Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AFR136C5.476ON69569532700.0
Ecym_23125.476ON7566279321e-114
SAKL0G03586g5.476ON8533425398e-58
Kwal_55.212545.476ON8531904513e-46
KLTH0F14982g5.476ON8281254415e-45
TDEL0A034005.476ON8101504362e-44
NCAS0H022805.476ON6572864225e-43
ZYRO0D11286g5.476ON7171334156e-42
NDAI0C013805.476ON7671273856e-38
CAGL0I07183g5.476ON7711693723e-36
Suva_8.1915.476ON7582733704e-36
Smik_15.3195.476ON7622973696e-36
YOR140W (SFL1)5.476ON7662753615e-35
Skud_15.3035.476ON7481483581e-34
KNAG0B040405.476ON8521703521e-33
TDEL0G010105.77ON3981382452e-21
KNAG0F020206.209ON7711232342e-19
Skud_7.2086.209ON8361172307e-19
ZYRO0G08734g6.209ON5721262261e-18
YGL073W (HSF1)6.209ON8331102281e-18
Smik_7.2096.209ON8371102272e-18
Kpol_1033.466.209ON7171202235e-18
KAFR0C022506.209ON6131122225e-18
NCAS0E038705.77ON3931392185e-18
ZYRO0C11506g5.77ON3341622157e-18
KLTH0H04290g6.209ON5691382181e-17
Suva_7.1976.209ON8461182182e-17
TDEL0E051706.209ON5461122162e-17
KLLA0D03322g6.209ON6771172172e-17
Ecym_22086.209ON5291102152e-17
TBLA0A020006.209ON6271102154e-17
AFL085C6.209ON5691112144e-17
SAKL0H02354g5.77ON3851182097e-17
SAKL0A04576g6.209ON5571122101e-16
SAKL0B12408g4.385ON4651412072e-16
KAFR0B069904.385ON5451092082e-16
Skud_7.5825.77ON4521152072e-16
NDAI0I011106.209ON9051102102e-16
KAFR0B044105.77ON4651322063e-16
Kpol_1062.85.77ON4331442053e-16
TBLA0G02700singletonON4451122053e-16
Kwal_56.240366.209ON5671102047e-16
KLLA0A10219g4.385ON4751212011e-15
CAGL0H03443g6.209ON7061102031e-15
KLLA0A05368g5.77ON4121321992e-15
NCAS0D037806.209ON7601102012e-15
YGR249W (MGA1)5.77ON4561141964e-15
KLTH0D17182g4.385ON4641231956e-15
Smik_16.585.77ON4531151956e-15
ADL388W4.385ON4821131948e-15
TPHA0C001504.385ON5101131931e-14
Ecym_74744.385ON4961211922e-14
TBLA0A107004.385ON5871111912e-14
Suva_7.5445.77ON4691151902e-14
TDEL0D003204.385ON5471171913e-14
Kwal_47.167704.385ON4611251903e-14
NDAI0B009405.77ON5261161903e-14
NCAS0A064504.385ON6091261913e-14
NDAI0D034304.385ON5971121894e-14
TPHA0E028806.209ON7181121895e-14
AEL216C5.77ON4501231875e-14
CAGL0F08195g5.77ON3251211836e-14
CAGL0F09097g4.385ON6301211887e-14
ZYRO0G00484g4.385ON6471171842e-13
TPHA0H011305.77ON4391471812e-13
Kpol_265.24.385ON5491411823e-13
Smik_8.2964.385ON6251671806e-13
YHR206W (SKN7)4.385ON6221241781e-12
Suva_15.4124.385ON6171241771e-12
Skud_8.2734.385ON6231241771e-12
Kpol_1050.795.77ON4331421733e-12
KNAG0M001804.385ON6151121725e-12
TPHA0A052505.77ON6011671682e-11
KNAG0K004705.77ON4141511634e-11
Ecym_55735.77ON572661644e-11
TBLA0E049804.385ON7911151583e-10
KLTH0H00814g5.77ON3901731511e-09
Skud_10.3734.385ON346851054e-04
KLLA0E03191g5.476ON770371020.001
YJR147W (HMS2)4.385ON35864990.002
Smik_10.4424.385ON34764980.003
Suva_12.2414.385ON34966950.007
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AFR136C
         (695 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AFR136C Chr6 complement(682887..684974) [2088 bp, 695 aa] {ON} S...  1264   0.0  
Ecym_2312 Chr2 complement(607441..609711) [2271 bp, 756 aa] {ON}...   363   e-114
SAKL0G03586g Chr7 (297103..299664) [2562 bp, 853 aa] {ON} some s...   212   8e-58
Kwal_55.21254 s55 complement(752205..754766) [2562 bp, 853 aa] {...   178   3e-46
KLTH0F14982g Chr6 complement(1224825..1227311) [2487 bp, 828 aa]...   174   5e-45
TDEL0A03400 Chr1 (605729..608161) [2433 bp, 810 aa] {ON} Anc_5.4...   172   2e-44
NCAS0H02280 Chr8 (447781..449754) [1974 bp, 657 aa] {ON} Anc_5.476    167   5e-43
ZYRO0D11286g Chr4 (952637..954790) [2154 bp, 717 aa] {ON} some s...   164   6e-42
NDAI0C01380 Chr3 complement(287185..289488) [2304 bp, 767 aa] {O...   152   6e-38
CAGL0I07183g Chr9 complement(690080..692395) [2316 bp, 771 aa] {...   147   3e-36
Suva_8.191 Chr8 (342114..344390) [2277 bp, 758 aa] {ON} YOR140W ...   147   4e-36
Smik_15.319 Chr15 (548397..550685) [2289 bp, 762 aa] {ON} YOR140...   146   6e-36
YOR140W Chr15 (586981..589281) [2301 bp, 766 aa] {ON}  SFL1Trans...   143   5e-35
Skud_15.303 Chr15 (541019..543265) [2247 bp, 748 aa] {ON} YOR140...   142   1e-34
KNAG0B04040 Chr2 complement(773334..775892) [2559 bp, 852 aa] {O...   140   1e-33
TDEL0G01010 Chr7 complement(209613..210809) [1197 bp, 398 aa] {O...    99   2e-21
KNAG0F02020 Chr6 complement(384620..386935) [2316 bp, 771 aa] {O...    95   2e-19
Skud_7.208 Chr7 (371946..374456) [2511 bp, 836 aa] {ON} YGL073W ...    93   7e-19
ZYRO0G08734g Chr7 (704684..706402) [1719 bp, 572 aa] {ON} simila...    92   1e-18
YGL073W Chr7 (368753..371254) [2502 bp, 833 aa] {ON}  HSF1Trimer...    92   1e-18
Smik_7.209 Chr7 (363136..365649) [2514 bp, 837 aa] {ON} YGL073W ...    92   2e-18
Kpol_1033.46 s1033 (115581..117734) [2154 bp, 717 aa] {ON} (1155...    91   5e-18
KAFR0C02250 Chr3 (445113..446954) [1842 bp, 613 aa] {ON} Anc_6.2...    90   5e-18
NCAS0E03870 Chr5 (759876..761057) [1182 bp, 393 aa] {ON} Anc_5.77      89   5e-18
ZYRO0C11506g Chr3 (891756..892760) [1005 bp, 334 aa] {ON} some s...    87   7e-18
KLTH0H04290g Chr8 complement(387890..389599) [1710 bp, 569 aa] {...    89   1e-17
Suva_7.197 Chr7 (361661..364201) [2541 bp, 846 aa] {ON} YGL073W ...    89   2e-17
TDEL0E05170 Chr5 (951579..953219) [1641 bp, 546 aa] {ON} Anc_6.2...    88   2e-17
KLLA0D03322g Chr4 complement(276591..278624) [2034 bp, 677 aa] {...    88   2e-17
Ecym_2208 Chr2 complement(410156..411745) [1590 bp, 529 aa] {ON}...    87   2e-17
TBLA0A02000 Chr1 (482464..484347) [1884 bp, 627 aa] {ON} Anc_6.2...    87   4e-17
AFL085C Chr6 complement(279712..281421) [1710 bp, 569 aa] {ON} S...    87   4e-17
SAKL0H02354g Chr8 complement(236815..237972) [1158 bp, 385 aa] {...    85   7e-17
SAKL0A04576g Chr1 complement(422093..423766) [1674 bp, 557 aa] {...    86   1e-16
SAKL0B12408g Chr2 (1065161..1066558) [1398 bp, 465 aa] {ON} simi...    84   2e-16
KAFR0B06990 Chr2 (1455520..1457157) [1638 bp, 545 aa] {ON} Anc_4...    85   2e-16
Skud_7.582 Chr7 (962776..964134) [1359 bp, 452 aa] {ON} YGR249W ...    84   2e-16
NDAI0I01110 Chr9 complement(267274..269991) [2718 bp, 905 aa] {O...    86   2e-16
KAFR0B04410 Chr2 (916555..917952) [1398 bp, 465 aa] {ON} Anc_5.7...    84   3e-16
Kpol_1062.8 s1062 complement(17211..18512) [1302 bp, 433 aa] {ON...    84   3e-16
TBLA0G02700 Chr7 (710230..711567) [1338 bp, 445 aa] {ON}               84   3e-16
Kwal_56.24036 s56 (822498..824201) [1704 bp, 567 aa] {ON} YGL073...    83   7e-16
KLLA0A10219g Chr1 (896931..898358) [1428 bp, 475 aa] {ON} simila...    82   1e-15
CAGL0H03443g Chr8 (320888..323008) [2121 bp, 706 aa] {ON} weakly...    83   1e-15
KLLA0A05368g Chr1 complement(490032..491270) [1239 bp, 412 aa] {...    81   2e-15
NCAS0D03780 Chr4 (702461..704743) [2283 bp, 760 aa] {ON} Anc_6.209     82   2e-15
YGR249W Chr7 (988049..989419) [1371 bp, 456 aa] {ON}  MGA1Protei...    80   4e-15
KLTH0D17182g Chr4 complement(1424948..1426342) [1395 bp, 464 aa]...    80   6e-15
Smik_16.58 Chr16 complement(107370..108731) [1362 bp, 453 aa] {O...    80   6e-15
ADL388W Chr4 (30355..31803) [1449 bp, 482 aa] {ON} Syntenic homo...    79   8e-15
TPHA0C00150 Chr3 complement(15029..16561) [1533 bp, 510 aa] {ON}...    79   1e-14
Ecym_7474 Chr7 (967242..968732) [1491 bp, 496 aa] {ON} similar t...    79   2e-14
TBLA0A10700 Chr1 (2646036..2647799) [1764 bp, 587 aa] {ON} Anc_4...    78   2e-14
Suva_7.544 Chr7 (943366..944775) [1410 bp, 469 aa] {ON} YGR249W ...    78   2e-14
TDEL0D00320 Chr4 complement(53243..54886) [1644 bp, 547 aa] {ON}...    78   3e-14
Kwal_47.16770 s47 (103208..104593) [1386 bp, 461 aa] {ON} YHR206...    78   3e-14
NDAI0B00940 Chr2 complement(218385..219965) [1581 bp, 526 aa] {O...    78   3e-14
NCAS0A06450 Chr1 (1273459..1275288) [1830 bp, 609 aa] {ON} Anc_4...    78   3e-14
NDAI0D03430 Chr4 (809977..811770) [1794 bp, 597 aa] {ON} Anc_4.385     77   4e-14
TPHA0E02880 Chr5 complement(603237..605393) [2157 bp, 718 aa] {O...    77   5e-14
AEL216C Chr5 complement(228433..229785) [1353 bp, 450 aa] {ON} S...    77   5e-14
CAGL0F08195g Chr6 (813050..814027) [978 bp, 325 aa] {ON} some si...    75   6e-14
CAGL0F09097g Chr6 (898706..900598) [1893 bp, 630 aa] {ON} simila...    77   7e-14
ZYRO0G00484g Chr7 complement(35793..37736) [1944 bp, 647 aa] {ON...    75   2e-13
TPHA0H01130 Chr8 (250116..251435) [1320 bp, 439 aa] {ON} Anc_5.7...    74   2e-13
Kpol_265.2 s265 (9842..11491) [1650 bp, 549 aa] {ON} (9842..1149...    75   3e-13
Smik_8.296 Chr8 (487452..489329) [1878 bp, 625 aa] {ON} YHR206W ...    74   6e-13
YHR206W Chr8 (512732..514600) [1869 bp, 622 aa] {ON}  SKN7Nuclea...    73   1e-12
Suva_15.412 Chr15 (719438..721291) [1854 bp, 617 aa] {ON} YHR206...    73   1e-12
Skud_8.273 Chr8 (481627..483498) [1872 bp, 623 aa] {ON} YHR206W ...    73   1e-12
Kpol_1050.79 s1050 (171402..172703) [1302 bp, 433 aa] {ON} (1714...    71   3e-12
KNAG0M00180 Chr13 complement(22500..24347) [1848 bp, 615 aa] {ON...    71   5e-12
TPHA0A05250 Chr1 (1183602..1185407) [1806 bp, 601 aa] {ON} Anc_5...    69   2e-11
KNAG0K00470 Chr11 complement(79664..80908) [1245 bp, 414 aa] {ON...    67   4e-11
Ecym_5573 Chr5 (1172938..1174656) [1719 bp, 572 aa] {ON} similar...    68   4e-11
TBLA0E04980 Chr5 (1275927..1278302) [2376 bp, 791 aa] {ON} Anc_4...    65   3e-10
KLTH0H00814g Chr8 complement(90962..92134) [1173 bp, 390 aa] {ON...    63   1e-09
Skud_10.373 Chr10 (662167..663207) [1041 bp, 346 aa] {ON} YJR147...    45   4e-04
KLLA0E03191g Chr5 (296592..298904) [2313 bp, 770 aa] {ON} some s...    44   0.001
YJR147W Chr10 (704196..705272) [1077 bp, 358 aa] {ON}  HMS2Prote...    43   0.002
Smik_10.442 Chr10 (693234..694277) [1044 bp, 347 aa] {ON} YJR147...    42   0.003
Suva_12.241 Chr12 (384063..385112) [1050 bp, 349 aa] {ON} YJR147...    41   0.007

>AFR136C Chr6 complement(682887..684974) [2088 bp, 695 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR140W
           (SFL1)
          Length = 695

 Score = 1264 bits (3270), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 626/695 (90%), Positives = 626/695 (90%)

Query: 1   MAQLEDPKERAGKVGESQHGQHHNTAFIHKLYSMLEDDNMKDLIWWSASQNSFLIKPNEK 60
           MAQLEDPKERAGKVGESQHGQHHNTAFIHKLYSMLEDDNMKDLIWWSASQNSFLIKPNEK
Sbjct: 1   MAQLEDPKERAGKVGESQHGQHHNTAFIHKLYSMLEDDNMKDLIWWSASQNSFLIKPNEK 60

Query: 61  FSKALATFFKHTNVASFVRQLNMYGFHKVSDHKPSSAKGTSQDEDEAINLWEFRHSMGCF 120
           FSKALATFFKHTNVASFVRQLNMYGFHKVSDHKPSSAKGTSQDEDEAINLWEFRHSMGCF
Sbjct: 61  FSKALATFFKHTNVASFVRQLNMYGFHKVSDHKPSSAKGTSQDEDEAINLWEFRHSMGCF 120

Query: 121 RKGDKESLKSIKRRSSKNQVLLSRNNSAQSLASQYNSQQDLGPGGSSIAGHVHPIEPADK 180
           RKGDKESLKSIKRRSSKNQVLLSRNNSAQSLASQYNSQQDLGPGGSSIAGHVHPIEPADK
Sbjct: 121 RKGDKESLKSIKRRSSKNQVLLSRNNSAQSLASQYNSQQDLGPGGSSIAGHVHPIEPADK 180

Query: 181 YYSTTVYQPPYTDAPPLHSQSQIQAYPDMRFPQEQKPHTSSVITLPHLPNSAIEDLRATN 240
           YYSTTVYQPPYTDAPPLHSQSQIQAYPDMRFPQEQKPHTSSVITLPHLPNSAIEDLRATN
Sbjct: 181 YYSTTVYQPPYTDAPPLHSQSQIQAYPDMRFPQEQKPHTSSVITLPHLPNSAIEDLRATN 240

