEHAGRIEKAVLSTIASSRE 344
            ++ I E  HGSAPDIAG+  ANP A + S+ +ML  +G  E A  I KAV S I   RE
Sbjct: 291 PEIVIGEPCHGSAPDIAGRGIANPIATIRSTALMLEFLGYPEAAQPIYKAVDSNI---RE 347

Query: 345 N--RTADLAGTASTSSFTNAVIERL 367
           N  +T DL G ++T    + ++ ++
Sbjct: 348 NQIKTPDLGGKSTTQQVVDDILSKI 372

>TBLA0B05940 Chr2 complement(1402869..1403978) [1110 bp, 369 aa]
           {ON} Anc_2.287 YIL094C
          Length = 369

 Score =  159 bits (402), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 125/375 (33%), Positives = 189/375 (50%), Gaps = 33/375 (8%)

Query: 16  SVRQPSIGRYAGKPNAAGKYTVSFIEGDGVGPEISQSVKDIFSAASVP--VEWEYCDVTP 73
           SVRQ S+   A   ++    T+  I GDG+G E+  + K +    +    + +E+ D+  
Sbjct: 5   SVRQFSVS--ARNASSLKTLTIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEFIDLQA 62

Query: 74  LLVNGLTT---IPEPAVASI-NKNLVALKGPLATPIGK--GHRSLNLTLRKTFGLFANVR 127
                L T   +P   V  + NK   AL G + +P  K  G+ S  + LRK  GLFANVR
Sbjct: 63  GYQTFLDTGAALPRDTVDILKNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGLFANVR 122

Query: 128 PAKSIEGYKTTYSDVDLVLIRENTEGEYSGIEHVVS-----PGVVQSIKLITREASERVI 182
           P K++EG  T    +DLV++RENTE  Y  IE   +       + ++ K IT  A++R+ 
Sbjct: 123 PVKTVEG--TDAKPIDLVIVRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIA 180

Query: 183 RYAFEYA----RTVGRPKVVVVHKSTIQRLADGLFVNVAQELGRE----YPDIELQTELL 234
           + A + A    +T G   + V HKS +   +DGLF  V +E+       Y  +    +++
Sbjct: 181 KTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIV 240

Query: 235 DNTVLNVVTKPEAYKDVVAVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHQVSIFEAVH 294
           D+ V  +  +PE +  +VA  PNLYGDI                  AN+G  + I E  H
Sbjct: 241 DSMVYRLFREPECFDVIVA--PNLYGDILSDGAAALVGSLGLVPS-ANVGPNIVIGEPCH 297

Query: 295 GSAPDIAGQNRANPTALLLSSVMMLNHMGLHEHAGRIEKAVLSTIASSREN--RTADLAG 352
           GSAPDIAG+  ANP A + S+  ML ++G    A  I KAV + I   R+N  +TADL G
Sbjct: 298 GSAPDIAGKGIANPIATIRSTAQMLEYLGYSNPAQDIYKAVDANI---RDNKIKTADLGG 354

Query: 353 TASTSSFTNAVIERL 367
            ++T    + ++ +L
Sbjct: 355 DSTTQQVIDDILGKL 369

>Kpol_1003.39 s1003 complement(96083..97195) [1113 bp, 370 aa] {ON}
           complement(96083..97195) [1113 nt, 371 aa]
          Length = 370

 Score =  157 bits (396), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 111/358 (31%), Positives = 183/358 (51%), Gaps = 27/358 (7%)

Query: 31  AAGKYTVSFIEGDGVGPEISQSVKDIFS--AASVPVEWEYCDVTPLLVNGLTT---IPEP 85
           A    T+  I GDG+G E+  + K +         +++++ D+       L T   +P+ 
Sbjct: 19  ARSNLTIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFKFIDLHAGWQTFLDTGKALPDE 78

Query: 86  AVASINKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGYKTTYSDV 142
            V+ + +    AL G + +P  K  G+ S  + LRK  GL+AN+RP KS+ G  T    V
Sbjct: 79  TVSILKQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLGLYANIRPVKSVSG--TNDRPV 136

Query: 143 DLVLIRENTEGEY-----SGIEHVVSPGVVQSIKLITREASERVIRYAFEYA----RTVG 193
           D+V++RENTE  Y     + I+      V ++ K I+  A+ ++ + A + A    +  G
Sbjct: 137 DMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRKIAKIALDIALQRLKNTG 196

Query: 194 RPKVVVVHKSTIQRLADGLFVNVAQELGRE----YPDIELQTELLDNTVLNVVTKPEAYK 249
           +  + V HKS +   +DGLF  V +++  +    Y ++    +++D+ V  +  +PE + 
Sbjct: 197 KATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQIVDSMVYRIFREPECFD 256

Query: 250 DVVAVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHQVSIFEAVHGSAPDIAGQNRANPT 309
            VVA  PNLYGDI                  AN+G  + I E  HGSAPDI+GQ  +NP 
Sbjct: 257 VVVA--PNLYGDILSDGAAALVGSLGVVPS-ANVGPDIIIGEPCHGSAPDISGQGISNPV 313

Query: 310 ALLLSSVMMLNHMGLHEHAGRIEKAVLSTIASSRENRTADLAGTASTSSFTNAVIERL 367
           A + S+ +ML  +G +E A  I+ AV   I S +  +T DL G +ST+  T+ ++ +L
Sbjct: 314 ATIRSAALMLQFLGYNEAAKDIQNAVDENIRSGKI-KTPDLGGDSSTTEVTDDILSKL 370

>SAKL0E07656g Chr5 (620028..621134) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094C LYS12 Homo-isocitrate dehydrogenase an
           NAD-linked mitochondrial enzyme required for the fourth
           step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 368

 Score =  157 bits (396), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 122/390 (31%), Positives = 190/390 (48%), Gaps = 45/390 (11%)

Query: 1   MLRQKLFQGSRRWLASVRQPSIGRYAGKPNAAGKYTVSFIEGDGVGPEISQSVKDIFSAA 60
           MLR  + Q +RR  AS  +P               T+  I GDG+G E+  + K +    
Sbjct: 1   MLRSTVSQFARRSYASAAKP--------------LTIGLIPGDGIGKEVIPAGKLVLENL 46

Query: 61  SVP--VEWEYCDVTPLLVNGLTT---IPEPAVASINKNLV-ALKGPLATPIGK--GHRSL 112
           S    +++ + D+       L T   +P+  +  +  +   AL G + +P  K  G+ S 
Sbjct: 47  SSKHNLKFNFIDLQAGWQTFLDTGKALPDETIEILKSDCQGALFGAVQSPTNKVEGYSSP 106

Query: 113 NLTLRKTFGLFANVRPAKSIEGYKTTYSDVDLVLIRENTEGEY-----SGIEHVVSPGVV 167
            + LRK  GL+ANVRP KS++G  T    VD++++RENTE  Y     + I+      V 
Sbjct: 107 IVALRKKLGLYANVRPVKSVQG--TNDRPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVA 164

Query: 168 QSIKLITREASERVIRYAFEYA----RTVGRPKVVVVHKSTIQRLADGLF----VNVAQE 219
           ++IK I+  A+  + + A E +    +  G+  + V HKS +   +DGLF     NV + 
Sbjct: 165 EAIKRISETATTDIAKIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYES 224

Query: 220 LGREYPDIELQTELLDNTVLNVVTKPEAYKDVVAVCPNLYGDIXXXXXXXXXXXXXXXXX 279
               Y  I    +++D+ V  +  +PE +  +VA  PNLYGDI                 
Sbjct: 225 NKERYGAIGYNEQIVDSMVYRLFREPECFDVIVA--PNLYGDILSDGAAALVGSLGVVPS 282

Query: 280 XANIGHQVSIFEAVHGSAPDIAGQNRANPTALLLSSVMMLNHMGLHEHAGRIEKAVLSTI 339
            AN+GH   + E  HGSAPDIAG+  +NP A + S+ +ML  MG  E A  I KAV + I
Sbjct: 283 -ANVGHDFIVGEPCHGSAPDIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVDTNI 341

Query: 340 ASSREN--RTADLAGTASTSSFTNAVIERL 367
              REN  +T DL G ++T    + ++ ++
Sbjct: 342 ---RENQIKTPDLGGKSTTQQVVDDILSKM 368

>YIL094C Chr9 complement(186517..187632) [1116 bp, 371 aa] {ON}
           LYS12Homo-isocitrate dehydrogenase, an NAD-linked
           mitochondrial enzyme required for the fourth step in the
           biosynthesis of lysine, in which homo-isocitrate is
           oxidatively decarboxylated to alpha-ketoadipate
          Length = 371

 Score =  155 bits (391), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 122/366 (33%), Positives = 182/366 (49%), Gaps = 40/366 (10%)

Query: 30  NAAGK-YTVSFIEGDGVGPEISQSVKDIFSAASVP--VEWEYCDVTPLLVNGLTTIPEPA 86
           NAA K  T+  I GDG+G E+  + K +    +    + + + D    L  G  T  E  
Sbjct: 18  NAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFID----LYAGFQTFQETG 73

Query: 87  VASINKNLVALK--------GPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGYK 136
            A  ++ +  LK        G + +P  K  G+ S  + LR+  GLFANVRP KS+EG K
Sbjct: 74  KALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLFANVRPVKSVEGEK 133

Query: 137 TTYSDVDLVLIRENTEGEYSGIEHV-----VSPGVVQSIKLITREASERVIRYAFEYA-- 189
                +D+V++RENTE  Y  IE           V  + K I+  A+ R+   A + A  
Sbjct: 134 G--KPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIATIALDIALK 191

Query: 190 --RTVGRPKVVVVHKSTIQRLADGLFVNVAQEL----GREYPDIELQTELLDNTVLNVVT 243
             +T G+  + V HKS +   +DGLF  + +E+      +Y  I+   +++D+ V  +  
Sbjct: 192 RLQTRGQATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQIVDSMVYRLFR 251

Query: 244 KPEAYKDVVAVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHQVSIFEAVHGSAPDIAGQ 303
           +P+ +  +VA  PNLYGDI                  AN+G ++ I E  HGSAPDIAG+
Sbjct: 252 EPQCFDVIVA--PNLYGDILSDGAAALVGSLGVVPS-ANVGPEIVIGEPCHGSAPDIAGK 308

Query: 304 NRANPTALLLSSVMMLNHMGLHEHAGRIEKAVLSTIASSREN--RTADLAGTASTSSFTN 361
             ANP A + S+ +ML  +G +E A  I KAV + +   RE   +T DL G AST    +
Sbjct: 309 GIANPIATIRSTALMLEFLGHNEAAQDIYKAVDANL---REGSIKTPDLGGKASTQQVVD 365

Query: 362 AVIERL 367
            V+ RL
Sbjct: 366 DVLSRL 371

>KLLA0E08339g Chr5 (750670..751779) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094C LYS12 Homo-isocitrate dehydrogenase an
           NAD-linked mitochondrial enzyme required for the fourth
           step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 369

 Score =  154 bits (389), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 128/391 (32%), Positives = 187/391 (47%), Gaps = 47/391 (12%)

Query: 1   MLRQKLFQGSRRWLASVRQPSIGRYAGKPNAAGKYTVSFIEGDGVGPEISQSVKDIFSAA 60
           M+R +  Q SRR  AS               A   T+  I GDG+G E+  + K I  + 
Sbjct: 1   MMRTRFIQLSRRAYAS--------------NAKNLTIGLIPGDGIGKEVIPAGKKILESL 46

Query: 61  S--VPVEWEYCDVTP---LLVNGLTTIPEPAVASINKNLV--ALKGPLATPIGK--GHRS 111
           +    + +++ D+        N    +P+  +  I KN    AL G + +P  K  G+ S
Sbjct: 47  NPKYGLSFKFIDLQAGWETFQNTGKALPDETI-DILKNQCEGALFGAVQSPTTKVEGYSS 105

Query: 112 LNLTLRKTFGLFANVRPAKSIEGYKTTYSDVDLVLIRENTEGEY-----SGIEHVVSPGV 166
             + LRK  GLFANVRP KS++G K     VDLV++RENTE  Y     S I+      V
Sbjct: 106 PIVALRKNLGLFANVRPVKSVDGTKD--RKVDLVIVRENTEDLYIKLEKSYIDEATGTRV 163

Query: 167 VQSIKLITREASERVIRYAFEYARTV----GRPKVVVVHKSTIQRLADGLFVNVAQEL-- 220
             + K IT  A++ +   A + A+      G   + V HKS +   +DGLF  V +E   
Sbjct: 164 ADATKRITEIATKNIATIALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYE 223

Query: 221 --GREYPDIELQTELLDNTVLNVVTKPEAYKDVVAVCPNLYGDIXXXXXXXXXXXXXXXX 278
               +Y  ++   +++D+ V  +  +PE +  VVA  PNLYGDI                
Sbjct: 224 ANKDKYGGVQYNEQIVDSMVYRMFREPECFDVVVA--PNLYGDILSDGAAALVGSLGVVP 281

Query: 279 XXANIGHQVSIFEAVHGSAPDIAGQNRANPTALLLSSVMMLNHMGLHEHAGRIEKAVLST 338
             AN+G  + I E  HGSAPDIAG+  +NP A + S+ +ML  +G  E A  I KAV + 
Sbjct: 282 S-ANVGPNIVIGEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGYPEPAKDIHKAVDAN 340

Query: 339 IASSRENR--TADLAGTASTSSFTNAVIERL 367
           I   RE +  T DL G ++T      V+ +L
Sbjct: 341 I---REGKYLTPDLGGNSTTQQVLEDVLSKL 368

>TPHA0C03410 Chr3 complement(748639..749754) [1116 bp, 371 aa] {ON}
           Anc_2.287 YIL094C
          Length = 371

 Score =  154 bits (389), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 127/392 (32%), Positives = 195/392 (49%), Gaps = 46/392 (11%)

Query: 1   MLRQKLFQGSRRWLASVRQPSIGRYAGKPNAAGKYTVSFIEGDGVGPEISQSVKDIFSAA 60
           MLR+ ++  +R++     Q +IG  + K N     T+  I GDG+G E+  S + +    
Sbjct: 1   MLRRSVY--NRQF-----QRTIGNISKKSN----LTIGLIPGDGIGKEVIPSGRQVLETI 49

Query: 61  SVP--VEWEYCDVTPLLVNGLTT---IPEPAVASINKNLV-ALKGPLATPIGK--GHRSL 112
                + + + D+       L T   +P   V ++ +N   AL G + +P  K  G+ S 
Sbjct: 50  GPKHGLTFNFIDLQAGWQTFLDTGKALPVETVKTLRENCDGALFGAVQSPTTKVEGYSSP 109

Query: 113 NLTLRKTFGLFANVRPAKSIE--GYKTTYSDVDLVLIRENTEGEYSGIEHV-----VSPG 165
            + LRK  GL+AN+RP KS++  G K     VD+V++RENTE  Y  +E           
Sbjct: 110 IVALRKELGLYANIRPVKSVDTPGNKK----VDMVIVRENTEDLYIKLEKTYIDEKTGTR 165

Query: 166 VVQSIKLITREASERVIRYAFEYA----RTVGRPKVVVVHKSTIQRLADGLFVNVAQELG 221
           V  + K I+  A+ R+ + A + A    +  G  ++ V HKS +   +DGLF  V +E+ 
Sbjct: 166 VADATKRISEVATRRIAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVF 225

Query: 222 RE----YPDIELQTELLDNTVLNVVTKPEAYKDVVAVCPNLYGDIXXXXXXXXXXXXXXX 277
                 Y DI+   +++D+ V  +  +PE +  +VA  PNLYGDI               
Sbjct: 226 ESNKTLYSDIQYNEQIIDSMVYRLFREPECFDVIVA--PNLYGDILSDGAAALVGSLGVV 283

Query: 278 XXXANIGHQVSIFEAVHGSAPDIAGQNRANPTALLLSSVMMLNHMGLHEHAGRIEKAVLS 337
              AN+G  + I E  HGSAPDIAG+  +NP A + S+ +ML  +G  + A  I+ AV S
Sbjct: 284 PS-ANVGPGIVIGEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQDIQTAVDS 342

Query: 338 TIASSREN--RTADLAGTASTSSFTNAVIERL 367
            +   RE+  +T DL G  STS   N VI RL
Sbjct: 343 NL---REDKIKTPDLGGKNSTSDVVNDVIRRL 371

>KNAG0A05420 Chr1 (799521..800639) [1119 bp, 372 aa] {ON} 
          Length = 372

 Score =  154 bits (389), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 118/364 (32%), Positives = 185/364 (50%), Gaps = 36/364 (9%)

Query: 30  NAAGK-YTVSFIEGDGVGPEISQSVKDIFSAASVP--VEWEYCDVTPLLVNGLTT----- 81
           NAA K  T+  I GDG+G E+  + K +  + +    + +++ D    L  G  T     
Sbjct: 19  NAARKSLTIGLIPGDGIGKEVIPAGKQVLQSLNPKHGLNFDFID----LQAGFQTFQDTG 74

Query: 82  --IPEPAVASINKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGYK 136
             +P+  V  + +    AL G + +P  K  G+ S  + LRK  GL+AN+RP KS+EG  
Sbjct: 75  KALPDETVQILKEKCQGALFGAVQSPTTKVEGYSSPIVALRKAMGLYANIRPVKSVEG-- 132

Query: 137 TTYSDVDLVLIRENTEGEYSGIEHV-----VSPGVVQSIKLITREASERVIRYAFEYA-- 189
           +    VD++++RENTE  Y  IE           V ++ K I+  A++R+   A + A  
Sbjct: 133 SNERPVDMIIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATQRIATIALDIALQ 192

Query: 190 --RTVGRPKVVVVHKSTIQRLADGLFVNVAQEL----GREYPDIELQTELLDNTVLNVVT 243
             +  G+  + V HKS +   +DGLF  V +E+      +Y  I    +++D+ V  +  
Sbjct: 193 RLQNNGKATLTVTHKSNVLSQSDGLFREVCREMYEANKDKYAGITYNEQIVDSMVYRMFR 252

Query: 244 KPEAYKDVVAVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHQVSIFEAVHGSAPDIAGQ 303
           +PE +  +VA  PNLYGDI                  AN+G ++ I E  HGSAPDIAG+
Sbjct: 253 EPECFDVIVA--PNLYGDILSDGAAALVGSLGVVPS-ANVGPEIVIGEPCHGSAPDIAGK 309

Query: 304 NRANPTALLLSSVMMLNHMGLHEHAGRIEKAVLSTIASSRENRTADLAGTASTSSFTNAV 363
             ANP A + S+ +ML  +G +E A  I KAV + +      +TADL G A+T +  + +
Sbjct: 310 GIANPIATIRSTALMLEFLGHNEAAQDIHKAVDANLRDGLV-KTADLGGNATTQNVVDDI 368

Query: 364 IERL 367
           + RL
Sbjct: 369 LARL 372

>ADL214C Chr4 complement(328094..329197) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL094C
           (LYS12)
          Length = 367

 Score =  153 bits (387), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 113/354 (31%), Positives = 176/354 (49%), Gaps = 30/354 (8%)

Query: 36  TVSFIEGDGVGPEISQSVKDIFSAA----SVPVEWEYCDV--TPLLVNGLTTIPEPAVAS 89
           T+  I GDG+G E+  + + +  A      +   +E+ D      L  G   +P   V +
Sbjct: 22  TIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLDAGWQTFLETG-NALPGATVEA 80

Query: 90  INKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGYKTTYSDVDLVL 146
           + +    AL G + +P  K  G+ S  + LR+  GL+AN+RP KS+ G   T   VDLV+
Sbjct: 81  LRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANIRPVKSVSG---TGQPVDLVI 137

Query: 147 IRENTEGEY-----SGIEHVVSPGVVQSIKLITREASERV----IRYAFEYARTVGRPKV 197
           +RENTE  Y     + ++      V ++IK I+  A+ER+    +R A +  R  GR  +
Sbjct: 138 VRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLALQRQRMGGRGAL 197

Query: 198 VVVHKSTIQRLADGLFVNVAQEL----GREYPDIELQTELLDNTVLNVVTKPEAYKDVVA 253
            V HKS +    DGLF  V +E+     + Y  IE   +++D+ V  +  +P  +  VVA
Sbjct: 198 TVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLFKEPHCFDVVVA 257

Query: 254 VCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHQVSIFEAVHGSAPDIAGQNRANPTALLL 313
             PNLYGD+                   N+G+ + I E  HGSAPDIAG+  ANP A + 
Sbjct: 258 --PNLYGDLLSDGAAALVGSLGLVPS-VNVGNNIIIGEPCHGSAPDIAGRGIANPIATIR 314

Query: 314 SSVMMLNHMGLHEHAGRIEKAVLSTIASSRENRTADLAGTASTSSFTNAVIERL 367
           S  +ML  +GL E A  I++AV   +   R+  + DL G  +T    + ++ R+
Sbjct: 315 SVSLMLQFLGLEEAASDIDQAVTGNL-KDRQVVSPDLGGKNTTQEVLDDILARI 367

>Suva_9.105 Chr9 complement(180626..181741) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  153 bits (386), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 121/366 (33%), Positives = 181/366 (49%), Gaps = 40/366 (10%)

Query: 30  NAAGK-YTVSFIEGDGVGPEISQSVKDIFSAASVP--VEWEYCDVTPLLVNGLTTIPEPA 86
           NAA K  T+  I GDG+G E+  + K I    +    + + + D    L  G  T  E  
Sbjct: 18  NAARKSLTIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFID----LYAGFQTFQETG 73

Query: 87  VASINKNLVALK--------GPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGYK 136
            A  ++ +  LK        G + +P  K  G+ S  + LR+  GL+ANVRP KS+EG K
Sbjct: 74  KALPDETIKVLKDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLYANVRPVKSVEGTK 133

Query: 137 TTYSDVDLVLIRENTEGEYSGIEHV-----VSPGVVQSIKLITREASERVIRYAFEYA-- 189
                +D+V++RENTE  Y  IE           V  +IK I+  A+ R+ + A + A  
Sbjct: 134 D--KPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRRIAKIALDIALQ 191

Query: 190 --RTVGRPKVVVVHKSTIQRLADGLFVNVAQEL----GREYPDIELQTELLDNTVLNVVT 243
             +T G   + V HKS +   +DGLF  + +++      +Y  I+   +++D+ V  +  
Sbjct: 192 RLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQIVDSMVYRLFR 251

Query: 244 KPEAYKDVVAVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHQVSIFEAVHGSAPDIAGQ 303
           +P+ +  +VA  PNLYGDI                  AN+G  + I E  HGSAPDIAG+
Sbjct: 252 EPQCFDVIVA--PNLYGDILSDGAAALVGSLGVVPS-ANVGPDIVIGEPCHGSAPDIAGK 308

Query: 304 NRANPTALLLSSVMMLNHMGLHEHAGRIEKAVLSTIASSREN--RTADLAGTASTSSFTN 361
             ANP A + S+ +ML  +G ++ A  I KAV + +   RE    T DL G AST    +
Sbjct: 309 GIANPIATIRSTALMLEFLGHNDAAQDIYKAVDANL---REGAITTPDLGGKASTQQVVD 365

Query: 362 AVIERL 367
            V+ RL
Sbjct: 366 DVLSRL 371

>Ecym_3326 Chr3 complement(624805..625905) [1101 bp, 366 aa] {ON}
           similar to Ashbya gossypii ADL214C
          Length = 366

 Score =  152 bits (385), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 112/355 (31%), Positives = 176/355 (49%), Gaps = 30/355 (8%)

Query: 35  YTVSFIEGDGVGPEISQSVKDIFS--AASVPVEWEYCDVTPLLVNGLTT---IPEPAVAS 89
           +T+  I GDG+G E+    + +         V+++Y D+       L T   +P+  V  
Sbjct: 20  FTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQAGWQTFLDTGKALPDDTVEQ 79

Query: 90  INKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGYKTTYSDVDLVL 146
           +  N   AL G + +P  K  G+ S  + LRK  GL+AN+RP KS++G  T    VDLV+
Sbjct: 80  LRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIRPVKSVDG--TGDRPVDLVI 137

Query: 147 IRENTEGEY-----SGIEHVVSPGVVQSIKLITREASERVIRYAFEYA----RTVGRPKV 197
            RENTE  Y     + I+      V ++IK I+  A+  +   A E A    +  G   +
Sbjct: 138 ARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEIALQRLKEKGHATL 197

Query: 198 VVVHKSTIQRLADGLFVNVAQEL---GREYPDIELQTELLDNTVLNVVTKPEAYKDVVAV 254
            V HKS +   +DGLF  + + +    +++ +++   +++D+ V  +  +P+ +  +VA 
Sbjct: 198 TVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVDSMVYRLFKEPQCFDVIVA- 256

Query: 255 CPNLYGDIXXXXXXXXXXXXXXXXXXANIGHQVSIFEAVHGSAPDIAGQNRANPTALLLS 314
            PNLYGDI                   N+G  + I E  HGSAPDI GQ  ANP A + S
Sbjct: 257 -PNLYGDILSDGAAALVGSLGVVPS-VNVGPNIVIGEPCHGSAPDIVGQGIANPIATIRS 314