Query: 241 LDMMKLLDLVQKAMHISSPPSANEXXXXXXXXXXXXXXXXXXXXXXXXXANDVTSPSSFA 300
           LDMMKLLDLVQKAMHISSPPSANE                         ANDVTSPSSFA
Sbjct: 241 LDMMKLLDLVQKAMHISSPPSANELGGSVCSTSGGSGLSSNQLGSASGSANDVTSPSSFA 300

Query: 301 RSPTGTRERTLEYLHQEIAAFRTTILMKLQRHAELQLHMLPPTPSQRHSHPQNSYAVSAP 360
           RSPTGTRERTLEYLHQEIAAFRTTILMKLQRHAELQLHMLPPTPSQRHSHPQNSYAVSAP
Sbjct: 301 RSPTGTRERTLEYLHQEIAAFRTTILMKLQRHAELQLHMLPPTPSQRHSHPQNSYAVSAP 360

Query: 361 PSTGTNFLPYNGSGSIGMPTGYDAYPTNKPALAIPGAISHGFHGSPYLMLDPYAKGXXXX 420
           PSTGTNFLPYNGSGSIGMPTGYDAYPTNKPALAIPGAISHGFHGSPYLMLDPYAKG    
Sbjct: 361 PSTGTNFLPYNGSGSIGMPTGYDAYPTNKPALAIPGAISHGFHGSPYLMLDPYAKGSSSS 420

Query: 421 XXRKRHMSVLVDXXXXXXXXXXXXXXXXXLAQPTSTSSSPVHAPEGNMPHANAAGANSPF 480
             RKRHMSVLVD                 LAQPTSTSSSPVHAPEGNMPHANAAGANSPF
Sbjct: 421 ISRKRHMSVLVDPLAPAPMSAPAAMQVPSLAQPTSTSSSPVHAPEGNMPHANAAGANSPF 480

Query: 481 HASCPVSRIDSRQDLHHHQTSNPSASEDKRPFSPSRKDXXXXXXXXXXTTNARGSGDGNS 540
           HASCPVSRIDSRQDLHHHQTSNPSASEDKRPFSPSRKD          TTNARGSGDGNS
Sbjct: 481 HASCPVSRIDSRQDLHHHQTSNPSASEDKRPFSPSRKDSPPSQLLPLLTTNARGSGDGNS 540

Query: 541 LLLAPQSPATLPPTASQHRLPAPTPQNNAGRGPAQVSITYKPYFPYGTIPPQPVLSSQYI 600
           LLLAPQSPATLPPTASQHRLPAPTPQNNAGRGPAQVSITYKPYFPYGTIPPQPVLSSQYI
Sbjct: 541 LLLAPQSPATLPPTASQHRLPAPTPQNNAGRGPAQVSITYKPYFPYGTIPPQPVLSSQYI 600

Query: 601 LPLFQXXXXXXXXXXXVTAAHAPLRSTTAIPETSSCNNSEIPSFPKPTTDEQQAPATVNQ 660
           LPLFQ           VTAAHAPLRSTTAIPETSSCNNSEIPSFPKPTTDEQQAPATVNQ
Sbjct: 601 LPLFQSGSGSFTSGSSVTAAHAPLRSTTAIPETSSCNNSEIPSFPKPTTDEQQAPATVNQ 660

Query: 661 SATNSHRQSIVNQDTCSSPATSKSRGLYALLNHDT 695
           SATNSHRQSIVNQDTCSSPATSKSRGLYALLNHDT
Sbjct: 661 SATNSHRQSIVNQDTCSSPATSKSRGLYALLNHDT 695

>Ecym_2312 Chr2 complement(607441..609711) [2271 bp, 756 aa] {ON}
           similar to Ashbya gossypii AFR136C
          Length = 756

 Score =  363 bits (932), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 260/627 (41%), Positives = 330/627 (52%), Gaps = 85/627 (13%)

Query: 25  TAFIHKLYSMLEDDNMKDLIWWSASQNSFLIKPNEKFSKALATFFKHTNVASFVRQLNMY 84
           TAFIHKLYSMLED+ MKDLIWWS S+NSFLIKPNEKFSKALATFFKHTNVASFVRQLNMY
Sbjct: 71  TAFIHKLYSMLEDEEMKDLIWWSESENSFLIKPNEKFSKALATFFKHTNVASFVRQLNMY 130

Query: 85  GFHKVSDHKPS-------SAKGTSQDEDEAINLWEFRHSMGCFRKGDKESLKSIKRRSSK 137
           GFHKVSDHK +        A G    E+++INLWEFRHS+GCFRKGDKESLKSIKRRSSK
Sbjct: 131 GFHKVSDHKSNEKSSETDGAHGNGDIEEDSINLWEFRHSLGCFRKGDKESLKSIKRRSSK 190

Query: 138 NQVLLSRNNSAQSLASQYNSQQ-----DLGPGGSSIAGHVHPIEPADKYY-STTVYQPPY 191
           NQ++ +R +S     S    Q      D G       GHV   +  D YY  +  YQ PY
Sbjct: 191 NQIVTARVSSTCGAPSHTACQDPSSWSDTG----GCCGHVQSPDVPDAYYRGSMFYQLPY 246

Query: 192 TDA-----------PPLHSQSQIQAYPDMRFPQEQKPHTSSVITLPHLPNSAIEDLRATN 240
            +            P      ++Q++ D R   + K H   ++TL +  ++AIE+LRATN
Sbjct: 247 YEVLQQGQKQQQQYPFQPQLQELQSH-DARNHFDYKQHQLGLMTLQNRYDNAIEELRATN 305

Query: 241 LDMMKLLDLVQKAMHISSPPSANEXXXXXXXXXXXXXXXXXXXXXXXXXANDVTSPSSFA 300
           +DMMKLLDLVQKA+ IS+ PSA+                            DV SP  + 
Sbjct: 306 MDMMKLLDLVQKAIWISTVPSASSNTSAIAPGVSSGSRPSTPVNVSAQIGQDVVSP-GYE 364

Query: 301 RSPTGTRERTLEYLHQEIAAFRTTILMKLQRHAELQLHMLPPTPSQRHSH-PQNSYAVSA 359
            SP   +++  E L+QEI  F+ +IL KLQR    Q+    P  SQ+ S  P   Y+  A
Sbjct: 365 LSPKTNQKQYFEQLNQEIVKFKASILNKLQR----QIDYHAPYHSQKLSQAPVMYYSSLA 420

Query: 360 P----PSTGTNFLPYNGSGSIGMPTGYDAYPTNKPALAIP----GAISHGFHGSPYLMLD 411
           P    P+    F  YN +  I  P     Y T+ P   IP     A + G  G PYLM++
Sbjct: 421 PLSSDPTPDMEFQHYNSASPINSPVSDGLYSTSNP---IPEQTSTATTAGIKGPPYLMMN 477

Query: 412 PYAKGXXXXXX-RKRHMSVLVDXXXXXXXXXXXXXXXXXLAQPTSTSSSPVHAPE-GNMP 469
           P+AK        +KRHMSV +D                 + Q ++++S+P +  E  + P
Sbjct: 478 PFAKRKSTESLPKKRHMSVFMD-------------PLAPVPQQSASTSAPTNINEPLSGP 524

Query: 470 HANAAGANSPFHASCPVSRIDSRQDLHHHQTSNPSASEDKRPFSPSRKDXXXXXXXXXXT 529
           H    G +SPF  +   SRI SRQD    QTSNP    +K P+SP  +D          T
Sbjct: 525 HI-LGGTSSPFVPTNLSSRISSRQDSQCVQTSNPVTMGEKGPYSPPLQDSTPHAPLHSST 583

Query: 530 ---------TNARGSGDGNSLLLAP--QSPATLPPTASQHRLPAPTPQNNAGRGPAQVSI 578
                     +   S   N++  A   QS  +  P+ S +R   PTP            I
Sbjct: 584 LMHSSDVSHISHPSSSVFNTVGAASVVQSAYSSVPSTSGYRHTIPTP------------I 631

Query: 579 TYKPYFPYGTIPPQPVLSSQYILPLFQ 605
            YKP FPYGT+P Q + SSQYI+P  Q
Sbjct: 632 PYKPQFPYGTMPTQSIGSSQYIVPSAQ 658

>SAKL0G03586g Chr7 (297103..299664) [2562 bp, 853 aa] {ON} some
           similarities with uniprot|P20134 Saccharomyces
           cerevisiae YOR140W SFL1 Transcription factor with
           domains homologous to Hsf1p and to myc oncoprotein
           required for normal cell surface assembly and
           flocculence
          Length = 853

 Score =  212 bits (539), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 136/342 (39%), Positives = 182/342 (53%), Gaps = 52/342 (15%)

Query: 22  HHNTAFIHKLYSMLEDDNMKDLIWWSASQNSFLIKPNEKFSKALATFFKHTNVASFVRQL 81
           HH+TAFIHKLYSMLED  MKDLIWWS +Q+SFLIKPNEKFSKALATFFKHTNVASFVRQL
Sbjct: 40  HHHTAFIHKLYSMLEDQEMKDLIWWSPTQDSFLIKPNEKFSKALATFFKHTNVASFVRQL 99

Query: 82  NMYGFHKVSDHKPSSAKGTSQD----EDEAINLWEFRHSMGCFRKGDKESLKSIKRRSSK 137
           NMYGFHKV+D+        S D     +++INLWEF+HS   FRKGD E LK+IKRRSS+
Sbjct: 100 NMYGFHKVNDNTGKQTDKYSTDSASTNEDSINLWEFKHSSSAFRKGDMEGLKTIKRRSSR 159

Query: 138 NQVLLSRNNSAQSL-ASQYNSQQDLGPGGSSIAGHVHPIEPAD----------------- 179
           N +L  +N+S  S  A Q  S  D          + HP+  A                  
Sbjct: 160 NPILARKNSSTASTPAEQSESWTD---------HNRHPLSNASAPEMNSQSYTNLRSISS 210

Query: 180 -KYYSTTVYQP-PYTDAPPLHSQSQIQAYPDMRFPQEQKPHTSSV----ITLPHLPNSAI 233
            ++ +  VY P  Y    P  S +Q Q         E   +T+S+       P   +  +
Sbjct: 211 PQHSNGMVYVPVEYFGVQPAASHNQQQNQVLDSKHNEGVQNTTSLKNEQANAPWNCDQTV 270

Query: 234 EDLRATNLDMMKLLDLVQKAMHISSPPSANEXXXXXXXXXXXXXXXXXXXXXXXXXANDV 293
            +LR TN+DM++LL+L++K   +SS                                N  
Sbjct: 271 YELRTTNMDMIRLLELIEKWFFLSS-----------TQNTGTSTTNEAIYRTTTPLTNIS 319

Query: 294 TSPSSFARSPTG----TRERTLEYLHQEIAAFRTTILMKLQR 331
           T+PS+      G       + L++L+ EI+  ++T+L++LQ+
Sbjct: 320 TNPSAETNMSPGQSLPQHHQQLDWLNGEISKLKSTVLLRLQK 361

 Score = 48.5 bits (114), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 57/210 (27%), Positives = 77/210 (36%), Gaps = 70/210 (33%)

Query: 401 GFHGSPYLMLDPYAK-GXXXXXXRKRHMSVLVDXXXXXXXXXXXXXXXXXLAQPTSTSSS 459
           G  G+PYLM++P+AK        R RHMSVL+D                      S S +
Sbjct: 543 GSSGTPYLMMNPFAKRKSSASSARNRHMSVLMDPLVPAPPPSSAPPIS------NSASPN 596

Query: 460 PVHAPEGNMPHANAAGANSPFHA---SCPVSRIDSRQDLHHHQTSNP-----------SA 505
           P+         +   G  SP+ A   S P ++ D RQ + +  TSNP             
Sbjct: 597 PIQQ---QQQLSQQYGPPSPYGALPGSSPGAKHDPRQSVRYVPTSNPDPDSTITTSLREI 653

Query: 506 SEDKRPFSPSRKDXXXXXXXXXXTTNARGSGDGNSLLLAPQSPATLPPTASQHRLPAPTP 565
            ++KRPFSP                                         S  R+ +P P
Sbjct: 654 KQEKRPFSP----------------------------------------LSTERVASP-P 672

Query: 566 QNNAGRGPAQVS-----ITYKPYFPYGTIP 590
           Q    +G  Q S     I YKPY+PYGT+P
Sbjct: 673 QTGKQQGKTQSSSVPNAIPYKPYYPYGTVP 702

>Kwal_55.21254 s55 complement(752205..754766) [2562 bp, 853 aa] {ON}
           YOR140W (SFL1) - 1:1 [contig 130] FULL
          Length = 853

 Score =  178 bits (451), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 118/190 (62%), Gaps = 23/190 (12%)

Query: 25  TAFIHKLYSMLEDDNMKDLIWWSASQNSFLIKPNEKFSKALATFFKHTNVASFVRQLNMY 84
           TAFIHKLYSMLED+ M +LIWWS SQ SFLI+P E+FSKALAT+FKHTNVASFVRQLNMY
Sbjct: 58  TAFIHKLYSMLEDEEMHELIWWSPSQTSFLIRPTERFSKALATYFKHTNVASFVRQLNMY 117

Query: 85  GFHKVSDHKPSSAKGTS--------------QDEDEAINLWEFRHSMGCFRKGDKESLKS 130
           GFHKV+DHK   AK  +              Q  D + ++WEF+HS   FR+GD ESLK 
Sbjct: 118 GFHKVNDHKAHGAKSGAANKGEEAGLKTRGGQPTDNSTSVWEFKHSSAAFRRGDMESLKL 177

Query: 131 IKRRSSKNQVLLSRNNSAQSLASQYNSQQDLGPGGSSIAGHVHPIEPADKYYSTTVYQPP 190
           IKRRSS+ Q   +R NSA ++++       L PG     G   PI          V+  P
Sbjct: 178 IKRRSSRYQS-SNRKNSASTVST------PLEPGMPEQPGEQQPIPHLSGVPVDMVH--P 228

Query: 191 YTDAPPLHSQ 200
           Y   P  HSQ
Sbjct: 229 YAYVPQPHSQ 238

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 92/392 (23%), Positives = 146/392 (37%), Gaps = 99/392 (25%)

Query: 232 AIEDLRATNLDMMKLLDLVQKAMHISSPPSANEXXXXXXXXXXXXXXXXXXXXXXXXXAN 291
           A+EDLR +N+DM+KLLDLV   + +S   S                             +
Sbjct: 404 AVEDLRNSNMDMIKLLDLVHSLVTVSPQLSG------------ANNRKQDEVKRSTTPVS 451

Query: 292 DVTSPSSFARSPT--GTRERTLEYLHQEIAAFRTTILMKLQRHAELQLHMLPPTPSQRHS 349
            + + + F+ SP     +++ L+ +  EIA  + + L ++QR A LQ  M P +  +  +
Sbjct: 452 GMPASNDFSESPKDGSLQQQYLDNIMGEIARLKNSTLYRVQRSALLQQGMRPSSSLEHPT 511

Query: 350 HPQNSYAVSAPPSTGTNFLPYNGSGSIG-MPTGYDA---------------YPTNKPALA 393
               +Y ++ P     +      S ++  M TG+ A                P+  P +A
Sbjct: 512 AAATTYPMAFPGRAALSTQTSMSSPALSQMATGHHASLPQMTHPMYYQPAYTPSAYPTIA 571

Query: 394 IP-------GAISHGFHGSPYLMLDPYAKGXXXXXXRKRHMSVLVDXXXXXXXXXXXXXX 446
            P        AI      +P L ++P+ K       R R+MSVL+D              
Sbjct: 572 GPVSDYYGTAAIKAPGASAPCLKMNPFEKKGSTSSSRNRNMSVLMDPLAPAPMSQSMP-- 629

Query: 447 XXXLAQPTSTSSSPVHAPEGNMPHANAAGANSPFHASCPV---SRIDSRQDLHHHQTSNP 503
                 P STS SP   P        +   ++  H S P    SR +S+ D+ +  TSNP
Sbjct: 630 ------PISTSVSP--NPLQQSAQQQSYYVST--HMSNPPSVHSRKNSKNDVKNVPTSNP 679