Query: 315 SVMMLNHMGLHEHAGRIEKAVLSTIASSREN--RTADLAGTASTSSFTNAVIERL 367
           + ++L  +GL E A  IEK V   I   REN  +T DL G ++     N ++ R+
Sbjct: 315 AALLLEFLGLPEAARHIEKVVDENI---RENKIKTPDLGGNSTGEQVANDILSRI 366

>NDAI0B03550 Chr2 (891508..892626) [1119 bp, 372 aa] {ON} Anc_2.287
           YIL094C
          Length = 372

 Score =  152 bits (385), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 112/354 (31%), Positives = 182/354 (51%), Gaps = 28/354 (7%)

Query: 36  TVSFIEGDGVGPEISQSVKDIFSAASVP--VEWEYCDVTPLLVNGLTT---IPEPAVASI 90
           T+  I GDG+G E+  + K +    +    + +++ D+       L T   +P+  +  +
Sbjct: 25  TIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFIDLQAGFQTFLDTGKALPDETIQVL 84

Query: 91  -NKNLVALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGYKTTYSDVDLVLI 147
            N+   AL G + +P  K  G+ S  + LRK  GL+ANVRP KS+EG  TT   VD+V++
Sbjct: 85  KNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLYANVRPVKSVEG--TTDKPVDMVIV 142

Query: 148 RENTEG------EYSGIEHVVSPGVVQSIKLITREASERVIRYAFEYA----RTVGRPKV 197
           RENT        E + I+      V ++ K I+  A+ R+   A + A    +T G+  +
Sbjct: 143 RENTRRFINIKLERTYIDRATGTRVAEATKRISEIATRRIATIALDIALQRLKTNGKATL 202

Query: 198 VVVHKSTIQRLADGLFVNVAQEL----GREYPDIELQTELLDNTVLNVVTKPEAYKDVVA 253
            V HKS +   +DGLF  + +++      +Y  I    +++D+ V  +  +P+ +  VVA
Sbjct: 203 TVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNEQIVDSMVYRMFREPQCFDVVVA 262

Query: 254 VCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHQVSIFEAVHGSAPDIAGQNRANPTALLL 313
             PNLYGDI                  AN+G ++ I E  HGSAPDIAG+  +NP A + 
Sbjct: 263 --PNLYGDILSDGAAALVGSLGVVPS-ANVGPEIVIGEPCHGSAPDIAGKGISNPIATIR 319

Query: 314 SSVMMLNHMGLHEHAGRIEKAVLSTIASSRENRTADLAGTASTSSFTNAVIERL 367
           S+ +ML  +G +E A  I +AV + +  ++  +T DL G ++T   T  V+ RL
Sbjct: 320 STALMLEFLGHNEAAQDIHRAVEANLKENKV-KTPDLGGKSTTQEVTEDVLARL 372

>NCAS0B06250 Chr2 (1179360..1180481) [1122 bp, 373 aa] {ON}
           Anc_2.287
          Length = 373

 Score =  152 bits (384), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 115/355 (32%), Positives = 179/355 (50%), Gaps = 31/355 (8%)

Query: 36  TVSFIEGDGVGPEISQSVKDIFSAASVP--VEWEYCDVTPLLVNGLTT---IPEPAVASI 90
           T+  I GDG+G E+  + K +    +    +++++ D+       L T   +P+  V  +
Sbjct: 27  TIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFDFIDLQAGFQTFLDTGKALPDETVQVL 86

Query: 91  NKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGYKTTYSDVDLVLI 147
                 AL G + +P  K  G+ S  + LRK  GLFANVRP KS+ G K     VD+V++
Sbjct: 87  KSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLFANVRPVKSVSGTKD--RPVDMVIV 144

Query: 148 RENTEGEYSGIEHV-----VSPGVVQSIKLITREASERVIRYAFEYA----RTVGRPKVV 198
           RENTE  Y  IE           V ++ K I+  A+ R+   A + A    +  G+  + 
Sbjct: 145 RENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATRRIATIALDIALQRLKVNGKATLT 204

Query: 199 VVHKSTIQRLADGLFVNVAQEL----GREYPDIELQTELLDNTVLNVVTKPEAYKDVVAV 254
           V HKS +   +DGLF  + +++      +Y  I    +++D+ V  +  +P+ +  +VA 
Sbjct: 205 VTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYNEQIVDSMVYRMFREPQCFDVIVA- 263

Query: 255 CPNLYGDIXXXXXXXXXXXXXXXXXXANIGHQVSIFEAVHGSAPDIAGQNRANPTALLLS 314
            PNLYGDI                  AN+G ++ I E  HGSAPDIAG+  ANP A + S
Sbjct: 264 -PNLYGDILSDGAAALVGSLGVVPS-ANVGPEIVIGEPCHGSAPDIAGKGIANPIATIRS 321

Query: 315 SVMMLNHMGLHEHAGRIEKAVLSTIASSREN--RTADLAGTASTSSFTNAVIERL 367
           + +ML  +G ++ A  I +AV    A+ REN  +T DL G ++T   T  V+ RL
Sbjct: 322 TALMLEFLGHNDAAQDIHRAVE---ANMRENKIKTPDLGGNSTTQQVTEDVLARL 373

>Smik_9.85 Chr9 complement(165648..166763) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  151 bits (381), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 121/366 (33%), Positives = 179/366 (48%), Gaps = 40/366 (10%)

Query: 30  NAAGK-YTVSFIEGDGVGPEISQSVKDIFSAASVP--VEWEYCDVTPLLVNGLTTIPEPA 86
           NAA K  T+  I GDG+G E+  + K +    +    + + + D    L  G  T  E  
Sbjct: 18  NAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFID----LYAGFQTFQETG 73

Query: 87  VASINKNLVALK--------GPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGYK 136
            A  ++ +  LK        G + +P  K  G+ S  + LR+  GLFANVRP KS+EG K
Sbjct: 74  KALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLFANVRPVKSVEGGK 133

Query: 137 TTYSDVDLVLIRENTEGEYSGIEHV-----VSPGVVQSIKLITREASERVIRYAFEYA-- 189
                +D+V++RENTE  Y  IE           V  + K I+  A+ R+   A + A  
Sbjct: 134 D--KPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIATIAMDIALK 191

Query: 190 --RTVGRPKVVVVHKSTIQRLADGLFVNVAQEL----GREYPDIELQTELLDNTVLNVVT 243
             +T G   + V HKS +   +DGLF  + +E+      +Y  I+   +++D+ V  +  
Sbjct: 192 RLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQIVDSMVYRLFR 251

Query: 244 KPEAYKDVVAVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHQVSIFEAVHGSAPDIAGQ 303
           +P+ +  +VA  PNLYGDI                  AN+G ++ I E  HGSAPDIAG+
Sbjct: 252 EPQCFDVIVA--PNLYGDILSDGAAALVGSLGVVPS-ANVGPEIVIGEPCHGSAPDIAGK 308

Query: 304 NRANPTALLLSSVMMLNHMGLHEHAGRIEKAVLSTIASSREN--RTADLAGTASTSSFTN 361
             ANP A + S+ +ML  +G +  A  I KAV + +   RE   +T DL G AST     
Sbjct: 309 GIANPIATIRSTALMLEFLGHNNAAQDIYKAVDANL---REGAIKTPDLGGKASTQQVVE 365

Query: 362 AVIERL 367
            V+ RL
Sbjct: 366 DVLSRL 371

>Skud_9.79 Chr9 complement(163173..164288) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  149 bits (376), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 121/366 (33%), Positives = 179/366 (48%), Gaps = 40/366 (10%)

Query: 30  NAAGK-YTVSFIEGDGVGPEISQSVKDIFSAASVP--VEWEYCDVTPLLVNGLTT----- 81
           NAA K  T+  I GDG+G E+  + K +    +    + + + D    L  G  T     
Sbjct: 18  NAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFID----LYAGFQTFQETG 73

Query: 82  --IPEPAVASINKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGYK 136
             +P+  V  + K    AL G + +P  K  G+ S  + LR+  GLFANVRP KS+EG +
Sbjct: 74  KALPDETVNVLKKQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLFANVRPVKSVEGSR 133

Query: 137 TTYSDVDLVLIRENTEGEYSGIEHV-----VSPGVVQSIKLITREASERVIRYAFEYA-- 189
                +D+V++RENTE  Y  IE           V  + K I+  A+ R+   A + A  
Sbjct: 134 N--KPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRRIATIALDIALK 191

Query: 190 --RTVGRPKVVVVHKSTIQRLADGLFVNVAQEL----GREYPDIELQTELLDNTVLNVVT 243
             +T G   + V HKS +    DGLF  + +E+      +Y  I+   +++D+ V  +  
Sbjct: 192 RLQTRGEATLTVTHKSNVLSQTDGLFREICKEVYESNKDKYGQIKYNEQIVDSMVYRLFR 251

Query: 244 KPEAYKDVVAVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHQVSIFEAVHGSAPDIAGQ 303
           +P+ +  +VA  PNLYGDI                  AN+G ++ I E  HGSAPDIAG+
Sbjct: 252 EPQCFDVIVA--PNLYGDILSDGAAALVGSLGVVPS-ANVGPEIVIGEPCHGSAPDIAGK 308

Query: 304 NRANPTALLLSSVMMLNHMGLHEHAGRIEKAVLSTIASSREN--RTADLAGTASTSSFTN 361
             ANP A + S+ +ML  +G +  A  I KAV + +   RE    T DL G AST    +
Sbjct: 309 GIANPIATIRSTALMLEFLGHNGAAQDIYKAVDANL---REGAITTPDLGGKASTQQVVD 365

Query: 362 AVIERL 367
            V+ RL
Sbjct: 366 DVLSRL 371

>KAFR0J01360 Chr10 (249197..250318) [1122 bp, 373 aa] {ON} Anc_2.287
           YIL094C
          Length = 373

 Score =  147 bits (372), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 114/354 (32%), Positives = 179/354 (50%), Gaps = 29/354 (8%)

Query: 36  TVSFIEGDGVGPEISQSVKDIFSAASV--PVEWEYCDVTPLLVNGLTT---IPEPAVASI 90
           T+  I GDG+G E+  + K +    S    + + + D+       L T   +P+  V  +
Sbjct: 25  TIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNFIDLEAGFQTFLDTGKALPDETVKVL 84

Query: 91  NKNLVA-LKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGYKTTYSDVDLVLI 147
            +     L G + +P  +   + S  + LRK   L+AN+RP KS+ G  +    VD+V++
Sbjct: 85  KEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQLYANIRPVKSVAGAHSG-KPVDMVIV 143

Query: 148 RENTEGEYSGIEHVVSPG----VVQSIKLITREASERVIRYAFEYA----RTVGRPKVVV 199
           RENTE  Y  IE          V ++ K IT  A+ ++ + A + A    +T G+  + V
Sbjct: 144 RENTEDLYIKIEKSYKDQNGMRVAEATKRITEVATRKIAKIALDVALQRLKTNGKATLTV 203

Query: 200 VHKSTIQRLADGLFVNVAQELGR----EYPDIELQTELLDNTVLNVVTKPEAYKDVVAVC 255
            HKS +   +DGLF  + +++ +    +Y  I    +++D+ V  +  +PE Y DV+ V 
Sbjct: 204 THKSNVLSQSDGLFREICKDVYQANKDKYAGINYNEQIIDSMVYRMFREPE-YFDVI-VA 261

Query: 256 PNLYGDIXXXXXXXXXXXXXXXXXXANIGHQVSIFEAVHGSAPDIAGQNRANPTALLLSS 315
           PNLYGDI                  AN+G  + + E  HGSAPDIAG+  ANP A + S+
Sbjct: 262 PNLYGDILSDGAAALVGSLGVVPS-ANVGPDIVMGEPCHGSAPDIAGKGIANPIATIRST 320

Query: 316 VMMLNHMGLHEHAGRIEKAVLSTIASSREN--RTADLAGTASTSSFTNAVIERL 367
            +ML  +G  E A  I KAV S +   REN  +T DL G +ST +  + V+E+L
Sbjct: 321 ALMLEFLGHKEAAQDIHKAVESNM---RENKIKTPDLGGNSSTQNVVDDVLEKL 371

>TDEL0G02180 Chr7 complement(428789..429898) [1110 bp, 369 aa] {ON}
           Anc_2.287 YIL094C
          Length = 369

 Score =  144 bits (363), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 118/377 (31%), Positives = 187/377 (49%), Gaps = 42/377 (11%)

Query: 21  SIGRYAGK---PNAAGKYTVSFIEGDGVGPEISQSVKDIFSAASVP--VEWEYCDVTPLL 75
           +IGR A +    +A     +  I GDG+G E+  + K +    S    + +++ D    L
Sbjct: 5   AIGRLATRRAYASAPKSMVIGLIPGDGIGKEVIPAGKQVLENLSGKHGLNFDFID----L 60

Query: 76  VNGLTT-------IPEPAVASI-NKNLVALKGPLATPIGK--GHRSLNLTLRKTFGLFAN 125
             G  T       +PE  V  + N+   AL G + +P  K  G+ S  + LRK  GL+AN
Sbjct: 61  QAGWGTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKELGLYAN 120

Query: 126 VRPAKSIEGYKTTYSDVDLVLIRENTEGEYSGIEHV-----VSPGVVQSIKLITREASER 180
           VRP KS+EG K     VD+V++RENTE  Y  +E           V ++ K I+  A+ R
Sbjct: 121 VRPVKSVEGTKD--RPVDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRR 178

Query: 181 VIRYAFEYA----RTVGRPKVVVVHKSTIQRLADGLFVNVAQEL----GREYPDIELQTE 232
           +   A + A    +T G   + V HKS +   +DGLF  + +++      +Y  +    +
Sbjct: 179 IATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQ 238

Query: 233 LLDNTVLNVVTKPEAYKDVVAVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGHQVSIFEA 292
           ++D+ V  +  +PE +  VVA  PNLYGDI                  AN+G ++ I E 
Sbjct: 239 IVDSMVYRMFREPECFDVVVA--PNLYGDILSDGAAALVGSLGVVPS-ANVGPEIVIGEP 295

Query: 293 VHGSAPDIAGQNRANPTALLLSSVMMLNHMGLHEHAGRIEKAVLSTIASSREN--RTADL 350
            HGSAPDIAG+  +NP A + S+ +ML  +G ++ A  I +AV + +   RE+  +T DL
Sbjct: 296 CHGSAPDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDANL---REDKVKTPDL 352

Query: 351 AGTASTSSFTNAVIERL 367
            G ++T      ++ +L
Sbjct: 353 GGNSTTQQVVEDILSKL 369

>KLTH0G10384g Chr7 complement(878375..879478) [1104 bp, 367 aa] {ON}
           highly similar to uniprot|P40495 Saccharomyces
           cerevisiae YIL094C LYS12 Homo-isocitrate dehydrogenase
           an NAD-linked mitochondrial enzyme required for the
           fourth step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 367

 Score =  144 bits (362), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 122/394 (30%), Positives = 186/394 (47%), Gaps = 54/394 (13%)

Query: 1   MLRQKLFQGSRRWLASVRQPSIGRYAGKPNAAGKYTVSFIEGDGVGPEISQSVKDIFSAA 60
           MLR    Q +RR  AS              A+   T+  I GDG+G E+  + + +    
Sbjct: 1   MLRASFTQLARRSYAS--------------ASKSLTIGLIPGDGIGKEVIPAGRQVLENL 46

Query: 61  SVP--VEWEYCDVTPLLVNGLTTIPEPAVA------SINKNLV--ALKGPLATPIGK--G 108
           S    +++++ D    L  G  T  E   A       I +N    AL G + +P  K  G
Sbjct: 47  SSKHGLKFDFID----LQAGWQTFQETGKALPDETIDILRNQCQGALFGAVQSPTNKVEG 102

Query: 109 HRSLNLTLRKTFGLFANVRPAKSIEGYKTTYSDVDLVLIRENTEGEY-----SGIEHVVS 163
           + S  + LRK  GL+ANVRP KS+   +     VD++++RENTE  Y     + I+    
Sbjct: 103 YSSPIVALRKKLGLYANVRPVKSVLPQERP---VDMIIVRENTEDLYIKTEKTYIDEKTG 159

Query: 164 PGVVQSIKLITREASERVIRYAFEYA----RTVGRPKVVVVHKSTIQRLADGLFVNVAQE 219
             V ++IK I+  A++ +   A E A    +  G   + V HKS +   +DGLF  V ++
Sbjct: 160 TRVAEAIKRISETATKNIANIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQ 219

Query: 220 LGREYPD----IELQTELLDNTVLNVVTKPEAYKDVVAVCPNLYGDIXXXXXXXXXXXXX 275
           +     D    I+   +++D+ V  +  +PE +  +VA  PNLYGDI             
Sbjct: 220 VYESNKDKFGSIKYNEQIVDSMVYRMFREPECFDVIVA--PNLYGDILSDGAAALVGSLG 277

Query: 276 XXXXXANIGHQVSIFEAVHGSAPDIAGQNRANPTALLLSSVMMLNHMGLHEHAGRIEKAV 335
                AN+G    + E  HGSAPDIAG+  +NP A + S+ +ML  MG  E A  I KAV
Sbjct: 278 VVPS-ANVGFDFVVGEPCHGSAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAV 336

Query: 336 LSTIASSREN--RTADLAGTASTSSFTNAVIERL 367
            + +   R+N  +T DL G ++T      V+ R+
Sbjct: 337 DANL---RDNSIKTPDLGGKSTTQQVVEDVLSRM 367

>ZYRO0A01914g Chr1 complement(158403..159509) [1107 bp, 368 aa] {ON}
           highly similar to uniprot|P40495 Saccharomyces
           cerevisiae YIL094C LYS12 Homo-isocitrate dehydrogenase
           an NAD-linked mitochondrial enzyme required for the
           fourth step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 368

 Score =  143 bits (361), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 104/352 (29%), Positives = 178/352 (50%), Gaps = 27/352 (7%)

Query: 37  VSFIEGDGVGPEISQSVKDIFSAASVP--VEWEYCDVTP---LLVNGLTTIPEPAVASIN 91
           +  I GDG+G E+  + K +  A      +++++ D+             +P+  V  + 
Sbjct: 23  IGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLKAGWEAFQQQGKALPDDTVKVLK 82

Query: 92  KNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGYKTTYSDVDLVLIR 148
           +    AL G + +P  K  G+ S  + LRK  GL+ANVRP KS+E  K    +VD++++R
Sbjct: 83  EQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANVRPVKSVE--KGNDRNVDMIIVR 140

Query: 149 ENTEGEY-----SGIEHVVSPGVVQSIKLITREASERVIRYAFEYA----RTVGRPKVVV 199
           ENTE  Y     + ++      V ++IK I+  A+ ++   A + +    ++ G   + V
Sbjct: 141 ENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIATIALDISLQRLKSRGHATLTV 200

Query: 200 VHKSTIQRLADGLFVNVAQEL----GREYPDIELQTELLDNTVLNVVTKPEAYKDVVAVC 255
            HKS +   +DGLF  + +++      +Y +++   +++D+ V  +  +PE +  VVA  
Sbjct: 201 THKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPECFDVVVA-- 258

Query: 256 PNLYGDIXXXXXXXXXXXXXXXXXXANIGHQVSIFEAVHGSAPDIAGQNRANPTALLLSS 315
           PNLYGDI                  AN+G ++ I E  HGSAPDIAG+  +NP A + S+
Sbjct: 259 PNLYGDILSDGAAALVGSLGVVPS-ANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRST 317

Query: 316 VMMLNHMGLHEHAGRIEKAVLSTIASSRENRTADLAGTASTSSFTNAVIERL 367
            +ML  +G  E A  I KAV + +     N T DL G A+T    + ++ ++
Sbjct: 318 ALMLEFLGHPEPAQDIYKAVDANLIKGDVN-TPDLGGKATTQQVVDDILSKI 368

>Kwal_27.11528 s27 (836437..837540) [1104 bp, 367 aa] {ON} YIL094C
           (LYS12) - Homo-isocitrate dehydrogenase [contig 27] FULL
          Length = 367

 Score =  140 bits (354), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 118/390 (30%), Positives = 184/390 (47%), Gaps = 46/390 (11%)

Query: 1   MLRQKLFQGSRRWLASVRQPSIGRYAGKPNAAGKYTVSFIEGDGVGPEISQSVKDIFSAA 60
           MLR    Q +RR   S              A    T+  I GDG+G E+  + K +    
Sbjct: 1   MLRTSFNQLARRSYTS--------------ATKSLTIGLIPGDGIGREVIPAGKLVLENL 46

Query: 61  SVP--VEWEYCDVTPLLVNGLTT---IPEPAVASI-NKNLVALKGPLATPIGK--GHRSL 112
           S    +++ + D+       L T   +P+  +  + N+   AL G + +P  K  G+ S 
Sbjct: 47  SSKHGLKFNFIDLEAGWQTFLDTGKALPDETIDILKNECQGALFGAVQSPTNKVEGYSSP 106

Query: 113 NLTLRKTFGLFANVRPAKSIEGYKTTYSDVDLVLIRENTEGEY-----SGIEHVVSPGVV 167
            + LRK  GL+ANVRP KS+   +     +D+V++RENTE  Y     + I+      V 
Sbjct: 107 IVALRKKLGLYANVRPVKSVLSQEKP---IDMVIVRENTEDLYIKTEKTYIDEKTGTRVA 163

Query: 168 QSIKLITREASERVIRYAFEYA----RTVGRPKVVVVHKSTIQRLADGLFVNVAQELGRE 223
           ++IK I+  A+  +   A E A    +  G   + V HKS +   +DGLF  + +++   
Sbjct: 164 EAIKRISEVATRNIANIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYES 223

Query: 224 YPD----IELQTELLDNTVLNVVTKPEAYKDVVAVCPNLYGDIXXXXXXXXXXXXXXXXX 279
             D    I    +++D+ V  +  +PE +  +VA  PNLYGDI                 
Sbjct: 224 NQDKFGSINYNEQIVDSMVYRLFREPECFDVIVA--PNLYGDILSDGAAALVGSLGVVPS 281

Query: 280 XANIGHQVSIFEAVHGSAPDIAGQNRANPTALLLSSVMMLNHMGLHEHAGRIEKAVLSTI 339
            AN+G    + E  HGSAPDIAG+  +NP A + S+ +ML  MG  E A  I KAV + +
Sbjct: 282 -ANVGFDFVVGEPCHGSAPDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANL 340

Query: 340 ASSREN--RTADLAGTASTSSFTNAVIERL 367
              R+N  +T DL G ++T    + V+ R+
Sbjct: 341 ---RDNTVKTPDLGGKSTTQQVVDDVLSRM 367

>AAL012C Chr1 complement(320148..321266) [1119 bp, 372 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCL018W
           (LEU2)
          Length = 372

 Score = 85.5 bits (210), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 88/351 (25%), Positives = 148/351 (42%), Gaps = 32/351 (9%)

Query: 40  IEGDGVGPEISQSVKDIFSAASVPVEWEYCDVTPLLVNGL------TTIPEPAVASINKN 93
           + GD +G E+ +    +  A    +   + D    LV G       + +P+ A+ +  + 
Sbjct: 10  LPGDHIGREVVEEAVKVLGAVEQSLSDVHFDFQYHLVGGAAIDATGSALPDEALGAAKEA 69

Query: 94  LVALKGPLATPIGKG-----HRSLNLTLRKTFGLFANVRPAKSIEGYKTTYS-------- 140
              L G +  P  +G      + L L LR+  G++AN+RP           S        
Sbjct: 70  DAVLLGAVGGPKWQGGAVRPEQGL-LKLRQELGVYANLRPCNFAADSLLELSPLRPEIAR 128

Query: 141 DVDLVLIRENTEGEYSGIEHV-VSPGVVQSIKLITREASERVIRYAFEYARTVGRP-KVV 198
           D D++++RE   G Y G  H     GV       T +  +R+ R A   A     P  V 
Sbjct: 129 DTDIMVVRELLGGSYFGERHEDEGDGVAWDTDKYTVKEVQRIARMAGFLALQHDPPLPVW 188

Query: 199 VVHKSTIQRLADGLFVNVAQELGREYPDIELQTELLDNTVLNVVTKPEAYKDVVAVCPNL 258
            + K+ +   +      V +    E+P+++LQ +L+D+  + +V  P A+  VV V  N+
Sbjct: 189 SLDKANVLASSRLWRKTVEETFQSEFPNVQLQHQLIDSAAMILVKNPRAFNGVV-VTSNM 247

Query: 259 YGDIXXXXXXXXXXX-----XXXXXXXANIGHQVSIFEAVHGSAPDIAGQNRANPTALLL 313
           +GDI                        +      ++E  HGSAPD+    +ANP   +L
Sbjct: 248 FGDIISDEASVIPGSLGLLPSASLASLPDSKSAFGLYEPCHGSAPDLPA-GKANPIGCIL 306