Query: 504 SASE-----DKRPFSPSRKDXXXXXXXXXXTTNARGSGDGNSLLLAPQSPATLPPTASQH 558
             +      D+RP +P   D          + NA GS                       
Sbjct: 680 DGNREIRLSDRRPLTPPVPD----SSTKGGSKNAAGS----------------------- 712

Query: 559 RLPAPTPQNNAGRGPAQVSITYKPYFPYGTIP 590
                          A  +++YKP+FPYGT+P
Sbjct: 713 ---------------AVNAVSYKPFFPYGTVP 729

>KLTH0F14982g Chr6 complement(1224825..1227311) [2487 bp, 828 aa]
           {ON} some similarities with uniprot|P20134 Saccharomyces
           cerevisiae YOR140W SFL1 Transcription factor with
           domains homologous to Hsf1p and to myc oncoprotein
           required for normal cell surface assembly and
           flocculence
          Length = 828

 Score =  174 bits (441), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 81/125 (64%), Positives = 95/125 (76%), Gaps = 8/125 (6%)

Query: 24  NTAFIHKLYSMLEDDNMKDLIWWSASQNSFLIKPNEKFSKALATFFKHTNVASFVRQLNM 83
           NTAFIHKLYSMLED  M +LIWWS  Q SFLI+P E+F KALAT+FKHTNVASFVRQLNM
Sbjct: 71  NTAFIHKLYSMLEDPEMDELIWWSPPQTSFLIRPTERFGKALATYFKHTNVASFVRQLNM 130

Query: 84  YGFHKVSDHK--PSSAKGTSQDEDEA------INLWEFRHSMGCFRKGDKESLKSIKRRS 135
           YGFHKV+DHK   +S  G ++ +D A       ++WEF+HS   FR+GD ESLK IKRRS
Sbjct: 131 YGFHKVNDHKTHAASKNGAAKTDDPASKSENTTSIWEFKHSSSAFRRGDMESLKLIKRRS 190

Query: 136 SKNQV 140
           S+ Q 
Sbjct: 191 SRYQA 195

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 98/384 (25%), Positives = 148/384 (38%), Gaps = 82/384 (21%)

Query: 231 SAIEDLRATNLDMMKLLDLVQKAMHISSPPSANEXXXXXXXXXXXXXXXXXXXXXXXXXA 290
           +A+EDLR +N+DM++LLDLV   + ++   +A                            
Sbjct: 394 AAVEDLRNSNMDMVRLLDLVHNLVTLTPQLAA-----------ASSGRPSEGIKRSTTPV 442

Query: 291 NDVTSPSSFARSP--TGTRERTLEYLHQEIAAFRTTILMKLQRHAELQLHMLP------- 341
           +   +PS    SP  T ++++ ++ +  EIA  + + L +LQR   LQ  + P       
Sbjct: 443 SGHPNPSEMGTSPRDTPSQQQCMDQIMSEIARLKNSTLYRLQRSTMLQQTVRPVHSFSEY 502

Query: 342 ------PTPSQRHSHPQNSYAVSAPP-STGTNFLPY---NGSGSIGMPTGY--DAYP-TN 388
                   P+       N  ++S+P  S  TN  P      S ++  P  Y    YP T 
Sbjct: 503 PMTSSSAIPAASRPPLSNQTSLSSPALSQLTNAQPAPLPQMSHAMYYPPAYGPSVYPGTP 562

Query: 389 KPALAIPGAISHGFHGS-PYLMLDPYAKGXXXXXXRKRHMSVLVDXXXXXXXXXXXXXXX 447
            P     G  +    GS PYLM++P+ K         R+MSVL+D               
Sbjct: 563 GPQSDYFGTTAKANSGSMPYLMMNPFEKKTSTSSSGNRNMSVLMDPLAPAPIVQALPG-- 620

Query: 448 XXLAQPTSTSSSPVHAPEGNMPHANAAGANSPFHASCPVSRIDSRQDLHHHQTSNPSASE 507
                  STS+SP    +    H   AG     H++  +   DSR++  +   S P    
Sbjct: 621 ------VSTSASPNPNQQIAQQHGYFAG-----HSTSNLPLADSRKNSRNETKSIP---- 665

Query: 508 DKRPFSPSRKDXXXXXXXXXXTTNARGSGDGNSLLLAPQSPATLP-PTASQHRLPAPTPQ 566
                                T+N  G+ D       PQSP+    PT +    PA    
Sbjct: 666 ---------------------TSNPDGARDLKQSNRRPQSPSVAETPTRATANKPA---- 700

Query: 567 NNAGRGPAQVSITYKPYFPYGTIP 590
                G A  ++TYKPYFPYGT+P
Sbjct: 701 -----GSAVSTMTYKPYFPYGTVP 719

>TDEL0A03400 Chr1 (605729..608161) [2433 bp, 810 aa] {ON} Anc_5.476
           YOR140W
          Length = 810

 Score =  172 bits (436), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 106/150 (70%), Gaps = 18/150 (12%)

Query: 17  SQHGQHHNTAFIHKLYSMLEDDNMKDLIWWSASQNSFLIKPNEKFSKALATFFKHTNVAS 76
           S H    NT FIHKLY++LEDD++KDLIWWS S  SFLI+P E+FS+ALAT+FKHTN+AS
Sbjct: 42  SAHVPLQNTVFIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERFSRALATYFKHTNIAS 101

Query: 77  FVRQLNMYGFHKVS-DHK-----------PSSAKGTSQDEDEAINLWEFRHSMGCFRKGD 124
           FVRQLNMYGFHKVS DH            PSS  G      + + +WEFRHSMG F++GD
Sbjct: 102 FVRQLNMYGFHKVSNDHNKGIQQQQQQQQPSSEAG-----QDGVKIWEFRHSMGIFKRGD 156

Query: 125 KESLKSIKRRSSKNQVLLS-RNNSAQSLAS 153
            E LK IKRRSS+N   L+ R NS  +L++
Sbjct: 157 IEGLKFIKRRSSRNIAALNVRKNSNPTLST 186

>NCAS0H02280 Chr8 (447781..449754) [1974 bp, 657 aa] {ON} Anc_5.476
          Length = 657

 Score =  167 bits (422), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 111/286 (38%), Positives = 153/286 (53%), Gaps = 65/286 (22%)

Query: 24  NTAFIHKLYSMLEDDNMKDLIWWSASQNSFLIKPNEKFSKALATFFKHTNVASFVRQLNM 83
           NT FIHKLY++LED +++DLIWWS+S  SF IKP EKFSKALAT+FKHTN+ SFVRQLN+
Sbjct: 47  NTIFIHKLYNILEDKDLEDLIWWSSSGQSFFIKPTEKFSKALATYFKHTNITSFVRQLNI 106

Query: 84  YGFHKVS-DHK-----------PSSAKGTSQDE--DEAINLWEFRHSMGCFRKGDKESLK 129
           YGFHKVS DH+            + +KG  +++  +E I +WEF+HS G F+KGD E LK
Sbjct: 107 YGFHKVSNDHQYINYPNNNNSNDNDSKGKEREDLTNETIKIWEFKHSAGIFKKGDVEGLK 166

Query: 130 SIKRRSS----------KNQVLLSRNNS-------AQSLASQYNSQQDLGPGGSSIAGHV 172
            IKRRSS          KN V +  N+S       A +     N +++  P G    G+ 
Sbjct: 167 LIKRRSSSRNISAMNQKKNLVSMQLNSSINNNVMPANTFMEANNDKKNRAPFGRPNNGN- 225

Query: 173 HPIEPADKY-------YSTTVYQP-------------PYTDAPPLHSQS-------QIQA 205
            P+   D         YS  V QP             PYT    + S +       Q+  
Sbjct: 226 EPMIQGDLGINAGHFPYSQRVQQPQAQPQKHIQYQRYPYTPYSSVDSNTYQNNRRKQLNM 285

Query: 206 YPDMRFPQEQKPHTSSVITLPHLPNSAIEDLRATNLDMMKLLDLVQ 251
            P+ ++ +E +  T    ++     S I+DLR+ N DM KL+  ++
Sbjct: 286 SPN-QYNEEDESSTHGKFSV-----SEIDDLRSINQDMAKLIGFME 325

>ZYRO0D11286g Chr4 (952637..954790) [2154 bp, 717 aa] {ON} some
           similarities with uniprot|P20134 Saccharomyces
           cerevisiae YOR140W SFL1 Transcription factor with
           domains homologous to Hsf1p and to myc oncoprotein
           required for normal cell surface assembly and
           flocculence
          Length = 717

 Score =  164 bits (415), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 94/133 (70%), Gaps = 19/133 (14%)

Query: 25  TAFIHKLYSMLEDDNMKDLIWWSASQNSFLIKPNEKFSKALATFFKHTNVASFVRQLNMY 84
           T FIHKLY++LEDD++KDLIWWS S  SFLI+P EKFS+ALAT+FKHTN+ASFVRQLNMY
Sbjct: 77  TVFIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKFSRALATYFKHTNIASFVRQLNMY 136

Query: 85  GFHKVS-DHKPSS------------------AKGTSQDEDEAINLWEFRHSMGCFRKGDK 125
           GFHKVS DH  SS                     ++ D  E I +W+FRHS G F++GD 
Sbjct: 137 GFHKVSNDHGKSSEHDSASNSRTNNSNSSDNNNNSNADVQEDIKIWKFRHSTGLFKRGDI 196

Query: 126 ESLKSIKRRSSKN 138
           E LK IKRRSS+N
Sbjct: 197 EGLKYIKRRSSRN 209

>NDAI0C01380 Chr3 complement(287185..289488) [2304 bp, 767 aa] {ON}
           Anc_5.476
          Length = 767

 Score =  152 bits (385), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 85/127 (66%), Gaps = 18/127 (14%)

Query: 24  NTAFIHKLYSMLEDDNMKDLIWWSASQNSFLIKPNEKFSKALATFFKHTNVASFVRQLNM 83
           NT FIHKLY++LED +++DLIWWS    SFLI+P E+FSKALAT+FKHTN+ SFVRQLN+
Sbjct: 77  NTIFIHKLYNILEDKDLEDLIWWSNDGKSFLIRPTERFSKALATYFKHTNITSFVRQLNI 136

Query: 84  YGFHKVSDHKPSSAKGTSQD------------------EDEAINLWEFRHSMGCFRKGDK 125
           YGFHKVS+        T  D                  ++E + +WEF+HS G FRKGD 
Sbjct: 137 YGFHKVSNDHQYINNKTEDDTTTNVTNHANTDVNNNITDNEQVKIWEFKHSAGIFRKGDV 196

Query: 126 ESLKSIK 132
           ESLK IK
Sbjct: 197 ESLKLIK 203

>CAGL0I07183g Chr9 complement(690080..692395) [2316 bp, 771 aa] {ON}
           some similarities with uniprot|P20134 Saccharomyces
           cerevisiae YOR140w SFL1
          Length = 771

 Score =  147 bits (372), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 79/169 (46%), Positives = 105/169 (62%), Gaps = 22/169 (13%)

Query: 24  NTAFIHKLYSMLEDDNMKDLIWWSASQNSFLIKPNEKFSKALATFFKHTNVASFVRQLNM 83
           NT FI+KLY +LE+ ++ DLIWW+A+  SFLI+P+E FS+ LA +FKHTN+ SFVRQLN+
Sbjct: 8   NTVFINKLYDLLENKDLDDLIWWAANGESFLIRPSESFSQNLAHYFKHTNITSFVRQLNI 67

Query: 84  YGFHKVS-DH----KPSSAKGTSQDE----------DEAINLWEFRHSMGCFRKGDKESL 128
           YGFHK+S DH    K    + +S D           DE I +WEF+HS G F+KGD E+L
Sbjct: 68  YGFHKISNDHFHNLKREKKQKSSTDNNTGVSNNNSGDENIKVWEFKHSGGLFKKGDLENL 127

Query: 129 KSIKRRSSKNQV----LLSRNNSAQSLASQYNSQQDLGPGGSSIAGHVH 173
           K IKRRSS   +    L S N +  +L +   ++ D       IA  VH
Sbjct: 128 KLIKRRSSSRTIPSLSLASSNTNTSTLETNDGAEID---NVKVIASAVH 173

>Suva_8.191 Chr8 (342114..344390) [2277 bp, 758 aa] {ON} YOR140W
           (REAL)
          Length = 758

 Score =  147 bits (370), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 102/273 (37%), Positives = 140/273 (51%), Gaps = 59/273 (21%)

Query: 23  HNTAFIHKLYSMLEDDNMKDLIWWSASQNSFLIKPNEKFSKALATFFKHTNVASFVRQLN 82
            N  FIHKLY +LEDD++ DLIWWS S  SF+IKP E+FSKALAT+FKHTN+ SFVRQLN
Sbjct: 57  QNAIFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFSKALATYFKHTNITSFVRQLN 116

Query: 83  MYGFHKVS-DHKP----SSAKGTSQDEDEAIN---------------------------- 109
           +YGFHKVS DH      S   G + D+  A +                            
Sbjct: 117 IYGFHKVSHDHTSNDTNSGDDGNTNDDANATDDNGGNKNSSGDETTGAGAQEKEKSNPTK 176

Query: 110 LWEFRHSMGCFRKGDKESLKSIKRRS---SKNQVLLSRNNSAQ------SLASQYNSQQD 160
           +WEF+HS G F+KGD ESLK IKRR+   + + +   +N+S Q      ++ ++  S QD
Sbjct: 177 IWEFKHSSGIFKKGDIESLKHIKRRASSRNNSSINSRKNSSNQNYDIESTIRARPASIQD 236

Query: 161 LGPGGSSIAGHVHPIEPADKYYSTTVYQPPYTDA--PPLHSQSQIQAYPDMRFPQEQKPH 218
                S+ + +V  I  A           PY +A   PL   +     PD +  +  KP 
Sbjct: 237 PVSASSAFSNYVPQISGASSSIPECFSHVPYENANHGPLEFNN-----PDTQ--ETSKPL 289

Query: 219 TSSVITLPHLPNSAIEDLRATNLDMMKLLDLVQ 251
           +    TL H        L+  N DM+K+++ +Q
Sbjct: 290 SFQDETLTH--------LKDINFDMIKIIESMQ 314

>Smik_15.319 Chr15 (548397..550685) [2289 bp, 762 aa] {ON} YOR140W
           (REAL)
          Length = 762

 Score =  146 bits (369), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 105/297 (35%), Positives = 151/297 (50%), Gaps = 59/297 (19%)

Query: 2   AQLEDPKERAGKVGES--QHGQH--------HNTAFIHKLYSMLEDDNMKDLIWWSASQN 51
            ++ +P      V E   +HG           N  FIHKLY +LEDD++ DLIWWS S  
Sbjct: 30  VEIANPAAEGSDVSEDVKKHGSKMLVGPRPPQNAIFIHKLYQILEDDSLHDLIWWSPSGL 89

Query: 52  SFLIKPNEKFSKALATFFKHTNVASFVRQLNMYGFHKVS-DH---------------KPS 95
           SF+IKP E+FSKALAT+FKHTN+ SFVRQLN+YGFHKVS DH                 S
Sbjct: 90  SFMIKPVERFSKALATYFKHTNITSFVRQLNIYGFHKVSHDHSSNDTNGGDEANTNDDSS 149

Query: 96  SAKGTSQDEDEAIN-----------LWEFRHSMGCFRKGDKESLKSIK---RRSSKNQVL 141
             K TS DE+  ++           +WEF+HS G F+KGD E LK IK      + + + 
Sbjct: 150 GNKNTSGDENNGVSVQEKERSNPTKIWEFKHSSGIFKKGDIEGLKHIKRRASSRNSSSIN 209

Query: 142 LSRNNSAQS------LASQYNSQQDLGPGGSSIA-GHVHPIEPADKYYSTTVYQPPYTDA 194
             +N+S Q+      + ++ +S QD  P  SS A G+  P  P+        +   +   
Sbjct: 210 SRKNSSNQNYDTDSGVRARPSSVQD--PSTSSSAFGNFVPQIPSANNTIPECFNNSHVTY 267

Query: 195 PPLHSQSQIQAYPDMRFPQEQKPHTSSVITLPHLPNSAIEDLRATNLDMMKLLDLVQ 251
             L   +     PDM+  ++ KP        P   + A++ L+  N+DM+K+++ +Q
Sbjct: 268 ENLSHGALEYNNPDMQ--EQSKP--------PSFQDEALKHLKDINVDMVKIIESMQ 314