Query: 314 SSVMMLN-HMGLHEHAGRIEKAVLSTIASSRENRTADLAGTASTSSFTNAV 363
           S+ MML   + +      +E+AV   + S    RT DL G++STS   +A+
Sbjct: 307 SAAMMLKLSLNMVAAGEAVEQAVQEVLDSGV--RTGDLLGSSSTSEVGDAI 355

>Ecym_1296 Chr1 (602530..603621) [1092 bp, 363 aa] {ON} similar to
           Ashbya gossypii AAL012C
          Length = 363

 Score = 80.9 bits (198), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 75/276 (27%), Positives = 120/276 (43%), Gaps = 32/276 (11%)

Query: 114 LTLRKTFGLFANVRP----AKSIEGYKTTYSDV----DLVLIRENTEGEYSG-IEHVVSP 164
           L +RK  GL+AN+RP    +KS+ G      ++    D V++RE   G Y G  +     
Sbjct: 94  LAIRKELGLYANLRPCSFISKSLLGLSPLKPEIAQGTDFVILRELVGGIYFGERKEDDGD 153

Query: 165 GVVQSIKLITREASERVIRYAFEYARTVGRP-------KVVVVHKSTIQRLADGLFVNVA 217
           GV    +  T    ER+ R     A     P       K  V+  S + R        V 
Sbjct: 154 GVAWDSEKYTVSEVERITRMGAFLALQHDPPLPLWSFDKANVLASSRLWRR------TVN 207

Query: 218 QELGREYPDIELQTELLDNTVLNVVTKPEAYKDVVAVCPNLYGDIXXXXXXXXXXX---- 273
           + + RE+P + +Q +L+D+  + ++  P  +  +V +  N++GDI               
Sbjct: 208 ETIKREFPQLSVQHQLIDSAAMIMIKNPRKFNGIV-ITSNIFGDIISDAASVIPGSLGLL 266

Query: 274 -XXXXXXXANIGHQVSIFEAVHGSAPDIAGQNRANPTALLLSSVMMLN-HMGLHEHAGRI 331
                    +  +   ++E  HGSAPD+  + +ANP A +LS+ MML   + + +    I
Sbjct: 267 PSASLASEPDKNNAFGLYEPCHGSAPDLE-KGQANPIACILSAAMMLKLSLNMVDEGKAI 325

Query: 332 EKAVLSTIASSRENRTADLAGTASTSSFTNAVIERL 367
           E AV   I S    RT DL G  +T+   +AV   L
Sbjct: 326 ENAVKQVIESGI--RTGDLGGNNTTTEVGDAVTHAL 359

>TBLA0C01500 Chr3 complement(347212..348309) [1098 bp, 365 aa] {ON}
           Anc_1.402 YCL018W
          Length = 365

 Score = 80.1 bits (196), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 72/270 (26%), Positives = 121/270 (44%), Gaps = 21/270 (7%)

Query: 114 LTLRKTFGLFANVRPAKSIE----GYKTTYSDV----DLVLIRENTEGEYSG-IEHVVSP 164
           L +RK  GL+ N+RP K I     G      +V    D V++RE   G Y G  +     
Sbjct: 94  LKIRKELGLYGNLRPCKFISDKLIGLSPLKEEVCKGTDFVVVRELVGGIYFGERQEDDGS 153

Query: 165 GVVQSIKLITREASERVIRYAFEYARTVGRPKVVVVHKSTIQRLADG-LFVNVAQELGRE 223
           GV    +  + E  +R+ + A  +      P + +        LA   L+     E   E
Sbjct: 154 GVAWDSEKYSIEEVKRITKMA-AFLSLQNDPPLPIWSLDKANVLASSRLWRAAVDETIAE 212

Query: 224 YPDIELQTELLDNTVLNVVTKPEAYKDVVAVCPNLYGDIXXXXXXXXXXX-----XXXXX 278
           +P++++Q +L+D+  + +V  P     ++ +  N++GDI                     
Sbjct: 213 FPNLKVQHQLIDSAAMMLVKNPTQLNGII-LTNNMFGDIISDEASVIPGSLGLLPSASLA 271

Query: 279 XXANIGHQVSIFEAVHGSAPDIAGQNRANPTALLLSSVMMLN-HMGLHEHAGRIEKAVLS 337
              +      ++E  HGSAPD+A + + NP A +LS+ MML   + + +    IE+AV  
Sbjct: 272 SLPDKNKAFGLYEPCHGSAPDLA-RGKVNPVATILSAAMMLKLSLDMVQEGEAIERAV-- 328

Query: 338 TIASSRENRTADLAGTASTSSFTNAVIERL 367
           ++   R  RTADL G ++TS   +AV + L
Sbjct: 329 SVVLDRGIRTADLGGNSTTSELGDAVAQEL 358

>KLLA0D04906g Chr4 (420903..421991) [1089 bp, 362 aa] {ON} highly
           similar to uniprot|P04173 Saccharomyces cerevisiae
           YCL018W LEU2 Beta-isopropylmalate dehydrogenase
           catalyzes the third step in the leucine biosynthesis
           pathway
          Length = 362

 Score = 75.5 bits (184), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 90/355 (25%), Positives = 156/355 (43%), Gaps = 34/355 (9%)

Query: 37  VSFIEGDGVGPEIS-QSVKDIFSAASVPVEWEYCDVTPLLVNGL------TTIPEPAVAS 89
           +  + GD VG E++ +++K + + A V  E ++ +    L+ G       T +P+ A+ +
Sbjct: 5   IVVLPGDHVGKEVTDEAIKVLNAIAEVRPEIKF-NFQHHLIGGAAIDATGTPLPDEALEA 63

Query: 90  INKNLVALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAK-------SIEGYKT 137
             K    L G +  P  G G     + L L +RK  GL+AN+RP          +   K 
Sbjct: 64  SKKADAVLLGAVGGPKWGTGAVRPEQGL-LKIRKELGLYANLRPCNFASDSLLDLSPLKP 122

Query: 138 TYSD-VDLVLIRENTEGEYSGI-EHVVSPGVVQSIKLITREASERVIRYAFEYARTVGRP 195
            Y+   D V++RE   G Y G  +     GV    +  +    +R+ R A   A     P
Sbjct: 123 EYAKGTDFVVVRELVGGIYFGERKEDEGDGVAWDSEKYSVPEVQRITRMAAFLALQQNPP 182

Query: 196 -KVVVVHKSTIQRLADGLFVNVAQELGREYPDIELQTELLDNTVLNVVTKPEAYKDVVAV 254
             +  + K+ +   +      V + +  E+P + +Q +L+D+  + +V  P     VV +
Sbjct: 183 LPIWSLDKANVLASSRLWRKTVEETIKTEFPQLTVQHQLIDSAAMILVKSPTKLNGVV-I 241

Query: 255 CPNLYGDIXXXXXXXXXXX-----XXXXXXXANIGHQVSIFEAVHGSAPDIAGQNRANPT 309
             N++GDI                        +      ++E  HGSAPD+   N+ NP 
Sbjct: 242 TNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNKAFGLYEPCHGSAPDLPA-NKVNPI 300

Query: 310 ALLLSSVMMLN-HMGLHEHAGRIEKAVLSTIASSRENRTADLAGTASTSSFTNAV 363
           A +LS+ MML   + L E    +E+AV + + +    RT DL G+ ST+   +A+
Sbjct: 301 ATILSAAMMLKLSLDLVEEGRALEEAVRNVLDAGV--RTGDLGGSNSTTEVGDAI 353

>ZYRO0E04796g Chr5 (362881..363969) [1089 bp, 362 aa] {ON}
           uniprot|Q96WI0 Zygosaccharomyces rouxii LEU2 3-
           isopropylmalate dehydrogenase
          Length = 362

 Score = 75.5 bits (184), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 69/266 (25%), Positives = 116/266 (43%), Gaps = 20/266 (7%)

Query: 114 LTLRKTFGLFANVRPAK-------SIEGYKTTYSD-VDLVLIRENTEGEYSGI-EHVVSP 164
           L +RK   L+AN+RP          +   K  ++   D V++RE   G Y G  +     
Sbjct: 92  LKIRKELQLYANLRPCNFASESLLDLSPLKPQHAKGTDFVVVRELVGGIYFGERKEDEGD 151

Query: 165 GVVQSIKLITREASERVIRYAFEYARTVGRP-KVVVVHKSTIQRLADGLFVNVAQELGRE 223
           GV    +  T+   +R+ R A   A     P  +  + K+ +   +      V + +  E
Sbjct: 152 GVAWDSEKYTKPEVQRLTRMAAFLALQHNPPLPIWSLDKANVLASSRLWRKTVEETIKNE 211

Query: 224 YPDIELQTELLDNTVLNVVTKPEAYKDVVAVCPNLYGDIXXXXXXXXXXX-----XXXXX 278
           +P ++L  +L+D+  + +V  P     +V +  NL+GDI                     
Sbjct: 212 FPQLKLNHQLIDSAAMILVKSPTQLNGIV-LTSNLFGDIISDEASVIPGSLGLLPSASLA 270

Query: 279 XXANIGHQVSIFEAVHGSAPDIAGQNRANPTALLLSSVMMLN-HMGLHEHAGRIEKAVLS 337
              +      ++E  HGSAPD+  + + NP A++LS+ MML   + L +    +EKAV  
Sbjct: 271 SLPDTNEAFGLYEPCHGSAPDLP-KGKVNPIAMILSAAMMLKLSLNLSKEGEAVEKAVKQ 329

Query: 338 TIASSRENRTADLAGTASTSSFTNAV 363
            + S    RT DL G+ STS   +A+
Sbjct: 330 VLDSGV--RTGDLGGSNSTSEVGDAI 353

>Kwal_0.225 s0 (111017..112111) [1095 bp, 364 aa] {ON} YCL018W
           (LEU2) - beta-IPM (isopropylmalate) dehydrogenase
           [contig 82] FULL
          Length = 364

 Score = 75.1 bits (183), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 88/355 (24%), Positives = 151/355 (42%), Gaps = 32/355 (9%)

Query: 40  IEGDGVGPEISQSVKDIFSAAS-----VPVEWEYCDVTPLLVNGL-TTIPEPAVASINKN 93
           + GD VG EI++    +  A S        E++Y  +    ++     +P+ ++ +  K+
Sbjct: 10  LPGDHVGQEITEEAVKVLKAISEVRPEKQFEFQYHLIGGAAIDATGEPLPDASLEAAKKS 69

Query: 94  LVALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAKSIEGYKTTYSDV------ 142
              L G +  P  G G     + L L +RK   L+AN+RP           S +      
Sbjct: 70  DAVLLGAVGGPKWGTGAVRPEQGL-LKIRKELQLYANLRPCNFASESLLDLSPLKPECAR 128

Query: 143 --DLVLIRENTEGEYSGI-EHVVSPGVVQSIKLITREASERVIRYAFEYARTVGRP-KVV 198
             D V++RE   G Y G  +     GV    +  +    +R+ R A   A     P  V 
Sbjct: 129 GTDFVVVRELVGGIYFGERKEDTGDGVAWDSEQYSVPEVQRITRMAAFLALQHSPPLPVW 188

Query: 199 VVHKSTIQRLADGLFVNVAQELGREYPDIELQTELLDNTVLNVVTKPEAYKDVVAVCPNL 258
            + K+ +   +      V + +  E+P + +Q +L+D+  + +V  P     V+ +  N+
Sbjct: 189 SLDKANVLASSRLWRKTVEETIKNEFPTLTVQHQLIDSAAMILVKNPTQLNGVI-ITNNM 247

Query: 259 YGDIXXXXXXXXXXX-----XXXXXXXANIGHQVSIFEAVHGSAPDIAGQNRANPTALLL 313
           +GDI                        +      ++E  HGSAPD+  + + NP A +L
Sbjct: 248 FGDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYEPCHGSAPDLP-KGKVNPIATIL 306

Query: 314 SSVMMLN-HMGLHEHAGRIEKAVLSTIASSRENRTADLAGTASTSSFTNAVIERL 367
           S+ MML   + + E    +E+AV   + S    RTADL GT++TS    AV++ L
Sbjct: 307 SAAMMLKLSLDMFEEGAAVEEAVRKVLDSGV--RTADLKGTSTTSEVGEAVVKAL 359

>SAKL0D08690g Chr4 complement(723302..724396) [1095 bp, 364 aa] {ON}
           highly similar to uniprot|P04173 Saccharomyces
           cerevisiae YCL018W LEU2 Beta-isopropylmalate
           dehydrogenase catalyzes the third step in the leucine
           biosynthesis pathway
          Length = 364

 Score = 73.6 bits (179), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 70/268 (26%), Positives = 117/268 (43%), Gaps = 20/268 (7%)