>YOR140W Chr15 (586981..589281) [2301 bp, 766 aa] {ON}
           SFL1Transcriptional repressor and activator; involved in
           repression of flocculation-related genes, and activation
           of stress responsive genes; negatively regulated by
           cAMP-dependent protein kinase A subunit Tpk2p
          Length = 766

 Score =  143 bits (361), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 95/275 (34%), Positives = 143/275 (52%), Gaps = 61/275 (22%)

Query: 23  HNTAFIHKLYSMLEDDNMKDLIWWSASQNSFLIKPNEKFSKALATFFKHTNVASFVRQLN 82
            N  FIHKLY +LED+++ DLIWW+ S  SF+IKP E+FSKALAT+FKHTN+ SFVRQLN
Sbjct: 61  QNAIFIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERFSKALATYFKHTNITSFVRQLN 120

Query: 83  MYGFHKVS-DHKPSSA---------------------KGTSQDEDEA-----------IN 109
           +YGFHKVS DH  + A                     K +S DE+               
Sbjct: 121 IYGFHKVSHDHSSNDANSGDDANTNDDSNTHDDNSGNKNSSGDENTGGGVQEKEKSNPTK 180

Query: 110 LWEFRHSMGCFRKGDKESLKSIKRRS---SKNQVLLSRNNSAQSLASQYNSQ------QD 160
           +WEF+HS G F+KGD E LK IKRR+   + + +   +N+S Q+      ++      QD
Sbjct: 181 IWEFKHSSGIFKKGDIEGLKHIKRRASSRNNSSINSRKNSSNQNYDIDSGARVRPSSIQD 240

Query: 161 LGPGGSSIAGHVHPIEPAD----KYYSTTVYQPPYTDAPPLHSQSQIQAYPDMRFPQEQK 216
                +S    V  I  A+    +Y++ +       +  PL S +     P+M+  ++ +
Sbjct: 241 PSTSSNSFGNFVPQIPGANNSIPEYFNNSHVTYENANHAPLESNN-----PEMQ--EQNR 293

Query: 217 PHTSSVITLPHLPNSAIEDLRATNLDMMKLLDLVQ 251
           P        P+  +  ++ L+  N DM+K+++ +Q
Sbjct: 294 P--------PNFQDETLKHLKEINFDMVKIIESMQ 320

>Skud_15.303 Chr15 (541019..543265) [2247 bp, 748 aa] {ON} YOR140W
           (REAL)
          Length = 748

 Score =  142 bits (358), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 72/148 (48%), Positives = 90/148 (60%), Gaps = 35/148 (23%)

Query: 23  HNTAFIHKLYSMLEDDNMKDLIWWSASQNSFLIKPNEKFSKALATFFKHTNVASFVRQLN 82
            N  FIHKLY +LEDD++ DLIWWS+S  SF+IKP E+FSKALAT+FKHTN+ SFVRQLN
Sbjct: 43  QNAIFIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERFSKALATYFKHTNITSFVRQLN 102

Query: 83  MYGFHKVS-DHKPSS---------------------AKGTSQDEDEA------------- 107
           +YGFHKVS DH  +                      +K +S +E+               
Sbjct: 103 IYGFHKVSHDHNSNEINSGDDANTNDVNSTNDDGGGSKNSSGEENNGATVQEKEKEKSNP 162

Query: 108 INLWEFRHSMGCFRKGDKESLKSIKRRS 135
             +WEF+HS G F+KGD E LK IKRR+
Sbjct: 163 TKIWEFKHSSGIFKKGDIEGLKHIKRRA 190

>KNAG0B04040 Chr2 complement(773334..775892) [2559 bp, 852 aa] {ON}
           Anc_5.476 YOR140W
          Length = 852

 Score =  140 bits (352), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 73/170 (42%), Positives = 91/170 (53%), Gaps = 41/170 (24%)

Query: 22  HHNTAFIHKLYSMLEDDNMKDLIWWSASQNSFLIKPNEKFSKALATFFKHTNVASFVRQL 81
             NT FIHKLY +LEDD ++DLIWW+ +  SF I+PNE FSK LAT+FKHTN+ SFVRQL
Sbjct: 60  QQNTVFIHKLYHILEDDALRDLIWWAPNGMSFYIRPNETFSKTLATYFKHTNITSFVRQL 119

Query: 82  NMYGFHKVSD------------------------------HKPSSA---------KGTSQ 102
           N+YGFHKV++                              H PS+          K    
Sbjct: 120 NIYGFHKVTNWNDTAAFAAVSNDGRNNSLGALPGGPDMNTHSPSTGVVVKSEPHTKSGPG 179

Query: 103 DEDEAINLWEFRHSMGCFRKGDKESLKSIKRRSSKNQV--LLSRNNSAQS 150
                + +WEF+HS   FR+GD E LK IKRRSS   +  + SR  S  S
Sbjct: 180 ATSSPVKIWEFKHSANLFRRGDIEGLKFIKRRSSAKSISQMSSRKGSGNS 229

>TDEL0G01010 Chr7 complement(209613..210809) [1197 bp, 398 aa] {ON}
           Anc_5.77 YGR249W
          Length = 398

 Score = 99.0 bits (245), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 55/138 (39%), Positives = 84/138 (60%), Gaps = 5/138 (3%)

Query: 23  HNTAFIHKLYSMLEDDNMKDLIWWSASQNS-FLIKPNEK-FSK-ALATFFKHTNVASFVR 79
           H   FIH+LY++L++  +++ I W    +S F++KP++  FSK  L  +FKH NV+SFVR
Sbjct: 2   HPKTFIHQLYAILQESQLQEWISWFKDDDSVFVLKPHDGGFSKYVLRRYFKHGNVSSFVR 61

Query: 80  QLNMYGFHKVSDHKPSSAKGTSQDE-DEAINLWEFRHSMGCFRK-GDKESLKSIKRRSSK 137
           QL+MYGFHK+++ +    +G S ++ D A   W F H +G FRK  D  SLK I+R+S+ 
Sbjct: 62  QLHMYGFHKITNPQEGLGEGRSDEQGDRATTRWFFAHPLGYFRKDADLASLKKIQRKSTG 121

Query: 138 NQVLLSRNNSAQSLASQY 155
                 R N   ++   Y
Sbjct: 122 VGKDGRRKNVLSTVCVNY 139

>KNAG0F02020 Chr6 complement(384620..386935) [2316 bp, 771 aa] {ON}
           Anc_6.209 YGL073W
          Length = 771

 Score = 94.7 bits (234), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 72/123 (58%), Gaps = 11/123 (8%)

Query: 17  SQHGQHHNT--AFIHKLYSMLEDDNMKDLIWWSASQNSFLIKPNEKFS-KALATFFKHTN 73
           ++ G  H T  AF++KL+SML D    DLI W+    SF++   EKF    L  +FKH+N
Sbjct: 157 TRRGNSHKTRPAFVNKLWSMLNDQANLDLIRWADDGKSFIVTNREKFVHDILPKYFKHSN 216

Query: 74  VASFVRQLNMYGFHKVSDHKPSSAKGTSQDEDEAINLWEFRHSMGCFRKGDKESLKSIKR 133
            ASFVRQLNMYG+HKV D K  S + ++ D       W+F +    F+KG ++ L  I R
Sbjct: 217 FASFVRQLNMYGWHKVQDVKSGSIQNSTDDR------WQFENE--HFQKGREDLLHKIVR 268

Query: 134 RSS 136
           + S
Sbjct: 269 QKS 271

>Skud_7.208 Chr7 (371946..374456) [2511 bp, 836 aa] {ON} YGL073W
           (REAL)
          Length = 836

 Score = 93.2 bits (230), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 51/117 (43%), Positives = 73/117 (62%), Gaps = 11/117 (9%)

Query: 26  AFIHKLYSMLEDDNMKDLIWWSASQNSFLIKPNEKFS-KALATFFKHTNVASFVRQLNMY 84
           AF++KL+SML DD+   LI W+    SF++   E+F  + L  +FKH+N ASFVRQLNMY
Sbjct: 175 AFVNKLWSMLNDDSNAKLIQWAPDGKSFIVTNREEFVHEILPKYFKHSNFASFVRQLNMY 234

Query: 85  GFHKVSDHKPSSAKGTSQDEDEAINLWEFRHSMGCFRKGDKESLKSIKRR--SSKNQ 139
           G+HKV D K  S + +S D+      W+F +    F +G ++ L+ I R+  SS NQ
Sbjct: 235 GWHKVQDVKSGSIQSSSDDK------WQFENE--NFIRGREDLLEKIIRQKGSSNNQ 283

>ZYRO0G08734g Chr7 (704684..706402) [1719 bp, 572 aa] {ON} similar
           to uniprot|P10961 Saccharomyces cerevisiae YGL073W HSF1
           Trimeric heat shock transcription factor activates
           multiple genes in response to hyperthermia recognizes
           variable heat shock elements
          Length = 572

 Score = 91.7 bits (226), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 50/126 (39%), Positives = 76/126 (60%), Gaps = 11/126 (8%)

Query: 19  HGQHHNTAFIHKLYSMLEDDNMKDLIWWSASQNSFLIKPNEKFS-KALATFFKHTNVASF 77
           H + H   F++K++SML D++  +LI W+    SF++   E+F  + L  +FKH+N ASF
Sbjct: 107 HKKRH--LFVNKVWSMLNDESNGNLIRWAEDGKSFVVVNREEFVHQVLPKYFKHSNFASF 164

Query: 78  VRQLNMYGFHKVSDHKPSSAKGTSQDEDEAINLWEFRHSMGCFRKGDKESLKSIKRRSSK 137
           VRQLNMYG+HKV D K  S + +S D+      W+F +    F +G ++ L+ I R+   
Sbjct: 165 VRQLNMYGWHKVQDVKSGSIQNSSDDK------WQFENEF--FIRGREDLLQHIVRQRPA 216

Query: 138 NQVLLS 143
           NQ  LS
Sbjct: 217 NQARLS 222

>YGL073W Chr7 (368753..371254) [2502 bp, 833 aa] {ON}  HSF1Trimeric
           heat shock transcription factor, activates multiple
           genes in response to stresses that include hyperthermia;
           recognizes variable heat shock elements (HSEs)
           consisting of inverted NGAAN repeats;
           posttranslationally regulated
          Length = 833

 Score = 92.4 bits (228), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 47/110 (42%), Positives = 69/110 (62%), Gaps = 9/110 (8%)

Query: 26  AFIHKLYSMLEDDNMKDLIWWSASQNSFLIKPNEKFS-KALATFFKHTNVASFVRQLNMY 84
           AF++KL+SML DD+   LI W+    SF++   E+F  + L  +FKH+N ASFVRQLNMY
Sbjct: 174 AFVNKLWSMLNDDSNTKLIQWAEDGKSFIVTNREEFVHQILPKYFKHSNFASFVRQLNMY 233

Query: 85  GFHKVSDHKPSSAKGTSQDEDEAINLWEFRHSMGCFRKGDKESLKSIKRR 134
           G+HKV D K  S + +S D+      W+F +    F +G ++ L+ I R+
Sbjct: 234 GWHKVQDVKSGSIQSSSDDK------WQFENE--NFIRGREDLLEKIIRQ 275

>Smik_7.209 Chr7 (363136..365649) [2514 bp, 837 aa] {ON} YGL073W
           (REAL)
          Length = 837

 Score = 92.0 bits (227), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 47/110 (42%), Positives = 69/110 (62%), Gaps = 9/110 (8%)

Query: 26  AFIHKLYSMLEDDNMKDLIWWSASQNSFLIKPNEKFS-KALATFFKHTNVASFVRQLNMY 84
           AF++KL+SML DD+   LI W+    SF++   E+F  + L  +FKH+N ASFVRQLNMY
Sbjct: 175 AFVNKLWSMLNDDSNTKLIQWAKDGKSFIVTNREEFVHQILPKYFKHSNFASFVRQLNMY 234

Query: 85  GFHKVSDHKPSSAKGTSQDEDEAINLWEFRHSMGCFRKGDKESLKSIKRR 134
           G+HKV D K  S + +S D+      W+F +    F +G ++ L+ I R+
Sbjct: 235 GWHKVQDVKSGSIQSSSDDK------WQFENE--NFIRGREDLLERIIRQ 276

>Kpol_1033.46 s1033 (115581..117734) [2154 bp, 717 aa] {ON}
           (115581..117734) [2154 nt, 718 aa]
          Length = 717

 Score = 90.5 bits (223), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 73/120 (60%), Gaps = 9/120 (7%)

Query: 19  HGQHHNTAFIHKLYSMLEDDNMKDLIWWSASQNSFLIKPNEKFSKA-LATFFKHTNVASF 77
           H Q     F++K+++M+ DDN  +LI WS+   S +I   E+  +  L  +FKH+N ASF
Sbjct: 178 HNQKTRPTFVNKVWNMVNDDNNAELIRWSSDGLSIVINNREELVREILPKYFKHSNFASF 237

Query: 78  VRQLNMYGFHKVSDHKPSSAKGTSQDEDEAINLWEFRHSMGCFRKGDKESLKSIKRRSSK 137
           VRQLNMYG+HKV D +  S + + +D+      W+F +    F KG ++ L++I R+ S+
Sbjct: 238 VRQLNMYGWHKVQDIRSGSIQNSVEDK------WQFENE--NFIKGREDLLENIVRQKSQ 289

>KAFR0C02250 Chr3 (445113..446954) [1842 bp, 613 aa] {ON} Anc_6.209
           YGL073W
          Length = 613

 Score = 90.1 bits (222), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 47/112 (41%), Positives = 71/112 (63%), Gaps = 9/112 (8%)

Query: 26  AFIHKLYSMLEDDNMKDLIWWSASQNSFLIKPNEKFS-KALATFFKHTNVASFVRQLNMY 84
           AF++KL+SML D++  DLI WS    SF++   E+F  + L  +FKH+N ASFVRQLNMY
Sbjct: 151 AFVNKLWSMLNDNSNLDLIQWSNDGKSFVVTNREQFVHEILPKYFKHSNFASFVRQLNMY 210

Query: 85  GFHKVSDHKPSSAKGTSQDEDEAINLWEFRHSMGCFRKGDKESLKSIKRRSS 136
           G+HKV D K  S + +S ++      W+F +    F++  ++ L+ I R+ S
Sbjct: 211 GWHKVQDVKSGSIQNSSDEK------WQFENE--YFQRDREDLLEKIVRQKS 254

>NCAS0E03870 Chr5 (759876..761057) [1182 bp, 393 aa] {ON} Anc_5.77
          Length = 393

 Score = 88.6 bits (218), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 54/139 (38%), Positives = 81/139 (58%), Gaps = 10/139 (7%)

Query: 21  QHHNTAFIHKLYSMLEDDNMKDLIWWSA-SQNSFLIKPNE-KFS-KALATFFKHTNVASF 77
           QH N  FIH+L+S+L++  + D I WS+   N F++KP +  FS K L  +FKH N++SF
Sbjct: 2   QHRN--FIHQLHSILQEPTLDDWITWSSFDNNVFILKPYDPNFSDKVLKKYFKHGNISSF 59

Query: 78  VRQLNMYGFHKVSDHKPSSAKGTSQDEDEAINLWEFRHSMGCF-RKGDKESLKSIKRRSS 136
           VRQL+MYGFHK++    +     +   D+   +W F+H  G F R    +SLK I+R+S+
Sbjct: 60  VRQLHMYGFHKIA----TVHNNNNVVNDKVQTIWHFKHPSGNFTRDVHLDSLKKIQRKST 115

Query: 137 KNQVLLSRNNSAQSLASQY 155
                  R N   +L+  Y
Sbjct: 116 GIGKDGKRKNMLSTLSVSY 134

>ZYRO0C11506g Chr3 (891756..892760) [1005 bp, 334 aa] {ON} some
           similarities with uniprot|P53050 Saccharomyces
           cerevisiae YGR249W
          Length = 334

 Score = 87.4 bits (215), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 53/162 (32%), Positives = 84/162 (51%), Gaps = 15/162 (9%)

Query: 23  HNTAFIHKLYSMLEDDNMKDLIWWSASQNS-FLIKPNEKF--SKALATFFKHTNVASFVR 79
           H   FIH+L+++L D  + + I WS  Q+  F+++P +K+  +  L  +FKH NV+SFVR
Sbjct: 2   HTKTFIHQLHAILNDATLAEWIRWSDDQDGVFVLRPYDKWFSTLVLKRYFKHGNVSSFVR 61

Query: 80  QLNMYGFHKVSDHKPSSAKGTSQD-----------EDEAINLWEFRHSMGCF-RKGDKES 127
           QL+MYGFHK+S+    S+                 +D++  +W F H +G F R     +
Sbjct: 62  QLHMYGFHKLSNFGSESSASGGSSISQLHGPPPPAKDKSATVWFFTHPLGIFTRNASAAT 121

Query: 128 LKSIKRRSSKNQVLLSRNNSAQSLASQYNSQQDLGPGGSSIA 169
           L  I R+S+       R N   ++   Y SQ D G   S ++
Sbjct: 122 LNRIPRKSTGVGRDGKRKNVLSTVCVNYISQNDPGRATSPLS 163

>KLTH0H04290g Chr8 complement(387890..389599) [1710 bp, 569 aa] {ON}
           similar to uniprot|P10961 Saccharomyces cerevisiae
           YGL073W HSF1 Trimeric heat shock transcription factor
           activates multiple genes in response to hyperthermia
           recognizes variable heat shock elements
          Length = 569

 Score = 88.6 bits (218), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 53/138 (38%), Positives = 75/138 (54%), Gaps = 15/138 (10%)

Query: 26  AFIHKLYSMLEDDNMKDLIWWSASQNSFLIKPNEKFS-KALATFFKHTNVASFVRQLNMY 84
           AF++KL+SM+ D   + LI WSA   SF+I   E F  + L  +FKH+N ASFVRQLNMY
Sbjct: 160 AFVNKLWSMVNDSANQKLIHWSADGKSFVITNREHFVHEILPKYFKHSNFASFVRQLNMY 219

Query: 85  GFHKVSDHKPSSAKGTSQDEDEAINLWEFRHSMGCFRKGDKESLKSIKRRSSKNQVLLSR 144
           G+HKV D +  S  G S +       W+F +    F +  ++ L++I R+        S 
Sbjct: 220 GWHKVQDVRSGSIHGNSDER------WQFENE--NFVRDCEDLLENIVRQKP------ST 265

Query: 145 NNSAQSLASQYNSQQDLG 162
           N S   L  Q   + D+G
Sbjct: 266 NPSKDVLVGQNGEEMDIG 283

>Suva_7.197 Chr7 (361661..364201) [2541 bp, 846 aa] {ON} YGL073W
           (REAL)
          Length = 846

 Score = 88.6 bits (218), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 49/118 (41%), Positives = 72/118 (61%), Gaps = 11/118 (9%)

Query: 26  AFIHKLYSMLEDDNMKDLIWWSASQNSFLIKPNEKFS-KALATFFKHTNVASFVRQLNMY 84
           AF++KL+SML DD+   LI W+    SF++   E+F  + L  +FKH+N ASFVRQLNMY
Sbjct: 175 AFVNKLWSMLNDDSNTKLIQWALDGKSFIVTNREEFVHEILPKYFKHSNFASFVRQLNMY 234

Query: 85  GFHKVSDHKPSSAKGTSQDEDEAINLWEFRHSMGCFRKGDKESLKSIKRR--SSKNQV 140
           G+HKV D K  S + +S ++      W+F +    F +  ++ L+ I R+  SS NQ 
Sbjct: 235 GWHKVQDVKSGSIQSSSDEK------WQFENE--NFIRDREDLLEKIIRQKGSSNNQT 284

>TDEL0E05170 Chr5 (951579..953219) [1641 bp, 546 aa] {ON} Anc_6.209
           YGL073W
          Length = 546

 Score = 87.8 bits (216), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 71/112 (63%), Gaps = 9/112 (8%)

Query: 26  AFIHKLYSMLEDDNMKDLIWWSASQNSFLIKPNEKFS-KALATFFKHTNVASFVRQLNMY 84
           AF++K++SML D++  +LI WS    SF++   E+F  + L  +FKH+N+ASFVRQLNMY
Sbjct: 119 AFVNKVWSMLNDESNVNLIQWSKDGKSFIVVNREEFVHQILPKYFKHSNLASFVRQLNMY 178

Query: 85  GFHKVSDHKPSSAKGTSQDEDEAINLWEFRHSMGCFRKGDKESLKSIKRRSS 136
           G+HKV D K  S + +S D+ +  N +        F +G ++ L+ I R+ S
Sbjct: 179 GWHKVQDVKSGSIQNSSDDKLQFENEY--------FIRGREDLLEKIVRQKS 222

>KLLA0D03322g Chr4 complement(276591..278624) [2034 bp, 677 aa] {ON}
           similar to uniprot|P10961 Saccharomyces cerevisiae
           YGL073W HSF1 Trimeric heat shock transcription factor
           activates multiple genes in response to hyperthermia
           recognizes variable heat shock elements
          Length = 677

 Score = 88.2 bits (217), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 68/117 (58%), Gaps = 9/117 (7%)

Query: 26  AFIHKLYSMLEDDNMKDLIWWSASQNSFLIKPNEKF-SKALATFFKHTNVASFVRQLNMY 84
           AF++KL+SM+ D + +  I WS S  S ++   E+F  + L  +FKH+N ASFVRQLNMY
Sbjct: 196 AFVNKLWSMVNDKSNEKFIHWSTSGESIVVPNRERFVQEVLPKYFKHSNFASFVRQLNMY 255

Query: 85  GFHKVSDHKPSSAKGTSQDEDEAINLWEFRHSMGCFRKGDKESLKSIKRRSSKNQVL 141
           G+HKV D K  S    +         WEF +    F++G +  L++I R+ S   +L
Sbjct: 256 GWHKVQDVKSGSMLSNNDSR------WEFENE--NFKRGKEYLLENIVRQKSNTNIL 304

>Ecym_2208 Chr2 complement(410156..411745) [1590 bp, 529 aa] {ON}
           similar to Ashbya gossypii AFL085C
          Length = 529

 Score = 87.4 bits (215), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 46/110 (41%), Positives = 66/110 (60%), Gaps = 9/110 (8%)

Query: 26  AFIHKLYSMLEDDNMKDLIWWSASQNSFLIKPNEKFS-KALATFFKHTNVASFVRQLNMY 84
           AF++KL+SM+ D   + LI W+    SF++   E+F  + L  +FKH+N ASFVRQLNMY
Sbjct: 213 AFVNKLWSMVNDPTNQALIHWNDDGKSFIVTQREQFVHEILPKYFKHSNFASFVRQLNMY 272

Query: 85  GFHKVSDHKPSSAKGTSQDEDEAINLWEFRHSMGCFRKGDKESLKSIKRR 134
           G+HKV D K  S +  S D       WEF +    F +G ++ L +I R+
Sbjct: 273 GWHKVQDVKSGSIQSNSDDR------WEFSNEY--FLRGREDLLTNILRQ 314

>TBLA0A02000 Chr1 (482464..484347) [1884 bp, 627 aa] {ON} Anc_6.209
           YGL073W
          Length = 627

 Score = 87.4 bits (215), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 45/110 (40%), Positives = 69/110 (62%), Gaps = 7/110 (6%)

Query: 26  AFIHKLYSMLEDDNMKDLIWWSASQNSFLIKPNEKFSK-ALATFFKHTNVASFVRQLNMY 84
           AF++KL++ML D   +D+I WS    SFL+   EKF    L  +FKH+N ASFVRQLNMY
Sbjct: 162 AFVNKLWNMLNDPINQDMIRWSDDGKSFLVVNREKFVHHVLPNYFKHSNFASFVRQLNMY 221

Query: 85  GFHKVSDHKPSSAKGTSQDEDEAINLWEFRHSMGCFRKGDKESLKSIKRR 134
           G+HKV D +  S    + ++++    W+F +    F +G ++ L++I R+
Sbjct: 222 GWHKVQDIRSGSMNMANNNDEK----WQFENQ--NFIRGREDLLENIIRQ 265

>AFL085C Chr6 complement(279712..281421) [1710 bp, 569 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL073W
           (HSF1)
          Length = 569

 Score = 87.0 bits (214), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 66/111 (59%), Gaps = 9/111 (8%)

Query: 27  FIHKLYSMLEDDNMKDLIWWSASQNSFLIKPNEKFS-KALATFFKHTNVASFVRQLNMYG 85
           F++KL+SM+ D   + LI WS    SF++   E+F  + L  +FKH+N ASFVRQLNMYG
Sbjct: 160 FVNKLWSMVNDPVNQSLIHWSHDGKSFIVTQREQFVHEILPKYFKHSNFASFVRQLNMYG 219

Query: 86  FHKVSDHKPSSAKGTSQDEDEAINLWEFRHSMGCFRKGDKESLKSIKRRSS 136
           +HKV D K  S +  S D       WEF +    F +G ++ L +I R+ S
Sbjct: 220 WHKVQDVKSGSIQSNSDDR------WEFANE--NFLRGREDLLANIIRQKS 262

>SAKL0H02354g Chr8 complement(236815..237972) [1158 bp, 385 aa] {ON}
           some similarities with uniprot|P53050 Saccharomyces
           cerevisiae YGR249W
          Length = 385

 Score = 85.1 bits (209), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 72/118 (61%), Gaps = 10/118 (8%)

Query: 27  FIHKLYSMLEDDNMKDLIWWSA-SQNSFLIKPN--EKFSKALATFFKHTNVASFVRQLNM 83
           FIH+L+ +L+ +++   I+WS+ SQ  F +KP   E  S+ L  +FKH NV+SFVRQL+M
Sbjct: 6   FIHQLHGILQQEDLDQWIYWSSKSQTVFALKPYDPEFSSQVLKRYFKHGNVSSFVRQLHM 65

Query: 84  YGFHKV-SDHKPSS---AKGTSQDEDEAINLWEFRHSMGCF-RKGDKESLKSIKRRSS 136
           YGFHK+ S + P S   A  T+ ++D  I  W F H  G F R      L  I+R+SS
Sbjct: 66  YGFHKIASSNAPQSQIAANTTANNKDSVI--WNFTHPSGNFHRDSTTVELSKIQRKSS 121

>SAKL0A04576g Chr1 complement(422093..423766) [1674 bp, 557 aa] {ON}
           similar to uniprot|P10961 Saccharomyces cerevisiae
           YGL073W HSF1 Trimeric heat shock transcription factor
           activates multiple genes in response to hyperthermia
           recognizes variable heat shock elements
          Length = 557

 Score = 85.5 bits (210), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 67/112 (59%), Gaps = 9/112 (8%)

Query: 26  AFIHKLYSMLEDDNMKDLIWWSASQNSFLIKPNEKFS-KALATFFKHTNVASFVRQLNMY 84
           AF++KL+SM+ D + + LI WS    SF++   E+F  + L  +FKH+N ASFVRQLNMY
Sbjct: 165 AFVNKLWSMVNDTSNQKLIHWSKDGKSFIVTKREQFVHEILPKYFKHSNFASFVRQLNMY 224

Query: 85  GFHKVSDHKPSSAKGTSQDEDEAINLWEFRHSMGCFRKGDKESLKSIKRRSS 136
           G+HKV D +  S +  S +       W+F++    F +  +E L  I R+ S
Sbjct: 225 GWHKVQDVRSGSIQNNSDER------WQFQNE--HFVRDKEELLDKIVRQKS 268

>SAKL0B12408g Chr2 (1065161..1066558) [1398 bp, 465 aa] {ON} similar
           to uniprot|Q75BF2 Ashbya gossypii ADL388W ADL388Wp and
           weakly similar to YHR206W uniprot|P38889 Saccharomyces
           cerevisiae
          Length = 465

 Score = 84.3 bits (207), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 53/141 (37%), Positives = 83/141 (58%), Gaps = 13/141 (9%)

Query: 7   PKERAGKVGESQHGQHHNTAFIHKLYSMLEDDNMKDLIWWSASQNSFLIKPNEKFS-KAL 65
           P+  +G++  SQ G  ++  F+ KL+++LE     D++ W+ + +SF++     F+ K L
Sbjct: 10  PRMISGQL--SQKGGSND--FVRKLFNILEGGEYTDIVCWTETGDSFVVLNTNDFTTKIL 65

Query: 66  ATFFKHTNVASFVRQLNMYGFHKVSDHKPSSAKGTSQDEDEAINLWEFRHSMGCFRKGDK 125
              FKH+N ASFVRQLN Y FHKV   + S  K  SQ  + +   WEF H    FR  D+
Sbjct: 66  PKHFKHSNFASFVRQLNKYDFHKVK--RTSEEKQNSQYGEHS---WEFNHPY--FRIHDE 118

Query: 126 ESLKSIKRRS-SKNQVLLSRN 145
           +SL  IKR++ ++ ++LL  N
Sbjct: 119 DSLDKIKRKTATQKKILLDEN 139

>KAFR0B06990 Chr2 (1455520..1457157) [1638 bp, 545 aa] {ON}
           Anc_4.385 YJR147W
          Length = 545

 Score = 84.7 bits (208), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 64/109 (58%), Gaps = 8/109 (7%)

Query: 27  FIHKLYSMLEDDNMKDLIWWSASQNSFLIKPNEKFS-KALATFFKHTNVASFVRQLNMYG 85
           F+ KLY++LE++   D++ W+A  +SF++    KF+ K L   FKH+N ASFVRQLN Y 
Sbjct: 61  FVRKLYNILENNEYPDIVRWTARGDSFVVLDTGKFTTKILPNHFKHSNFASFVRQLNKYD 120

Query: 86  FHKVSDHKPSSAKGTSQDEDEAINLWEFRHSMGCFRKGDKESLKSIKRR 134
           FHK+   KP   +     E      WEF+H   CFR  D   L +IKR+
Sbjct: 121 FHKIKT-KPDDKEKLIYGELS----WEFQHP--CFRIHDASQLDNIKRK 162

>Skud_7.582 Chr7 (962776..964134) [1359 bp, 452 aa] {ON} YGR249W
           (REAL)
          Length = 452

 Score = 84.3 bits (207), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 71/115 (61%), Gaps = 5/115 (4%)

Query: 26  AFIHKLYSMLEDDNMKDLIWWSASQNS-FLIKPNE-KFS-KALATFFKHTNVASFVRQLN 82
            F+H+L+S+L +  +   I+WS++ N  F +KP +  FS + L  +FKH NV SFVRQL+
Sbjct: 5   TFVHQLHSILLEPEVNKWIYWSSTDNVVFFLKPYDPNFSTQVLKRYFKHGNVNSFVRQLH 64

Query: 83  MYGFHKVSDHKPSSAKGTSQDEDEAINLWEFRHSMG-CFRKGDKESLKSIKRRSS 136
           MYGFHK+S   P  A  ++ +  E +  W+F H  G  F++ +   L  I+R+S+
Sbjct: 65  MYGFHKLSHPSPEQASASNGNAKELVE-WKFTHPSGFFFKEANAGILNKIQRKST 118

>NDAI0I01110 Chr9 complement(267274..269991) [2718 bp, 905 aa] {ON}
           Anc_6.209
          Length = 905

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 46/110 (41%), Positives = 66/110 (60%), Gaps = 9/110 (8%)

Query: 26  AFIHKLYSMLEDDNMKDLIWWSASQNSFLIKPNEKFS-KALATFFKHTNVASFVRQLNMY 84
           AF++K++SM+ D   K LI WS    SF+++  E F  + L  +FKH+N ASFVRQLNMY
Sbjct: 265 AFVNKVWSMINDPVNKGLINWSDDGRSFIVQNRENFVHEVLPKYFKHSNFASFVRQLNMY 324

Query: 85  GFHKVSDHKPSSAKGTSQDEDEAINLWEFRHSMGCFRKGDKESLKSIKRR 134
           G+HKV D K +S   T+ D       W+F +    F K  ++ L +I R+
Sbjct: 325 GWHKVQDAKSNSILTTADDR------WQFENKF--FIKDREDLLINIVRQ 366

>KAFR0B04410 Chr2 (916555..917952) [1398 bp, 465 aa] {ON} Anc_5.77
           YGR249W
          Length = 465