Query: 114 LTLRKTFGLFANVRPAK-------SIEGYKTTYSD-VDLVLIRENTEGEYSG-IEHVVSP 164
           L +RK   L+AN+RP          +   K  Y+   D V++RE   G Y G  +     
Sbjct: 94  LKIRKELQLYANLRPCNFASDSLLDLSPLKPEYAKGTDFVVVRELVGGIYFGERKEDEGD 153

Query: 165 GVVQSIKLITREASERVIRYAFEYARTVGRP-KVVVVHKSTIQRLADGLFVNVAQELGRE 223
           GV    +  +    +R+ R A   A     P  +  + K+ +   +      V + +  E
Sbjct: 154 GVAWDSEKYSVPEVQRITRMAAFLALQQNPPLPIWSLDKANVLASSRLWRKTVEETIKNE 213

Query: 224 YPDIELQTELLDNTVLNVVTKPEAYKDVVAVCPNLYGDIXXXXXXXXXXX-----XXXXX 278
           +P + +Q +L+D+  + +V  P     +V +  N++GDI                     
Sbjct: 214 FPTLTVQHQLIDSAAMILVKSPTKLNGIV-ITSNMFGDIISDEASVIPGSLGLLPSASLA 272

Query: 279 XXANIGHQVSIFEAVHGSAPDIAGQNRANPTALLLSSVMMLN-HMGLHEHAGRIEKAVLS 337
              +      ++E  HGSAPD+  +N+ NP A +LS+ MML   + L E    +E+AV  
Sbjct: 273 SLPDSNTAFGLYEPCHGSAPDLP-KNKVNPIATILSAAMMLKLSLNLVEEGNAVEEAVRR 331

Query: 338 TIASSRENRTADLAGTASTSSFTNAVIE 365
            + +    RTADL G  STS   +AV++
Sbjct: 332 VLDAGI--RTADLRGENSTSEVGDAVVK 357

>YCL018W Chr3 (91324..92418) [1095 bp, 364 aa] {ON}
           LEU2Beta-isopropylmalate dehydrogenase (IMDH), catalyzes
           the third step in the leucine biosynthesis pathway
          Length = 364

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 69/270 (25%), Positives = 117/270 (43%), Gaps = 20/270 (7%)

Query: 114 LTLRKTFGLFANVRPAK-------SIEGYKTTYSD-VDLVLIRENTEGEYSGI-EHVVSP 164
           L +RK   L+AN+RP          +   K  ++   D V++RE   G Y G  +     
Sbjct: 94  LKIRKELQLYANLRPCNFASDSLLDLSPIKPQFAKGTDFVVVRELVGGIYFGKRKEDDGD 153

Query: 165 GVVQSIKLITREASERVIRYAFEYARTVGRP-KVVVVHKSTIQRLADGLFVNVAQELGRE 223
           GV    +  T    +R+ R A   A     P  +  + K+ +   +      V + +  E
Sbjct: 154 GVAWDSEQYTVPEVQRITRMAAFMALQHEPPLPIWSLDKANVLASSRLWRKTVEETIKNE 213

Query: 224 YPDIELQTELLDNTVLNVVTKPEAYKDVVAVCPNLYGDIXXXXXXXXXXX-----XXXXX 278
           +P +++Q +L+D+  + +V  P     ++ +  N++GDI                     
Sbjct: 214 FPTLKVQHQLIDSAAMILVKNPTHLNGII-ITSNMFGDIISDEASVIPGSLGLLPSASLA 272

Query: 279 XXANIGHQVSIFEAVHGSAPDIAGQNRANPTALLLSSVMMLN-HMGLHEHAGRIEKAVLS 337
              +      ++E  HGSAPD+  +N+ NP A +LS+ MML   + L E    IE AV  
Sbjct: 273 SLPDKNTAFGLYEPCHGSAPDLP-KNKVNPIATILSAAMMLKLSLNLPEEGKAIEDAVKK 331

Query: 338 TIASSRENRTADLAGTASTSSFTNAVIERL 367
            + +    RT DL G+ ST+   +AV E +
Sbjct: 332 VLDAGI--RTGDLGGSNSTTEVGDAVAEEV 359

>Skud_3.43 Chr3 (70293..71387) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score = 72.0 bits (175), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 68/266 (25%), Positives = 115/266 (43%), Gaps = 20/266 (7%)

Query: 114 LTLRKTFGLFANVRPAK-------SIEGYKTTYSD-VDLVLIRENTEGEYSG-IEHVVSP 164
           L +RK   L+AN+RP          +   K  ++   D V++RE   G Y G  +     
Sbjct: 94  LKIRKELQLYANLRPCNFASESLLDLSPIKPQFAKGTDFVVVRELVGGIYFGERKEDDGD 153

Query: 165 GVVQSIKLITREASERVIRYAFEYARTVGRP-KVVVVHKSTIQRLADGLFVNVAQELGRE 223
           GV    +  T    +R+ R A   A     P  +  + K+ +   +      V + +  E
Sbjct: 154 GVAWDCEQYTVPEVQRITRMAAFMALQHEPPLPIWSLDKANVLASSRLWRKTVEETIKNE 213

Query: 224 YPDIELQTELLDNTVLNVVTKPEAYKDVVAVCPNLYGDIXXXXXXXXXXX-----XXXXX 278
           +P +++Q +L+D+  + +V  P     ++ +  N++GDI                     
Sbjct: 214 FPTLKVQHQLIDSAAMILVKNPTHLNGII-ITSNMFGDIISDEASVIPGSLGLLPSASLA 272

Query: 279 XXANIGHQVSIFEAVHGSAPDIAGQNRANPTALLLSSVMMLN-HMGLHEHAGRIEKAVLS 337
              +      ++E  HGSAPD+  +N+ NP A +LS+ MML   + L E    IE AV  
Sbjct: 273 SLPDKNTAFGLYEPCHGSAPDLP-KNKVNPVATILSAAMMLKLSLNLPEEGKAIEDAVKR 331

Query: 338 TIASSRENRTADLAGTASTSSFTNAV 363
            + +    RT DL G+ ST+   +AV
Sbjct: 332 VLDAGI--RTGDLGGSNSTTEVGDAV 355

>KAFR0I02200 Chr9 (449737..450834) [1098 bp, 365 aa] {ON} Anc_1.402
           YCL018W
          Length = 365

 Score = 71.2 bits (173), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 68/266 (25%), Positives = 113/266 (42%), Gaps = 20/266 (7%)

Query: 114 LTLRKTFGLFANVRPAKSIEGYKTTYSDV--------DLVLIRENTEGEYSG-IEHVVSP 164
           L +RK  G++AN+RP + +       S +        D V++RE   G Y G  +     
Sbjct: 94  LKIRKELGVYANLRPCQFVSETLLDLSPLKREIVQGTDFVIVRELVGGIYFGERQEAGDD 153

Query: 165 GVVQSIKLITREASERVIRYAFEYARTVGRP-KVVVVHKSTIQRLADGLFVNVAQELGRE 223
           GV    +  +    +R+ R A   A     P  V  + K+ +   +      V + +  E
Sbjct: 154 GVAWDKESYSVPEIQRITRMAAFLALQHNPPLPVWSLDKANVLATSRLWRKTVEETIKNE 213

Query: 224 YPDIELQTELLDNTVLNVVTKPEAYKDVVAVCPNLYGDIXXXXXXXXXXX-----XXXXX 278
           +P + +   L+D+  + +V  P     VV +  N++GDI                     
Sbjct: 214 FPTLTINHHLIDSAAMTLVQNPTKLNGVV-ITTNMFGDIISDEASVIPGSLGLLPSASLA 272

Query: 279 XXANIGHQVSIFEAVHGSAPDIAGQNRANPTALLLSSVMMLN-HMGLHEHAGRIEKAVLS 337
              +    + ++E  HGSAPD+   + ANP A +LS+ MM    + L +    IE+AV  
Sbjct: 273 SLPDKNDALGLYEPCHGSAPDLPA-DHANPIATILSAAMMCKLSLNLTKEGNAIEEAVKR 331

Query: 338 TIASSRENRTADLAGTASTSSFTNAV 363
           TI +    +T DL G  +T+   NAV
Sbjct: 332 TIDAGI--KTGDLGGKNTTTEVGNAV 355

>Smik_3.66 Chr3 (89718..90812) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score = 71.2 bits (173), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 68/266 (25%), Positives = 115/266 (43%), Gaps = 20/266 (7%)

Query: 114 LTLRKTFGLFANVRPAK-------SIEGYKTTYSD-VDLVLIRENTEGEYSGI-EHVVSP 164
           L +RK   L+AN+RP          +   K  ++   D V++RE   G Y G  +     
Sbjct: 94  LKIRKELQLYANLRPCNFASDSLLDLSPIKPQFAKGTDFVVVRELVGGIYFGKRKEDDGD 153

Query: 165 GVVQSIKLITREASERVIRYAFEYARTVGRP-KVVVVHKSTIQRLADGLFVNVAQELGRE 223
           GV    +  T    +R+ R A   A     P  +  + K+ +   +      V + +  E
Sbjct: 154 GVAWDSEQYTVPEVQRITRMAAFMALQHEPPLPIWSLDKANVLASSRLWRKTVEETIKNE 213

Query: 224 YPDIELQTELLDNTVLNVVTKPEAYKDVVAVCPNLYGDIXXXXXXXXXXX-----XXXXX 278
           +P +++Q +L+D+  + +V  P     ++ +  N++GDI                     
Sbjct: 214 FPTLKVQHQLIDSAAMILVKNPTHLNGII-ITSNMFGDIISDEASVIPGSLGLLPSASLA 272

Query: 279 XXANIGHQVSIFEAVHGSAPDIAGQNRANPTALLLSSVMMLN-HMGLHEHAGRIEKAVLS 337
              +      ++E  HGSAPD+  +N+ NP A +LS+ MML   + L E    IE AV  
Sbjct: 273 SLPDKNTAFGLYEPCHGSAPDLP-KNKVNPIATILSAAMMLKLSLNLPEEGKAIEDAVKK 331

Query: 338 TIASSRENRTADLAGTASTSSFTNAV 363
            + +    RT DL G+ ST+   +AV
Sbjct: 332 VLDAGI--RTGDLGGSNSTTEVGDAV 355

>NDAI0G04230 Chr7 complement(1015689..1016780) [1092 bp, 363 aa]
           {ON} Anc_1.402
          Length = 363

 Score = 70.9 bits (172), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 89/361 (24%), Positives = 155/361 (42%), Gaps = 46/361 (12%)

Query: 37  VSFIEGDGVGPEISQSVKDIFSAA-----SVPVEWEYCDVTPLLVNGLTTIPEP---AVA 88
           +  + GD VG EI+     +  A      S+  +++Y  +    ++  T +P P     A
Sbjct: 6   IVVLPGDHVGEEITAEAVKVLKAIAEVDNSINFDFQYHLIGGAAIDA-TGVPLPDEALEA 64

Query: 89  SINKNLV---ALKGP-LATPIGKGHRSLNLTLRKTFGLFANVRP----AKSIEGYKTTYS 140
           S N + V   A+ GP   T   +  + L L +RK  GL+AN+RP    ++S+ G      
Sbjct: 65  SKNSDAVLLGAVGGPKWGTGAVRPEQGL-LKIRKELGLYANLRPCNFASESLLGLSPLRP 123

Query: 141 DV----DLVLIRENTEGEYSGI-EHVVSPGVVQSIKLITREASERVIRYAFEYARTVGRP 195
           ++    D +++RE   G Y G  +     GV    +  +    +R+ R A   A     P
Sbjct: 124 EIAKGTDFMVVRELVGGIYFGKRKEDEGDGVAWDSEQYSVPEVQRITRMAAFLALQHNPP 183

Query: 196 -------KVVVVHKSTIQRLADGLFVNVAQELGREYPDIELQTELLDNTVLNVVTKPEAY 248
                  K  V+  S + R        V + +  E+P + +Q +L+D+  + +V  P   
Sbjct: 184 LPIWSLDKANVLASSRLWR------KTVEETIKNEFPTLTVQNQLIDSAAMILVKNPTQL 237

Query: 249 KDVVAVCPNLYGDIXXXXXXXXXXX-----XXXXXXXANIGHQVSIFEAVHGSAPDIAGQ 303
             ++ +  N++GDI                        +      ++E  HGSAPD+  +
Sbjct: 238 NGII-ITSNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPDLP-K 295

Query: 304 NRANPTALLLSSVMMLN-HMGLHEHAGRIEKAVLSTIASSRENRTADLAGTASTSSFTNA 362
            + NP A +LS+ MML   + L +    IE+AV   + +    RT DL G+ ST+   +A
Sbjct: 296 GKVNPIATILSAAMMLKLSLNLVKQGDAIEEAVKKVLDAGI--RTGDLGGSNSTTEVGDA 353