 Score = 84.0 bits (206), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 77/132 (58%), Gaps = 21/132 (15%)

Query: 26  AFIHKLYSMLEDDNMKDLIWWSASQNS-FLIKPNE-KFS-KALATFFKHTNVASFVRQLN 82
            FIH+L+S+L++ ++ +LI WS  +N+ FL+KP++  FS + L  +FKH N++SFVRQL+
Sbjct: 5   TFIHQLHSILQEPDLHNLICWSPMENNIFLLKPHDPNFSTQVLKRYFKHGNISSFVRQLH 64

Query: 83  MYGFHKVSDHK-----------------PSSAKGTSQDEDEAINLWEFRHSMGCF-RKGD 124
           MYGFHK+  H                   +     ++D+D+A   W F H  G F R  D
Sbjct: 65  MYGFHKLPSHNHMTNSTANTTTTATTINNNDMNFENRDKDKASVEWHFTHPSGHFYRDAD 124

Query: 125 KESLKSIKRRSS 136
             +L  I+R+S+
Sbjct: 125 ASTLNKIQRKSA 136

>Kpol_1062.8 s1062 complement(17211..18512) [1302 bp, 433 aa] {ON}
           complement(17211..18512) [1302 nt, 434 aa]
          Length = 433

 Score = 83.6 bits (205), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 50/144 (34%), Positives = 78/144 (54%), Gaps = 33/144 (22%)

Query: 26  AFIHKLYSMLEDDNMKDLIWWSASQNS-FLIKP-NEKFS-KALATFFKHTNVASFVRQLN 82
            F+H+LYS+L   ++ D I+WS   +S F IKP + +FS + L ++FKH NV+SFVRQL+
Sbjct: 5   TFLHQLYSILHQPDLTDWIYWSEDDSSIFAIKPYSTQFSSQILKSYFKHGNVSSFVRQLH 64

Query: 83  MYGFHKVS--DHKPSSAKGTSQD---------------------------EDEAINLWEF 113
           MYGFHK+S  + + +   G + D                           +D ++ +W F
Sbjct: 65  MYGFHKLSHLNKQGNDKNGNNTDPQNTTNNGNNSGIDPSESDISFPPTLPQDRSLTIWYF 124

Query: 114 RHSMGCFRK-GDKESLKSIKRRSS 136
            H  G F K  D  +L+ I+R+S+
Sbjct: 125 THPSGYFHKNADILNLEKIQRKST 148

>TBLA0G02700 Chr7 (710230..711567) [1338 bp, 445 aa] {ON} 
          Length = 445

 Score = 83.6 bits (205), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 71/112 (63%), Gaps = 7/112 (6%)

Query: 26  AFIHKLYSMLEDDNMKDLIWWSASQNSFLIKPNEKFSK-ALATFFKHTNVASFVRQLNMY 84
           AF++KL++ML++   +D+I W+    SFL+   EKF    L  +FKH+N ASFVRQLNMY
Sbjct: 120 AFVNKLWNMLKEPINQDMIRWNDDGKSFLVVNREKFVHHVLPNYFKHSNFASFVRQLNMY 179

Query: 85  GFHKVSDHKPSSAKGTSQDEDEAINLWEFRHSMGCFRKGDKESLKSIKRRSS 136
           G+HKV D +  S    + ++++    W+F +    F +G ++ L++I R+ S
Sbjct: 180 GWHKVQDIRSGSMNMANTNDEK----WQFENQN--FIRGREDLLENIIRQKS 225

>Kwal_56.24036 s56 (822498..824201) [1704 bp, 567 aa] {ON} YGL073W
           (HSF1) - heat shock transcription factor [contig 166]
           FULL
          Length = 567

 Score = 83.2 bits (204), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 47/110 (42%), Positives = 68/110 (61%), Gaps = 9/110 (8%)

Query: 26  AFIHKLYSMLEDDNMKDLIWWSASQNSFLIKPNEKFS-KALATFFKHTNVASFVRQLNMY 84
           AF++KL+SM+ D   + LI WS+   SF+I   E F  + L  +FKH+N ASFVRQLNMY
Sbjct: 159 AFVNKLWSMVNDSANQKLIHWSSDGKSFIITNREHFVHEILPKYFKHSNFASFVRQLNMY 218

Query: 85  GFHKVSDHKPSSAKGTSQDEDEAINLWEFRHSMGCFRKGDKESLKSIKRR 134
           G+HKV D +  S +G S   DE +   +F +    F +  +E L++I R+
Sbjct: 219 GWHKVQDVRSGSIQGNS---DERL---QFENE--NFIRDSEELLENIVRQ 260

>KLLA0A10219g Chr1 (896931..898358) [1428 bp, 475 aa] {ON} similar
           to uniprot|Q75BF2 Ashbya gossypii ADL388W ADL388Wp and
           some similarites with YHR206W uniprot|P38889
           Saccharomyces cerevisiae
          Length = 475

 Score = 82.0 bits (201), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 67/121 (55%), Gaps = 11/121 (9%)

Query: 27  FIHKLYSMLEDDNMKDLIWWSASQNSFLIKPNEKFS-KALATFFKHTNVASFVRQLNMYG 85
           F+ KL+ +LE +    +I WS    +F++    KF+   L   FKH+N ASFVRQLN Y 
Sbjct: 43  FVRKLFLILESEEYTSIISWSPDGKNFIVLDTNKFTTDILPKHFKHSNFASFVRQLNKYD 102

Query: 86  FHKVSDHKPSSAKGTSQDEDEAINLWEFRHSMGCFRKGDKESLKSIKRR-SSKNQVLLSR 144
           FHKV   K   ++G         N WEF H    FR+ D+  L +I+R+ SS+ ++L+  
Sbjct: 103 FHKVKRKKNEVSEGIQ-------NAWEFNHQY--FRRHDEAGLDNIRRKPSSQKKILVDE 153

Query: 145 N 145
           N
Sbjct: 154 N 154

>CAGL0H03443g Chr8 (320888..323008) [2121 bp, 706 aa] {ON} weakly
           similar to uniprot|P10961 Saccharomyces cerevisiae
           YGL073w HSF1
          Length = 706

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/110 (40%), Positives = 64/110 (58%), Gaps = 9/110 (8%)

Query: 26  AFIHKLYSMLEDDNMKDLIWWSASQNSFLIKPNEKFS-KALATFFKHTNVASFVRQLNMY 84
           AF++K++SM+ D     LI WS    S ++   EKF  + L  +FKH+N ASFVRQLNMY
Sbjct: 229 AFVNKVWSMINDPVNSHLIQWSEDGLSLIVVNREKFVHEILPKYFKHSNFASFVRQLNMY 288

Query: 85  GFHKVSDHKPSSAKGTSQDEDEAINLWEFRHSMGCFRKGDKESLKSIKRR 134
           G+HKV D K  S + +S D       W+F +    F +G ++ L  I R+
Sbjct: 289 GWHKVQDVKSGSIQSSSDDR------WQFENEF--FVRGREDLLNRIVRQ 330

>KLLA0A05368g Chr1 complement(490032..491270) [1239 bp, 412 aa] {ON}
           weakly similar to uniprot|P53050 Saccharomyces
           cerevisiae YGR249W
          Length = 412

 Score = 81.3 bits (199), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 55/132 (41%), Positives = 73/132 (55%), Gaps = 23/132 (17%)

Query: 23  HNTAFIHKLYSMLEDDNMKDLIWWSASQNS-FLIKPNE-KFS-KALATFFKHTNVASFVR 79
           H+  FIH+L+ +L  D + + I WS    S F+IKPN   FS K L  FFKH NV+SFVR
Sbjct: 2   HSKTFIHQLHHILMQDELIEWIRWSEDDESMFIIKPNAPNFSSKVLKRFFKHGNVSSFVR 61

Query: 80  QLNMYGFHKV------------SDHKPSSA---KGTSQDEDEAINLWEFRHSMGCFRKGD 124
           QL+MYGFHK+            +D+  ++A     TS+ E E    W+F H    F K  
Sbjct: 62  QLHMYGFHKLPHSASSTLAASGADNNGATASTNNATSKSEIE----WKFTHHSHDFCKSA 117

Query: 125 KES-LKSIKRRS 135
            E+ LK I R+S
Sbjct: 118 SEAQLKRIHRKS 129

>NCAS0D03780 Chr4 (702461..704743) [2283 bp, 760 aa] {ON} Anc_6.209
          Length = 760

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 64/110 (58%), Gaps = 9/110 (8%)

Query: 26  AFIHKLYSMLEDDNMKDLIWWSASQNSFLIKPNEKFS-KALATFFKHTNVASFVRQLNMY 84
           AF++KL+SM+ D+    LI WS    SF++     F  + L  +FKH+N ASFVRQLNMY
Sbjct: 196 AFVNKLWSMVNDEANHPLIQWSDDGKSFVVTNRGSFVHEILPKYFKHSNFASFVRQLNMY 255

Query: 85  GFHKVSDHKPSSAKGTSQDEDEAINLWEFRHSMGCFRKGDKESLKSIKRR 134
           G+HK+ D K  S + +S D       W+F +    F +G  + L +I R+
Sbjct: 256 GWHKIQDVKSGSIQSSSDDR------WQFGNRF--FLRGRDDLLVNIIRQ 297

>YGR249W Chr7 (988049..989419) [1371 bp, 456 aa] {ON}  MGA1Protein
           similar to heat shock transcription factor; multicopy
           suppressor of pseudohyphal growth defects of ammonium
           permease mutants
          Length = 456

 Score = 80.1 bits (196), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 43/114 (37%), Positives = 69/114 (60%), Gaps = 5/114 (4%)

Query: 27  FIHKLYSMLEDDNMKDLIWWSASQNS-FLIKPNE-KFSK-ALATFFKHTNVASFVRQLNM 83
           F+H+L+++L +  +   I+WS + N+ F +KP +  FS   L  +FKH NV SFVRQL+M
Sbjct: 6   FVHQLHAILLEPEVNKWIYWSPTDNTVFFLKPYDPNFSTHVLKRYFKHGNVNSFVRQLHM 65

Query: 84  YGFHKVSDHKPSSAKGTSQDEDEAINLWEFRHSMG-CFRKGDKESLKSIKRRSS 136
           YGFHK+S   P  +   + +  E +  W+F H  G  F++ +   L  I+R+S+
Sbjct: 66  YGFHKLSHPSPDQSSANNGNVKELVE-WKFTHPSGFFFKEANAGILNKIQRKST 118

>KLTH0D17182g Chr4 complement(1424948..1426342) [1395 bp, 464 aa]
           {ON} similar to uniprot|P38889 Saccharomyces cerevisiae
           YHR206W
          Length = 464

 Score = 79.7 bits (195), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 44/123 (35%), Positives = 72/123 (58%), Gaps = 8/123 (6%)

Query: 27  FIHKLYSMLEDDNMKDLIWWSASQNSFLI-KPNEKFSKALATFFKHTNVASFVRQLNMYG 85
           F+ KL+ +LE     D+I W+   +SF++   NE  +K L   FKH+N +SFVRQLN Y 
Sbjct: 30  FVRKLFKILEGAEYNDIIRWTEDGDSFVVLNTNEFTTKILPQHFKHSNFSSFVRQLNKYD 89

Query: 86  FHKVSDHKPSSAKGTSQDEDEAINLWEFRHSMGCFRKGDKESLKSIKRRSSKNQVLLSRN 145
           FHK+   + +  K  SQ  + +   WEF+H    F+  D++ L +IKR+S+  + ++  +
Sbjct: 90  FHKIK--RTNEEKQNSQYGEHS---WEFKHPF--FKIHDEDQLDNIKRKSAVQKKIMLDD 142

Query: 146 NSA 148
           N+ 
Sbjct: 143 NTV 145

>Smik_16.58 Chr16 complement(107370..108731) [1362 bp, 453 aa] {ON}
           YGR249W (REAL)
          Length = 453

 Score = 79.7 bits (195), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 67/115 (58%), Gaps = 5/115 (4%)

Query: 26  AFIHKLYSMLEDDNMKDLIWWSASQN-SFLIKPNE-KFSK-ALATFFKHTNVASFVRQLN 82
            F+H+L+S+L +  +   I+WS + N  F +KP +  FS   L  +FKH NV SFVRQL+
Sbjct: 5   TFVHQLHSILLEPEVNKWIYWSPTDNMVFFLKPYDPNFSTHVLKRYFKHGNVNSFVRQLH 64

Query: 83  MYGFHKVSDHKPSSAKGTSQDEDEAINLWEFRHSMG-CFRKGDKESLKSIKRRSS 136
           MYGFHK+S   P      + +  E +  W+F H  G  F++ +   L  I+R+S+
Sbjct: 65  MYGFHKLSHPSPDQVSTNNGNVKELVE-WKFTHPSGFFFKEANAGVLNKIQRKST 118

>ADL388W Chr4 (30355..31803) [1449 bp, 482 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YHR206W (SKN7) and YJR147W
           (HMS2)
          Length = 482

 Score = 79.3 bits (194), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 63/113 (55%), Gaps = 14/113 (12%)

Query: 27  FIHKLYSMLEDDNMKDLIWWSASQNSFLIKPNEKFS-KALATFFKHTNVASFVRQLNMYG 85
           F+ KL+++LE     D+I W+   NSF++    +F+   L   FKH+N +SFVRQLN Y 
Sbjct: 38  FVRKLFAILESGEYTDIISWTKEGNSFVVVDTNEFTTNILPKHFKHSNFSSFVRQLNKYD 97

Query: 86  FHKVS---DHKPSSAKGTSQDEDEAINLWEFRHSMGCFRKGDKESLKSIKRRS 135
           FHKV    + + SS  G           WEF+H    FR+ D+ +L  IKR++
Sbjct: 98  FHKVKRTPEERQSSVYGEHS--------WEFQHPR--FRRNDEAALDRIKRKT 140

>TPHA0C00150 Chr3 complement(15029..16561) [1533 bp, 510 aa] {ON}
           Anc_4.385 YJR147W
          Length = 510

 Score = 79.0 bits (193), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 67/113 (59%), Gaps = 16/113 (14%)

Query: 27  FIHKLYSMLEDDNMKDLIWWSASQNSFLIKPNEKF-SKALATFFKHTNVASFVRQLNMYG 85
           F+ K+YS+LE     +++ W+ + +SF++    KF S+ L   FKH+N ASFVRQLN Y 
Sbjct: 51  FVRKIYSILEGGEYPEIVTWTEAGDSFVVVDTGKFTSQILPNHFKHSNFASFVRQLNKYD 110

Query: 86  FHKVSDHKPSSAKGTSQDEDEAINL----WEFRHSMGCFRKGDKESLKSIKRR 134
           FHKV           +Q+E +        WEF+H +  F++G +E+L +IKR+
Sbjct: 111 FHKVK---------RTQEERKVWQYGELSWEFKHPL--FKRGQEENLDNIKRK 152

>Ecym_7474 Chr7 (967242..968732) [1491 bp, 496 aa] {ON} similar to
           Ashbya gossypii ADL388W
          Length = 496

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 70/121 (57%), Gaps = 9/121 (7%)

Query: 27  FIHKLYSMLEDDNMKDLIWWSASQNSFLIKPNEKFS-KALATFFKHTNVASFVRQLNMYG 85
           F+ KL+++LE     ++I W+   NSF++    +F+   L   FKH+N +SFVRQLN Y 
Sbjct: 43  FVRKLFAILESGEYTNIISWTKDGNSFVVVDTNEFTTNILPKHFKHSNFSSFVRQLNKYD 102

Query: 86  FHKVSDHKPSSAKGTSQDEDEAINLWEFRHSMGCFRKGDKESLKSIKRRS-SKNQVLLSR 144
           FHKV    P       Q+ D   + WEF+H    FR+ D+ +L  IKR++ ++ +V L+ 
Sbjct: 103 FHKVK-RTPEE----RQNSDYGKHSWEFQHPK--FRRSDEAALDRIKRKTVTQKKVSLTE 155

Query: 145 N 145
           N
Sbjct: 156 N 156

>TBLA0A10700 Chr1 (2646036..2647799) [1764 bp, 587 aa] {ON}
           Anc_4.385 YJR147W
          Length = 587