Query: 363 V 363
           +
Sbjct: 354 I 354

>TDEL0B06000 Chr2 (1060828..1061916) [1089 bp, 362 aa] {ON}
           Anc_1.402 YCL018W
          Length = 362

 Score = 70.5 bits (171), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 90/357 (25%), Positives = 144/357 (40%), Gaps = 44/357 (12%)

Query: 40  IEGDGVGPEISQSVKDIFSAASVPVEWEYCDVTPLLVNGLTT------IPEPAVASINKN 93
           + GD VG EI++    +  A S        +    L+ G         +P+ A+ +  K 
Sbjct: 8   LPGDHVGQEITEEAIKVLKAISEVRPNATFNFQHHLIGGAAIDATGVPLPDEALEASKKA 67

Query: 94  LVALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAK-------SIEGYKTTYSD 141
              L G +  P  G G     + L L +RK   L+AN+RP          +   K  Y+ 
Sbjct: 68  DAVLLGAVGGPKWGTGAVRPEQGL-LKIRKELQLYANLRPCNFASDSLLELSPLKAQYAQ 126

Query: 142 -VDLVLIRENTEGEYSGI-EHVVSPGVVQSIKLITREASERVIRYAFEYARTVGRP---- 195
             D V++RE   G Y G  +     GV    +  +    +R+ R A   A     P    
Sbjct: 127 GTDFVVVRELVGGIYFGERKEDEGDGVAWDSEQYSVPEVQRITRMAAFLALQHNPPLPIW 186

Query: 196 ---KVVVVHKSTIQRLADGLFVNVAQELGREYPDIELQTELLDNTVLNVVTKPEAYKDVV 252
              K  V+  S + R        V + +  E+P + +  +L+D+  + +V  P     ++
Sbjct: 187 SLDKANVLASSRLWR------KTVEKTIKEEFPTLSVNHQLIDSAAMILVKNPTQLNGII 240

Query: 253 AVCPNLYGDIXXXXXXXXXXX-----XXXXXXXANIGHQVSIFEAVHGSAPDIAGQNRAN 307
            +  N++GDI                        +      ++E  HGSAPD+A + + N
Sbjct: 241 -ITSNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPDLA-KGKVN 298

Query: 308 PTALLLSSVMMLN-HMGLHEHAGRIEKAVLSTIASSRENRTADLAGTASTSSFTNAV 363
           P A +LS+ MML   + + E    IEKAV   +      RT DL G+ STS   +AV
Sbjct: 299 PVATILSAAMMLKLSLNMVEEGVAIEKAVKKVLDDGI--RTGDLGGSNSTSEVGDAV 353

>CAGL0H03795g Chr8 (356535..357632) [1098 bp, 365 aa] {ON}
          Length = 365

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 87/356 (24%), Positives = 150/356 (42%), Gaps = 33/356 (9%)

Query: 36  TVSFIEGDGVGPEISQSVKDIFSAAS------VPVEWEYCDVTPLLVNGL-TTIPEPAVA 88
           T+  + GD VG EI++    + +A        V  ++++  +    ++     +P+ A+ 
Sbjct: 6   TIVVLPGDHVGQEITEEAIKVLNAIQECRPDKVNFKFDHHLIGGAAIDATGVPLPDEALE 65

Query: 89  SINKNLVALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAKSIEGYKTTYSDV- 142
           +  K    L G +  P  G G     + L L +RK   L+AN+RP           S + 
Sbjct: 66  ASKKADAVLLGAVGGPKWGTGAVRPEQGL-LKIRKELQLYANLRPCNFASDSLLDLSPLK 124

Query: 143 -------DLVLIRENTEGEYSG-IEHVVSPGVVQSIKLITREASERVIRYAFEYARTVGR 194
                  D V++RE   G Y G  +     GV    +  +    +R+ R A   A     
Sbjct: 125 PEIARGTDFVVVRELVGGIYFGERKEDEGDGVAWDSEKYSVPEVQRITRMAAFMALQHNP 184

Query: 195 P-KVVVVHKSTIQRLADGLFVNVAQELGREYPDIELQTELLDNTVLNVVTKPEAYKDVVA 253
           P  +  + K+ +   +      V + +  E+P + +Q +L+D+  + +V  P     ++ 
Sbjct: 185 PLPIWSLDKANVLASSRLWRKTVEETIKNEFPQLTVQHQLIDSAAMILVKNPTHLNGII- 243

Query: 254 VCPNLYGDIXXXXXXXXXXX-----XXXXXXXANIGHQVSIFEAVHGSAPDIAGQNRANP 308
           +  N++GDI                        +      ++E  HGSAPD+  + + NP
Sbjct: 244 ITNNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPDLP-KGKVNP 302

Query: 309 TALLLSSVMMLN-HMGLHEHAGRIEKAVLSTIASSRENRTADLAGTASTSSFTNAV 363
            A +LS+ MML   + L E    IE+AV   + S    RTADL GT ST+   +AV
Sbjct: 303 VATILSAAMMLKLSLDLFEEGEIIEQAVKKVLDSGI--RTADLKGTNSTTEVGDAV 356

>KNAG0I01280 Chr9 complement(245603..246946) [1344 bp, 447 aa] {ON}
           Anc_1.402 YCL018W
          Length = 447

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 89/351 (25%), Positives = 144/351 (41%), Gaps = 32/351 (9%)

Query: 40  IEGDGVGPEISQSVKDIFSAASVPVEWEYCDVTPLLVNGLTT------IPEPAVASINKN 93
           + GD VG EI++    + +A S        D    L+ G         +P+ A+ +  K 
Sbjct: 93  LPGDHVGQEITEEAIKVLNAISSVRPNVNFDFQHHLIGGAAIDATGVPLPDEALEASKKA 152

Query: 94  LVALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAKSIEGYKTTYSDV------ 142
              L G +  P  G G     + L L +RK   L+AN+RP           S +      
Sbjct: 153 DAVLLGAVGGPKWGTGSVRPEQGL-LKIRKELQLYANLRPCNFASDSLLDLSPLKPEIVK 211

Query: 143 --DLVLIRENTEGEYSG-IEHVVSPGVVQSIKLITREASERVIRYAFEYARTVGRP-KVV 198
             D+ ++RE   G Y G  +     GV    +  +    +R+ R A   A     P  V 
Sbjct: 212 GTDICIVRELVGGIYFGERKEDEGDGVAWDSEKYSVSEVQRITRMAGFLALQHNPPLPVW 271

Query: 199 VVHKSTIQRLADGLFVNVAQELGREYPDIELQTELLDNTVLNVVTKPEAYKDVVAVCPNL 258
            + K+ +   +      V + +  E+P + +Q +L+D+  + +V  P     VV +  N+
Sbjct: 272 SLDKANVLASSRLWRKTVEETIKNEFPTLTVQHQLIDSAAMILVKNPTHLNGVV-IANNM 330

Query: 259 YGDIXXXXXXXXXXX-----XXXXXXXANIGHQVSIFEAVHGSAPDIAGQNRANPTALLL 313
           +GDI                        +      ++E  HGSAPD+  + + NP A +L
Sbjct: 331 FGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPDLP-KGKVNPVATIL 389

Query: 314 SSVMMLN-HMGLHEHAGRIEKAVLSTIASSRENRTADLAGTASTSSFTNAV 363
           S  MML   + + E    +EKAV   + S    RTADL G+ STS   +A+
Sbjct: 390 SVAMMLKLSLNMTEEGIAVEKAVKQVLDSGV--RTADLRGSNSTSEVGDAI 438

>Kpol_1048.63 s1048 (182096..183190) [1095 bp, 364 aa] {ON}
           (182096..183190) [1095 nt, 365 aa]
          Length = 364

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 90/358 (25%), Positives = 153/358 (42%), Gaps = 45/358 (12%)

Query: 40  IEGDGVGPEI-SQSVKDIFSAASVPVEWEYCDVTPLLVNGL------TTIPEPAVASINK 92
           + GD VG EI  +++K + + AS   +    +    L+ G       T +P+ A+ +   
Sbjct: 9   LPGDHVGEEIVDEAIKVLEAVASSSSKGIKFEFQRHLIGGASIDATGTPLPDEALDAAKN 68

Query: 93  NLVALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRP----AKSIEGYKTTYSDV- 142
           +   L G +  P  G G     + L L +RK   L+AN+RP    + S+ G      ++ 
Sbjct: 69  SDAVLLGAVGGPKWGTGDVRPEQGL-LKIRKELQLYANLRPCNFVSDSLLGLSPLKEEIA 127

Query: 143 ---DLVLIRENTEGEYSGI-EHVVSPGVVQSIKLITREASERVIRYAFEYARTVGRP--- 195
              D  ++RE   G Y G  +     G     +  T    +R+ R A   A     P   
Sbjct: 128 KGTDFTVVRELVGGIYFGDRKEDDGDGSAWDCEKYTIPEVQRITRMAAFLALQHDPPLPI 187

Query: 196 ----KVVVVHKSTIQRLADGLFVNVAQELGREYPDIELQTELLDNTVLNVVTKPEAYKDV 251
               K  V+  S + R        V + +  E+P++++Q +L+D+  + +V  P     +
Sbjct: 188 WSLDKANVLASSRLWR------KTVEETIKNEFPNLKVQHQLIDSAAMILVKSPRQLNGI 241

Query: 252 VAVCPNLYGDIXXXXXXXXXXX-----XXXXXXXANIGHQVSIFEAVHGSAPDIAGQNRA 306
           + +  N++GDI                        +      ++E  HGSAPD+  + + 
Sbjct: 242 I-ITNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPDLP-KGKV 299

Query: 307 NPTALLLSSVMMLN-HMGLHEHAGRIEKAVLSTIASSRENRTADLAGTASTSSFTNAV 363
           NP A +LS+ MML   + L +    IE+AV   + +    RTADL G+ STS   +AV
Sbjct: 300 NPIATILSAAMMLKLSLNLVDEGIAIEQAVKQVLDAGI--RTADLKGSNSTSEVGDAV 355

>Suva_3.3 Chr3 (1464..2558) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score = 68.6 bits (166), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 87/352 (24%), Positives = 149/352 (42%), Gaps = 34/352 (9%)

Query: 40  IEGDGVGPEISQSVKDIFSAAS-----VPVEWEYCDVTPLLVNGLTTIP--EPAVASINK 92
           + GD VG EI++    +  A S     V  ++EY  +    ++  T +P  + A+ +  K
Sbjct: 10  LPGDHVGQEITEEAIKVLKAISEVRPNVKFDFEYHLIGGAAIDA-TGVPLTDEALEASKK 68

Query: 93  NLVALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAK-------SIEGYKTTYS 140
               L G +  P  G G     + L L +RK   L+AN+RP          +   K  ++
Sbjct: 69  ADAVLLGAVGGPKWGTGSVRPEQGL-LKIRKELQLYANLRPCNFASESLLELSPIKPQFA 127

Query: 141 -DVDLVLIRENTEGEYSGI-EHVVSPGVVQSIKLITREASERVIRYAFEYARTVGRP-KV 197
              D V++RE   G Y G  +     GV    +  T    +R+ R A   A     P  +
Sbjct: 128 RGTDFVVVRELVGGIYFGKRKEDDGDGVAWDSEQYTVPEVQRITRMAAFMALQHQPPLPI 187

Query: 198 VVVHKSTIQRLADGLFVNVAQELGREYPDIELQTELLDNTVLNVVTKPEAYKDVVAVCPN 257
             + K+ +   +      V + +  E+P +++Q +L+D+  + +V  P     ++ +  N
Sbjct: 188 WSLDKANVLASSRLWRKTVEETIKNEFPTLKVQHQLIDSAAMILVKNPTQLNGII-ITSN 246

Query: 258 LYGDIXXXXXXXXXXX-----XXXXXXXANIGHQVSIFEAVHGSAPDIAGQNRANPTALL 312
           ++GDI                        +      ++E  HGSAPD+  +N+ NP A +
Sbjct: 247 MFGDIISDEASCIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPDLP-KNKVNPIATI 305

Query: 313 LSSVMMLN-HMGLHEHAGRIEKAVLSTIASSRENRTADLAGTASTSSFTNAV 363
           LS+ MML   + +      IE AV   + +    RT DL G+ ST    +AV
Sbjct: 306 LSAAMMLKLSLNMTAEGQAIEDAVKKVLDAGI--RTGDLGGSNSTIEVGDAV 355

>NCAS0C04870 Chr3 complement(993177..994274) [1098 bp, 365 aa] {ON}
           Anc_1.402
          Length = 365