 Score = 78.2 bits (191), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/111 (38%), Positives = 63/111 (56%), Gaps = 8/111 (7%)

Query: 27  FIHKLYSMLEDDNMKDLIWWSASQNSFLIKPNEKF-SKALATFFKHTNVASFVRQLNMYG 85
           F+  +Y +LE ++  D+I WS   +SFL+    KF S+ L   FKH+N ASFVRQLN Y 
Sbjct: 67  FVRIIYGILEREDYPDIITWSEKGDSFLVLDTGKFTSQILPNHFKHSNFASFVRQLNKYD 126

Query: 86  FHKVSDHKPSSAKGTSQDEDEAINLWEFRHSMGCFRKGDKESLKSIKRRSS 136
           FHKV   +    K    ++      WEF H +  F++   + L +IKR++S
Sbjct: 127 FHKVKRTQEEKKKWKYGEQS-----WEFCHPL--FKRNHDDGLNNIKRKTS 170

>Suva_7.544 Chr7 (943366..944775) [1410 bp, 469 aa] {ON} YGR249W
           (REAL)
          Length = 469

 Score = 77.8 bits (190), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 67/115 (58%), Gaps = 5/115 (4%)

Query: 26  AFIHKLYSMLEDDNMKDLIWWSASQN-SFLIKPNE-KFSK-ALATFFKHTNVASFVRQLN 82
            F+H+L+S+L +  +   I+WS + +  F +KP +  FS   L  +FKH NV SFVRQL+
Sbjct: 5   TFVHQLHSILLEPEVNQWIYWSPTDSMVFFLKPYDPNFSTHVLKRYFKHGNVNSFVRQLH 64

Query: 83  MYGFHKVSDHKPSSAKGTSQDEDEAINLWEFRHSMG-CFRKGDKESLKSIKRRSS 136
           MYGFHK+S   P      + +  E +  W+F H  G  F++ +   L  I+R+S+
Sbjct: 65  MYGFHKLSHPSPEQTSANNGNTKELVE-WKFTHPSGFFFKEANAGVLNKIQRKST 118

>TDEL0D00320 Chr4 complement(53243..54886) [1644 bp, 547 aa] {ON}
           Anc_4.385 YJR147W
          Length = 547

 Score = 78.2 bits (191), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 69/117 (58%), Gaps = 8/117 (6%)

Query: 27  FIHKLYSMLEDDNMKDLIWWSASQNSFLIKPNEKFS-KALATFFKHTNVASFVRQLNMYG 85
           F+ KLY +LE     D++ W+ +  SF++    KF+ + L   FKH+N ASFVRQLN Y 
Sbjct: 34  FVRKLYGILERCEYPDIVRWTETGESFVVLDTGKFTTQILPNHFKHSNFASFVRQLNKYD 93

Query: 86  FHKVSDHKPSSAKGTSQDEDEAINLWEFRHSMGCFRKGDKESLKSIKRRSSKNQVLL 142
           FHKV   K    + TSQ  + +   WEF+H    F   ++E+L +IKR+++  + +L
Sbjct: 94  FHKVK--KTPEERQTSQYGELS---WEFKHPF--FTIHNEEALDNIKRKTTVQKKIL 143

>Kwal_47.16770 s47 (103208..104593) [1386 bp, 461 aa] {ON} YHR206W
           (SKN7) - transcription factor involved in oxidative
           stress response [contig 376] FULL
          Length = 461

 Score = 77.8 bits (190), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 46/125 (36%), Positives = 71/125 (56%), Gaps = 14/125 (11%)

Query: 27  FIHKLYSMLEDDNMKDLIWWSASQNSFLI-KPNEKFSKALATFFKHTNVASFVRQLNMYG 85
           F+ KL+ +LE     D+I W+A  +SF++   NE  +K L   FKH+N +SFVRQLN Y 
Sbjct: 29  FVRKLFKILEGGEYTDIIRWTADGDSFVVLNTNEFTTKILPQHFKHSNFSSFVRQLNKYD 88

Query: 86  FHKV---SDHKPSSAKGTSQDEDEAINLWEFRHSMGCFRKGDKESLKSIKRRSSKNQVLL 142
           FHK+   S+ K +S  G           WEF H    F+  +++ L +IKR+S+  + +L
Sbjct: 89  FHKIKRTSEEKQNSEYGEHS--------WEFNHPH--FKIHNEDQLDNIKRKSAVQKKIL 138

Query: 143 SRNNS 147
             +N+
Sbjct: 139 LDDNT 143

>NDAI0B00940 Chr2 complement(218385..219965) [1581 bp, 526 aa] {ON}
           Anc_5.77 YGR249W
          Length = 526

 Score = 77.8 bits (190), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 46/116 (39%), Positives = 74/116 (63%), Gaps = 6/116 (5%)

Query: 27  FIHKLYSMLEDDNMKDLI-WWSASQNSFLIKPNE-KFS-KALATFFKHTNVASFVRQLNM 83
           F+++L+ +L+   +   I W+S  ++ FL+KP +  FS K L  +FKH N++SFVRQL+M
Sbjct: 6   FVNQLHLILQQKGLHQWIRWYSIEKSIFLLKPYDPNFSEKVLKKYFKHGNISSFVRQLHM 65

Query: 84  YGFHKVSDHK-PSSAKGTSQDEDEAIN-LWEFRHSMGCF-RKGDKESLKSIKRRSS 136
           YGFHK+S +  P+S   ++ + +  IN +W F H  G F +    E LK I+R+S+
Sbjct: 66  YGFHKISSNDLPNSILNSNPNPNNRINTIWYFAHPSGFFTQTSTNEILKKIQRKST 121

>NCAS0A06450 Chr1 (1273459..1275288) [1830 bp, 609 aa] {ON}
           Anc_4.385
          Length = 609

 Score = 78.2 bits (191), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 44/126 (34%), Positives = 71/126 (56%), Gaps = 14/126 (11%)

Query: 17  SQHGQHHNTAFIHKLYSMLEDDNMKDLIWWSASQNSFLIKPNEKFSK-ALATFFKHTNVA 75
           +Q G+     F+ KLY++LE +   D++ W+ + ++F++    KF++  L   FKH+N A
Sbjct: 46  AQTGRPPANEFVRKLYTILEKNAYPDIVRWTENGDTFVVLDTGKFTEDILPNHFKHSNFA 105

Query: 76  SFVRQLNMYGFHKVSDHKPSSAKGTSQDEDEAINLWEFRHSMGCFRKGDKESLKSIKRRS 135
           SFVRQLN Y FHK+        K    D + +   WEF+H    FR+   E L +IKR+ 
Sbjct: 106 SFVRQLNKYDFHKI--------KKKVTDVERS---WEFKHP--SFRRHFDEGLDNIKRKP 152

Query: 136 SKNQVL 141
           + ++ L
Sbjct: 153 TTSKRL 158

>NDAI0D03430 Chr4 (809977..811770) [1794 bp, 597 aa] {ON} Anc_4.385
          Length = 597

 Score = 77.4 bits (189), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 65/112 (58%), Gaps = 8/112 (7%)

Query: 24  NTAFIHKLYSMLEDDNMKDLIWWSASQNSFLIKPNEKFS-KALATFFKHTNVASFVRQLN 82
           N  F+ KLY +LE +   +L+ W+    SF++    KF+ + L T FKH+N +SFVRQLN
Sbjct: 80  NNDFVRKLYKILETNTFPNLVRWTPEGTSFVVLDTGKFTTQILPTHFKHSNFSSFVRQLN 139

Query: 83  MYGFHKVSDHKPSSAKGTSQDEDEAINLWEFRHSMGCFRKGDKESLKSIKRR 134
            Y FHKV   + S   G  +  + +   WEF H    F++ D+  L++IKR+
Sbjct: 140 KYDFHKVK--RKSDEPGRKKYGELS---WEFTHP--SFKRHDEAGLENIKRK 184

>TPHA0E02880 Chr5 complement(603237..605393) [2157 bp, 718 aa] {ON}
           Anc_6.209 YGL073W
          Length = 718

 Score = 77.4 bits (189), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 40/112 (35%), Positives = 65/112 (58%), Gaps = 9/112 (8%)

Query: 26  AFIHKLYSMLEDDNMKDLIWWSASQNSFLIKPNEKFSKA-LATFFKHTNVASFVRQLNMY 84
            F++K+++M+ D +   LI W+    SF +   E   +  L  +FKH+N ASFVRQLNMY
Sbjct: 170 TFVNKVWNMINDPSNNQLIQWADDGKSFFVTNKEDLIREILPKYFKHSNFASFVRQLNMY 229

Query: 85  GFHKVSDHKPSSAKGTSQDEDEAINLWEFRHSMGCFRKGDKESLKSIKRRSS 136
           G+HK+ D K  S + + +D+      W+F +    F +G ++ L+ I R+ S
Sbjct: 230 GWHKIQDVKSGSIQSSIEDK------WQFAND--YFIRGREDLLEHIVRQKS 273

>AEL216C Chr5 complement(228433..229785) [1353 bp, 450 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR249W
           (MGA1)
          Length = 450

 Score = 76.6 bits (187), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 45/123 (36%), Positives = 69/123 (56%), Gaps = 13/123 (10%)

Query: 27  FIHKLYSMLEDDNMKDLIWWSASQNS-FLIKPNE-KF-SKALATFFKHTNVASFVRQLNM 83
           FIH+L+ ML D +++  I WSA  +  F +KP + +F    L   FKH NV+SFVRQL++
Sbjct: 6   FIHQLHHMLSDRSLETWIRWSAEDDHIFCLKPYDPEFPGTVLKKNFKHGNVSSFVRQLHL 65

Query: 84  YGFHKVSDHKPSSAKGTSQDEDEAINL---------WEFRHSMGCFRKGDKE-SLKSIKR 133
           YGFHK+     +++ G + D +   ++         W F H  G F KG  +  L  I+R
Sbjct: 66  YGFHKLQTGPGAASSGPAGDNEPPTHIIKSNKESMVWYFTHPSGYFYKGACQPDLARIQR 125

Query: 134 RSS 136
           +S+
Sbjct: 126 KSN 128

>CAGL0F08195g Chr6 (813050..814027) [978 bp, 325 aa] {ON} some
           similarities with uniprot|P53050 Saccharomyces
           cerevisiae YGR249w MGA1
          Length = 325

 Score = 75.1 bits (183), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 47/121 (38%), Positives = 68/121 (56%), Gaps = 13/121 (10%)

Query: 26  AFIHKLYSMLEDDNMKDLIWWSASQ--NSFLIKPN--EKFSKALATFFKHTNVASFVRQL 81
            F+H+L+S+L D  +  +I W+  +    FL+KP   E     L  +FKH NV+SFVRQL
Sbjct: 5   TFVHQLHSILSDPTLTGIINWNDDEIGTVFLLKPYHPEFCDNVLKRYFKHGNVSSFVRQL 64

Query: 82  NMYGFHKVSDHKPSS-------AKGTSQDEDEAINLWEFRHSMGCF-RKGDKESLKSIKR 133
           +MYGFHKV ++  +S        K  S+ E   I +W+F H  G F R+   E+L  I R
Sbjct: 65  HMYGFHKVGNNSVNSHINNIEGNKIVSKKEPHFI-IWKFSHPSGNFHRESSYETLCKITR 123

Query: 134 R 134
           +
Sbjct: 124 K 124

>CAGL0F09097g Chr6 (898706..900598) [1893 bp, 630 aa] {ON} similar
           to uniprot|P38889 Saccharomyces cerevisiae YHR206w SKN7
           transcription factor
          Length = 630

 Score = 77.0 bits (188), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 43/121 (35%), Positives = 74/121 (61%), Gaps = 15/121 (12%)

Query: 27  FIHKLYSMLEDDNMKDLIWWSASQNSFLIKPNEKFS-KALATFFKHTNVASFVRQLNMYG 85
           F+ KL+++LE +   +++ WS + +SF++    KF+ + L   FKH+N ASFVRQLN Y 
Sbjct: 77  FVRKLFNILESNQYSNIVRWSNTGDSFVVLDTGKFTTQILPNHFKHSNFASFVRQLNKYD 136

Query: 86  FHKVSDHKPSSAKGTSQDEDEAI---NLWEFRHSMGCFRKGDKESLKSIKRRS-SKNQVL 141
           FHK+        K T+++  ++I     WEF +    F+  D++SL  IKR++ ++ +V+
Sbjct: 137 FHKI--------KRTNEERQKSIYGEQSWEFENP--NFKINDEKSLDLIKRKTPAQRKVM 186

Query: 142 L 142
           L
Sbjct: 187 L 187

>ZYRO0G00484g Chr7 complement(35793..37736) [1944 bp, 647 aa] {ON}
           similar to uniprot|P38889 Saccharomyces cerevisiae
           YHR206W
          Length = 647

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 43/117 (36%), Positives = 67/117 (57%), Gaps = 8/117 (6%)

Query: 27  FIHKLYSMLEDDNMKDLIWWSASQNSFLIKPNEKFS-KALATFFKHTNVASFVRQLNMYG 85
           F+ KL+ +LE     D++ W+    SF++    KF+ + L   FKH+N ASFVRQLN Y 
Sbjct: 44  FVRKLFGILERCEYPDIVRWTEKGESFVVLDTGKFTTQILPNHFKHSNFASFVRQLNKYD 103

Query: 86  FHKVSDHKPSSAKGTSQDEDEAINLWEFRHSMGCFRKGDKESLKSIKRRSSKNQVLL 142
           FHKV   K    +  SQ  + +   WEFRH    F   ++E+L +IKR+++  + ++
Sbjct: 104 FHKVK--KSPEERQNSQYGELS---WEFRHPY--FTIHNEEALDNIKRKTTVQKKIM 153

>TPHA0H01130 Chr8 (250116..251435) [1320 bp, 439 aa] {ON} Anc_5.77
           YGR249W
          Length = 439

 Score = 74.3 bits (181), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 73/147 (49%), Gaps = 37/147 (25%)

Query: 27  FIHKLYSMLEDDNMKDLIWWSASQNS-FLIKP-NEKFS-KALATFFKHTNVASFVRQLNM 83
           F+H+L+S+L  +N+ + I+W+   ++ F IKP   +FS K L  +FKH NV+SFVRQL+M
Sbjct: 6   FLHQLFSILAQENLNEWIYWTEDDDAVFAIKPYASQFSAKILKGYFKHGNVSSFVRQLHM 65

Query: 84  YGFHKVSDHKPSSA----------KGTSQD-----------------------EDEAINL 110
           YGFHK+S+    S             T+ D                       +D A  +
Sbjct: 66  YGFHKLSNSNNRSKCQVSFLGVDNSLTASDPKIEPESPEFGKYKEKMSRPALPQDRAKTI 125

Query: 111 WEFRHSMGCFRKGDKES-LKSIKRRSS 136
           W F H  G F K  + S L  I R+S+
Sbjct: 126 WYFTHPSGVFHKNAETSDLDKIHRKSN 152

>Kpol_265.2 s265 (9842..11491) [1650 bp, 549 aa] {ON} (9842..11491)
           [1650 nt, 550 aa]
          Length = 549

 Score = 74.7 bits (182), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 45/141 (31%), Positives = 78/141 (55%), Gaps = 24/141 (17%)

Query: 27  FIHKLYSMLEDDNMKDLIWWSASQNSFLIKPNEKF-SKALATFFKHTNVASFVRQLNMYG 85
           F+ K+Y +LE  +  D++ W+ + +SF++     F S+ L   FKH+N ASFVRQLN Y 
Sbjct: 87  FVRKIYGILERGDYPDIVRWTENGDSFVVLDTGSFTSQILPNHFKHSNFASFVRQLNKYD 146

Query: 86  FHKVSDHKPSSAKGTSQDEDEAINL----WEFRHSMGCFRKGDKESLKSIKRRSSKNQ-- 139
           FHKV           +Q+E +A       WEF H +  F++  + +L +IKR+++  +  
Sbjct: 147 FHKVK---------RTQEERKACQYGELSWEFNHPL--FKRNQEANLDNIKRKAATQKKV 195

Query: 140 ------VLLSRNNSAQSLASQ 154
                 +LL++ +  Q+L ++
Sbjct: 196 LVDEKSLLLNKADGTQALENE 216

>Smik_8.296 Chr8 (487452..489329) [1878 bp, 625 aa] {ON} YHR206W
           (REAL)
          Length = 625