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 67/272 (24%), Positives = 116/272 (42%), Gaps = 32/272 (11%)

Query: 114 LTLRKTFGLFANVRP----AKSIEGYKTTYSDV----DLVLIRENTEGEYSG-IEHVVSP 164
           L +RK  GL+AN+RP    ++ + G      ++    D +++RE   G Y G  +     
Sbjct: 95  LKIRKELGLYANLRPCNFASEPLLGLSPLRPEIAKGTDFMVVRELVGGIYFGERKEDDGD 154

Query: 165 GVVQSIKLITREASERVIRYAFEYARTVGRP-------KVVVVHKSTIQRLADGLFVNVA 217
           GV    +  +    ER+ R A   A     P       K  V+  S + R        V 
Sbjct: 155 GVAWDSEKYSVPEVERITRMAAFLALQHNPPLPIWSLDKANVLASSRLWR------KTVE 208

Query: 218 QELGREYPDIELQTELLDNTVLNVVTKPEAYKDVVAVCPNLYGDIXXXXXXXXXXX---- 273
             +  E+P + +Q +L+D+  + +V  P     ++ +  N++GDI               
Sbjct: 209 ATIKNEFPTLTVQNQLIDSAAMILVKNPTQLNGII-ITSNMFGDIISDEASVIPGSLGLL 267

Query: 274 -XXXXXXXANIGHQVSIFEAVHGSAPDIAGQNRANPTALLLSSVMMLN-HMGLHEHAGRI 331
                    +      ++E  HGSAPD+  +N+ NP A +LS+ MML   + + +    +
Sbjct: 268 PSASLASLPDSNTAFGLYEPCHGSAPDLP-KNKVNPVATILSAAMMLKLSLNMVKEGEAV 326

Query: 332 EKAVLSTIASSRENRTADLAGTASTSSFTNAV 363
           E+AV   + +    RT DL G+ ST    +A+
Sbjct: 327 EEAVRRVLDAGV--RTGDLGGSNSTQEVGDAI 356

>KLTH0H12188g Chr8 (1039347..1040441) [1095 bp, 364 aa] {ON} highly
           similar to uniprot|P04173 Saccharomyces cerevisiae
           YCL018W LEU2 Beta-isopropylmalate dehydrogenase
           catalyzes the third step in the leucine biosynthesis
           pathway
          Length = 364

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 85/351 (24%), Positives = 147/351 (41%), Gaps = 32/351 (9%)

Query: 40  IEGDGVGPEISQSVKDIFSA-----ASVPVEWEYCDVTPLLVNGL-TTIPEPAVASINKN 93
           + GD VG EI+     +  A     +SV  E++   +    ++     +P+ ++ +  K 
Sbjct: 10  LPGDHVGQEITDEAIKVLKAISEVRSSVKFEFQQHLIGGAAIDATGEPLPDASLEAAKKA 69

Query: 94  LVALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAK-------SIEGYKTTYS- 140
              L G +  P  G G     + L L +RK   L+AN+RP          +   K  ++ 
Sbjct: 70  DAVLLGAVGGPKWGTGAVRPEQGL-LKIRKELQLYANLRPCNFASESLLDLSPLKAEHAR 128

Query: 141 DVDLVLIRENTEGEYSG-IEHVVSPGVVQSIKLITREASERVIRYAFEYARTVGRP-KVV 198
             D V++RE   G Y G  +     GV    +  +    +R+ R A   A     P  V 
Sbjct: 129 GTDFVVVRELVGGIYFGERKEDEGDGVAWDSEKYSVPEVQRITRMAAFLALQHNPPLPVW 188

Query: 199 VVHKSTIQRLADGLFVNVAQELGREYPDIELQTELLDNTVLNVVTKPEAYKDVVAVCPNL 258
            + K+ +   +      V + +  E+P + +Q +L+D+  + +V  P     V+ +  N+
Sbjct: 189 SLDKANVLASSRLWRKTVEETIKNEFPTLTVQHQLIDSAAMIMVKNPTQLNGVI-ITNNM 247

Query: 259 YGDIXXXXXXXXXXX-----XXXXXXXANIGHQVSIFEAVHGSAPDIAGQNRANPTALLL 313
           +GDI                        +      ++E  HGSAPD+  + + NP A +L
Sbjct: 248 FGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPDLE-KGKVNPIATIL 306

Query: 314 SSVMMLN-HMGLHEHAGRIEKAVLSTIASSRENRTADLAGTASTSSFTNAV 363
           S+ MML   + + E    +E+AV   + S    RT DL G+ ST    +AV
Sbjct: 307 SAAMMLELSLDMFEEGTAVEEAVRRVLDSGI--RTGDLRGSNSTQEVGDAV 355

>TPHA0B03730 Chr2 complement(878199..879296) [1098 bp, 365 aa] {ON}
           Anc_1.402 YCL018W
          Length = 365

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 65/266 (24%), Positives = 113/266 (42%), Gaps = 20/266 (7%)

Query: 114 LTLRKTFGLFANVRPAK-------SIEGYKTTYSD-VDLVLIRENTEGEYSGI-EHVVSP 164
           L +RK   L+AN+RP          +   K  Y+   D  ++RE   G Y G  +     
Sbjct: 95  LKIRKELQLYANLRPCNFASDSLLDLSPLKEKYAKGTDFTVVRELVGGIYFGKRKEDDGD 154

Query: 165 GVVQSIKLITREASERVIRYAFEYARTVGRP-KVVVVHKSTIQRLADGLFVNVAQELGRE 223
           GV    +  +    +R+ R A   A     P  +  + K+ +   +      V + +  E
Sbjct: 155 GVAWDSEQYSVPEVQRITRMAAFLAMQHNPPLPIWSLDKANVLASSRLWRKTVEETIQNE 214

Query: 224 YPDIELQTELLDNTVLNVVTKPEAYKDVVAVCPNLYGDIXXXXXX-----XXXXXXXXXX 278
           +P +++  +L+D+  + +V  P     ++ +  N++GDI                     
Sbjct: 215 FPSLKVSHQLIDSAAMILVKNPTQLNGII-ITNNMFGDIISDEASVIPGSLGLLPSASLS 273

Query: 279 XXANIGHQVSIFEAVHGSAPDIAGQNRANPTALLLSSVMMLN-HMGLHEHAGRIEKAVLS 337
              +      ++E  HGSAPD+  + + NP   +LS  MML   + L E    +E+AV  
Sbjct: 274 SLPDTNSAFGLYEPCHGSAPDLP-KGKVNPIGTILSVAMMLKLSLNLKEEGIAVEEAVRR 332

Query: 338 TIASSRENRTADLAGTASTSSFTNAV 363
            + ++   RTADL G+ STS   +AV
Sbjct: 333 VLDNNI--RTADLGGSNSTSDIGDAV 356

>Suva_14.303 Chr14 (547367..547525) [159 bp, 53 aa] {ON} YNL037C
           (REAL)
          Length = 53

 Score = 51.6 bits (122), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 26/51 (50%), Positives = 36/51 (70%), Gaps = 1/51 (1%)

Query: 317 MMLNHMGLHEHAGRIEKAVLSTIASSRENRTADLAGTASTSSFTNAVIERL 367
           +MLNH+GL+E A RI KAV  TIA  +   T D+ G++ST+ FTN +I +L
Sbjct: 1   LMLNHLGLNESATRISKAVHETIAEGKHT-TRDIGGSSSTTDFTNEIINKL 50

>Smik_5.87 Chr5 complement(124637..126319) [1683 bp, 560 aa] {ON}
           YEL020C (REAL)
          Length = 560

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 26/44 (59%), Gaps = 1/44 (2%)

Query: 209 ADGLFVNVAQELGREYPD-IELQTELLDNTVLNVVTKPEAYKDV 251
           A+G FVN   ELGR +   ++L    ++ +V+NV+ +P   K +
Sbjct: 507 ANGFFVNTLSELGRSFQKAVQLSRTKMETSVINVIIEPGEQKQI 550

>TDEL0A04220 Chr1 complement(748109..752113) [4005 bp, 1334 aa] {ON}
           Anc_5.559 YDR443C
          Length = 1334

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 36/162 (22%), Positives = 74/162 (45%), Gaps = 34/162 (20%)

Query: 49  ISQSVKDIFSAASVPVEWEYCDVTPLLVNGLTTIPEPAVASINKNLVALKGPLATPIGKG 108
           I+++++++FS+ S     E       L++ L+TI EP++                 + K 
Sbjct: 850 IAETIRELFSSFSRVHGNE-------LISSLSTIKEPSIY----------------VKKH 886

Query: 109 HRSLNLTL-RKTFGLFANVRPAKSIEGYK-----TTYSDVDLVLIRENTEGEYSGIEHVV 162
           H  +N++   + F  F NV+PAK I+ ++     T+Y++  L  +    +  Y G E   
Sbjct: 887 HSMMNMSADSQVFSKFLNVKPAKGIKNFRFLMLTTSYAEDCLSFVSTLCQ-TYIGYEF-- 943

Query: 163 SPGVVQSIKLITREASERVIRYAFEYARTVGRPKVVVVHKST 204
             G  + +KL + ++   +    F+ +R +     +V + ST
Sbjct: 944 --GFCELLKLTSDDSQGLMQLPDFDKSRLLLLAAQIVTYCST 983

>KLTH0G12474g Chr7 (1059087..1059776) [690 bp, 229 aa] {ON} similar
           to uniprot|Q12354 Saccharomyces cerevisiae YLR118C
          Length = 229

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 39/92 (42%), Gaps = 19/92 (20%)

Query: 90  INKNLVALKGPL--ATPIGKGHRSLNLTLRKTFGLFANVRPAKSIEGYKTTYSDVDLVLI 147
           IN  L+ LK P    TPI  GH   +  +   +G         S+E + T Y       I
Sbjct: 149 INDKLLELKSPANSDTPIFHGHGDQDTVIPLKYG--------HSVEQFFTKYCG-----I 195

Query: 148 RENTEGEYSGIEHVVSP----GVVQSIKLITR 175
              T   YSG+EH  SP     +V+ +K I R
Sbjct: 196 SNYTMNVYSGMEHSASPEEIEDLVKFLKSILR 227

>ADR028W Chr4 (753946..756444) [2499 bp, 832 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR089W
          Length = 832

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 27/58 (46%)

Query: 310 ALLLSSVMMLNHMGLHEHAGRIEKAVLSTIASSRENRTADLAGTASTSSFTNAVIERL 367
           AL L    ML   G H     +E   +S +ASS  N   +L   A+T S T AV  R+
Sbjct: 121 ALELFMAWMLQRFGRHHFKVPVENLAMSIVASSLVNDRGELLSYATTCSVTYAVTTRI 178

>Skud_14.280 Chr14 (516761..517972) [1212 bp, 403 aa] {ON} YNL051W
           (REAL)
          Length = 403

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 22/94 (23%), Positives = 44/94 (46%), Gaps = 5/94 (5%)

Query: 171 KLITREASERVIRYAFEYARTVGRPKVVVVHKSTIQRLADGLFVNVAQELGRE-----YP 225
           K++T    E +   + + ++       +  +K  I +LA  LF+   QE           
Sbjct: 192 KIVTPNKRELITFLSLQMSKECLNSIKIKSNKEIISQLAYSLFLLSPQEFASSINKIILS 251

Query: 226 DIELQTELLDNTVLNVVTKPEAYKDVVAVCPNLY 259
           ++ + +++L  T+ ++   PEA+KDVV    N+Y
Sbjct: 252 NVTVSSQILSKTINSIRMFPEAFKDVVEKGYNIY 285

>TPHA0A01440 Chr1 (281826..284477) [2652 bp, 883 aa] {ON} Anc_8.352
           YLR144C
          Length = 883

 Score = 30.8 bits (68), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 34/81 (41%), Gaps = 2/81 (2%)

Query: 153 GEYSGIEHVVSPGVVQSIKLITREASERVIRYA--FEYARTVGRPKVVVVHKSTIQRLAD 210
           G  S + H ++P +  SI   + E    + RY   FE     GR  ++ +      R+A 
Sbjct: 335 GFVSAVYHYITPVIYSSIGFRSLEELPAISRYTQKFESILENGRKWIIYISSPDNTRIAF 394

Query: 211 GLFVNVAQELGREYPDIELQT 231
               N A    +  P+I LQT
Sbjct: 395 KKMSNNAYSADKRLPEILLQT 415

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,090,818
Number of extensions: 1271583
Number of successful extensions: 3723
Number of sequences better than 10.0: 90
Number of HSP's gapped: 3504
Number of HSP's successfully gapped: 90
Length of query: 367
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 256
Effective length of database: 40,753,473
Effective search space: 10432889088
Effective search space used: 10432889088
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)