 Score = 73.9 bits (180), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 85/167 (50%), Gaps = 15/167 (8%)

Query: 27  FIHKLYSMLEDDNMKDLIWWSASQNSFLIKPNEKFSK-ALATFFKHTNVASFVRQLNMYG 85
           F+ KL+ +LE++   D++ W+ +  SF++    KF+   L   FKH+N ASFVRQLN Y 
Sbjct: 88  FVRKLFRILENNEYPDIVTWTENGKSFVVLDTGKFTTHILPNHFKHSNFASFVRQLNKYD 147

Query: 86  FHKVSDHKPSSAKGTSQDEDEAINLWEFRHSMGCFRKGDKESLKSIKRRS-SKNQVLLSR 144
           FHKV    P   +     E      WEF+H    FR    + L +IKR+  ++ +VLL  
Sbjct: 148 FHKVK-RSPEERQKCKYGEQS----WEFQHPE--FRVHYGKGLDNIKRKIPAQRKVLL-- 198

Query: 145 NNSAQSLASQYNSQQDLGPGGSSIAGHVHPIEPADKYYSTTVYQPPY 191
            + +Q     +NS+   G   ++++G +      +   S TV +  +
Sbjct: 199 -DESQKALLHFNSE---GANPNNLSGSLLNESTTELLLSNTVSKDAF 241

>YHR206W Chr8 (512732..514600) [1869 bp, 622 aa] {ON}  SKN7Nuclear
           response regulator and transcription factor; physically
           interacts with the Tup1-Cyc8 complex and recruits Tup1p
           to its targets; part of a branched two-component
           signaling system; required for optimal induction of
           heat-shock genes in response to oxidative stress;
           involved in osmoregulation
          Length = 622

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 67/124 (54%), Gaps = 9/124 (7%)

Query: 27  FIHKLYSMLEDDNMKDLIWWSASQNSFLIKPNEKFSK-ALATFFKHTNVASFVRQLNMYG 85
           F+ KL+ +LE++   D++ W+ +  SF++    KF+   L   FKH+N ASFVRQLN Y 
Sbjct: 87  FVRKLFRILENNEYPDIVTWTENGKSFVVLDTGKFTTHILPNHFKHSNFASFVRQLNKYD 146

Query: 86  FHKVSDHKPSSAKGTSQDEDEAINLWEFRHSMGCFRKGDKESLKSIKRRS-SKNQVLLSR 144
           FHKV    P   +     E      WEF+H    FR    + L +IKR+  ++ +VLL  
Sbjct: 147 FHKVK-RSPEERQRCKYGEQS----WEFQHPE--FRVHYGKGLDNIKRKIPAQRKVLLDE 199

Query: 145 NNSA 148
           +  A
Sbjct: 200 SQKA 203

>Suva_15.412 Chr15 (719438..721291) [1854 bp, 617 aa] {ON} YHR206W
           (REAL)
          Length = 617

 Score = 72.8 bits (177), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 67/124 (54%), Gaps = 9/124 (7%)

Query: 27  FIHKLYSMLEDDNMKDLIWWSASQNSFLIKPNEKFSK-ALATFFKHTNVASFVRQLNMYG 85
           F+ KL+ +LE++   D++ W+ +  SF++    KF+   L   FKH+N ASFVRQLN Y 
Sbjct: 87  FVRKLFRILENNEYPDIVTWTENGKSFVVLDTGKFTTHILPNHFKHSNFASFVRQLNKYD 146

Query: 86  FHKVSDHKPSSAKGTSQDEDEAINLWEFRHSMGCFRKGDKESLKSIKRRS-SKNQVLLSR 144
           FHKV    P   +     E      WEF+H    FR    + L +IKR+  ++ +VLL  
Sbjct: 147 FHKVK-RSPEERQKCKYGEQS----WEFQHPE--FRVHYGKGLDNIKRKIPAQRKVLLDE 199

Query: 145 NNSA 148
           +  A
Sbjct: 200 SQKA 203

>Skud_8.273 Chr8 (481627..483498) [1872 bp, 623 aa] {ON} YHR206W
           (REAL)
          Length = 623

 Score = 72.8 bits (177), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 67/124 (54%), Gaps = 9/124 (7%)

Query: 27  FIHKLYSMLEDDNMKDLIWWSASQNSFLIKPNEKFSK-ALATFFKHTNVASFVRQLNMYG 85
           F+ KL+ +LE++   D++ W+ +  SF++    KF+   L   FKH+N ASFVRQLN Y 
Sbjct: 87  FVRKLFRILENNEYPDIVTWTENGKSFVVLDTGKFTTHILPNHFKHSNFASFVRQLNKYD 146

Query: 86  FHKVSDHKPSSAKGTSQDEDEAINLWEFRHSMGCFRKGDKESLKSIKRRS-SKNQVLLSR 144
           FHKV    P   +     E      WEF+H    FR    + L +IKR+  ++ +VLL  
Sbjct: 147 FHKVK-RSPEERQRCKYGEQS----WEFQHPE--FRVHYGKGLDNIKRKIPAQRKVLLDE 199

Query: 145 NNSA 148
           +  A
Sbjct: 200 SQKA 203

>Kpol_1050.79 s1050 (171402..172703) [1302 bp, 433 aa] {ON}
           (171402..172703) [1302 nt, 434 aa]
          Length = 433

 Score = 71.2 bits (173), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 48/142 (33%), Positives = 69/142 (48%), Gaps = 31/142 (21%)

Query: 26  AFIHKLYSMLEDDNMKDLIWWSASQNS-FLIKP-NEKF-SKALATFFKHTNVASFVRQLN 82
            F+H+L+SML   + K+ I W   ++S F+I P N++F  K L  +FKH N +SFVRQL+
Sbjct: 3   TFVHQLFSMLNQPDYKEWIHWLNDEDSIFVITPYNQEFGDKVLKKYFKHGNFSSFVRQLH 62

Query: 83  MYGFHKV-------SDHKPSSAKGTSQDEDEAINL--------------------WEFRH 115
           MYGF K+       S+   S  +G   + +  I                      W F H
Sbjct: 63  MYGFQKLPIKNNDDSNGNVSITRGNELNNNVDIEFFNNDNPMYHIPSRPKRGSTTWHFTH 122

Query: 116 SMGCF-RKGDKESLKSIKRRSS 136
             G F R  D  +L  I+R+SS
Sbjct: 123 PSGFFHRNSDVVTLNRIQRKSS 144

>KNAG0M00180 Chr13 complement(22500..24347) [1848 bp, 615 aa] {ON}
           Anc_4.385 YJR147W
          Length = 615

 Score = 70.9 bits (172), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 40/112 (35%), Positives = 62/112 (55%), Gaps = 14/112 (12%)

Query: 27  FIHKLYSMLEDDNMKDLIWWSASQNSFLIKPNEKFS-KALATFFKHTNVASFVRQLNMYG 85
           F+ KL+ +LE +   +++ W+   +SF++    KF+ + L   FKH+N ASFVRQLN Y 
Sbjct: 78  FVRKLFKILESNIYSNIVRWTEEGDSFVVLDTGKFTTQILPNHFKHSNFASFVRQLNKYD 137

Query: 86  FHKVS---DHKPSSAKGTSQDEDEAINLWEFRHSMGCFRKGDKESLKSIKRR 134
           FHKV    D K     G           WEF+H    F+  ++++L +IKR+
Sbjct: 138 FHKVKRKMDDKQKPKFGELS--------WEFKHP--AFQIHNEKALDNIKRK 179

>TPHA0A05250 Chr1 (1183602..1185407) [1806 bp, 601 aa] {ON} Anc_5.77
           YGR249W
          Length = 601

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 57/167 (34%), Positives = 76/167 (45%), Gaps = 49/167 (29%)

Query: 26  AFIHKLYSMLEDDNMKDLIWWS-ASQNSFLIKP-NEKFS-KALATFFKHTNVASFVRQLN 82
            FIH+LYS+L+  ++++ I W   +   F IKP +  FS K L  +FKH N  SFVRQL 
Sbjct: 3   VFIHQLYSILDQSDLREWIHWIPDADGVFAIKPFHHNFSQKVLQKYFKHKNFTSFVRQLY 62

Query: 83  MYGFHKVS------DHKPS-----------------------------SAKGTSQDE--- 104
           MYGFHK+S      D K S                              +KG S++    
Sbjct: 63  MYGFHKLSPNKNVIDSKASLTSNTGKTSQTNSTSAKDSNSRKSNSLSDKSKGNSENAKNG 122

Query: 105 DEAINLWEFRHSMGCFRKG-DKESLKSIKR------RSSKNQVLLSR 144
            E I  W F H  G F KG D  +L  I+R      R  K + +L+R
Sbjct: 123 KEDIE-WYFTHPSGLFHKGSDVVTLNKIQRKGIGFGRDGKRKNILTR 168

>KNAG0K00470 Chr11 complement(79664..80908) [1245 bp, 414 aa] {ON}
           Anc_5.77 YGR249W
          Length = 414

 Score = 67.4 bits (163), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 75/151 (49%), Gaps = 41/151 (27%)

Query: 27  FIHKLYSMLEDDNMKDLIWWSASQN-SFLIKP-NEKFSK-ALATFFKHTNVASFVRQLNM 83
           F+HKL+S+L++  + +LI WS   + +F +KP +  F+   L  +FKH NV+SFVRQL+M
Sbjct: 6   FVHKLHSILQEPGISNLIAWSDKYDGAFCLKPYDADFANLVLKRYFKHGNVSSFVRQLHM 65

Query: 84  YGFHKV--------------------------------SDHKPSSAKGTSQDEDE----- 106
           YGFHK+                                ++++ SS +  +Q+ D+     
Sbjct: 66  YGFHKIPVLDVKNTISPLPSSDSINNTSTNSTGPEFTGNNNENSSLESMAQETDQRRTDK 125

Query: 107 AINLWEFRHSMGCFRKGDK-ESLKSIKRRSS 136
           A  +W F H  G F K  K  +L    R++S
Sbjct: 126 ASTIWYFSHPSGNFYKDAKYGTLSKTHRKNS 156

>Ecym_5573 Chr5 (1172938..1174656) [1719 bp, 572 aa] {ON} similar
          to Ashbya gossypii AEL216C
          Length = 572

 Score = 67.8 bits (164), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 34/66 (51%), Positives = 46/66 (69%), Gaps = 3/66 (4%)

Query: 27 FIHKLYSMLEDDNMKDLIWWSASQNS-FLIKPNE-KF-SKALATFFKHTNVASFVRQLNM 83
          FIH+L+ ML D +++  I WSA  +  F +KP + +F  K L   FKH NV+SFVRQL+M
Sbjct: 6  FIHQLHHMLNDKSLESWIRWSAEDDHIFCLKPYDPEFPGKVLKKNFKHGNVSSFVRQLHM 65

Query: 84 YGFHKV 89
          YGFHK+
Sbjct: 66 YGFHKL 71

>TBLA0E04980 Chr5 (1275927..1278302) [2376 bp, 791 aa] {ON}
           Anc_4.385 YJR147W
          Length = 791

 Score = 65.5 bits (158), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 62/115 (53%), Gaps = 14/115 (12%)

Query: 27  FIHKLYSMLEDDNMKDLIWWSASQNSFLIKPNEKF-SKALATFFKHTNVASFVRQLNMYG 85
           F+  L+++LED+  +++I W+   + F++     F S  L   F H+N ASFVRQLN +G
Sbjct: 35  FVKTLFNILEDEKYQNIIKWTEKGDRFVVIDAGLFTSDILPIHFNHSNFASFVRQLNKFG 94

Query: 86  FHKVSDHKPSSAKGTSQDEDEAI---NLWEFRHSMGCFRKGDKESLKSIKRRSSK 137
           FHK+        K T ++    I     WEF H    F+K D+  ++ I ++ S+
Sbjct: 95  FHKI--------KKTQEERLMCIYGEQSWEFIHP--NFKKNDRILMEKISKKISR 139

>KLTH0H00814g Chr8 complement(90962..92134) [1173 bp, 390 aa] {ON}
           some similarities with uniprot|P53050 Saccharomyces
           cerevisiae YGR249W MGA1 Protein similar to heat shock
           transcription factor; multicopy suppressor of
           pseudohyphal growth defects of ammonium permease mutants
          Length = 390

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 46/173 (26%), Positives = 75/173 (43%), Gaps = 40/173 (23%)

Query: 23  HNTAFIHKLYSMLEDDNMKDLIWWSASQ---NSFLIKPNEK-FS-KALATFFKHTNVASF 77
            N  FIH+L+++L+   ++  I W   +     F ++P++  FS   L  +FKH NV+SF
Sbjct: 2   QNKTFIHQLHAILQQPELERWIRWEPDEQLRGVFSLRPHDAAFSTNVLKRYFKHGNVSSF 61

Query: 78  VRQLNMYGFHKVS-------------DHKPSSAKGTS---------------------QD 103
           VRQL+MYGFHK++                P+++ G+S                       
Sbjct: 62  VRQLHMYGFHKLAAPTAPTSTEPASPATSPAASAGSSVAGGGTSSADGSAGAAATTAGTK 121

Query: 104 EDEAINLWEFRHSMGCF-RKGDKESLKSIKRRSSKNQVLLSRNNSAQSLASQY 155
             ++  +W+F H  G F R      L  I+R+S        R N   ++   Y
Sbjct: 122 SGKSAVVWQFSHPSGAFCRDSTMSELGRIQRKSGGVGKNGKRKNVLSAVCVNY 174

>Skud_10.373 Chr10 (662167..663207) [1041 bp, 346 aa] {ON} YJR147W
           (REAL)
          Length = 346

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 45/85 (52%), Gaps = 2/85 (2%)

Query: 26  AFIHKLYSMLEDDNMKDLIWWSASQNSFLIKPNEKFSKA-LATFFKHTNVASFVRQLNMY 84
            F+ KL+ +L+ +    +I WS+  + F+I   E+F+K  L  FF  ++  +FV+QL+ Y
Sbjct: 6   VFVSKLFHLLQSNAYSSIIQWSSDGSRFIIWDPEQFTKVILERFFSLSSYTAFVKQLSKY 65

Query: 85  GFHKVSD-HKPSSAKGTSQDEDEAI 108
            F K    H         Q E++AI
Sbjct: 66  SFQKTKRPHCEEFFNVHFQRENKAI 90

>KLLA0E03191g Chr5 (296592..298904) [2313 bp, 770 aa] {ON} some
           similarities with uniprot|P20134 Saccharomyces
           cerevisiae YOR140W SFL1 Transcription factor with
           domains homologous to Hsf1p and to myc oncoprotein
           required for normal cell surface assembly and
           flocculence
          Length = 770

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/37 (56%), Positives = 27/37 (72%), Gaps = 2/37 (5%)

Query: 225 LPHLPNSAIEDLRATNLDMMKLLDLVQKAM--HISSP 259
           L H    A+E+LRATN+DM+K+LD+VQK M   I SP
Sbjct: 328 LQHSYEMAVEELRATNIDMIKMLDIVQKTMVERIGSP 364

 Score = 31.6 bits (70), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 10/13 (76%), Positives = 13/13 (100%)

Query: 578 ITYKPYFPYGTIP 590
           I+YKPY+PYGT+P
Sbjct: 604 ISYKPYYPYGTVP 616

>YJR147W Chr10 (704196..705272) [1077 bp, 358 aa] {ON}
          HMS2Protein with similarity to heat shock transcription
          factors; overexpression suppresses the pseudohyphal
          filamentation defect of a diploid mep1 mep2 homozygous
          null mutant
          Length = 358

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 36/64 (56%), Gaps = 1/64 (1%)

Query: 26 AFIHKLYSMLEDDNMKDLIWWSASQNSFLIKPNEKFSKA-LATFFKHTNVASFVRQLNMY 84
           F+ KLY +L+ +   ++I WS   +  +I   ++F+K  L  FF     A+FV+QL+ Y
Sbjct: 12 VFVSKLYHLLQGNAYSNIIQWSTDGSKLVIWNPDQFTKVILERFFGIHTFAAFVKQLSKY 71

Query: 85 GFHK 88
           F K
Sbjct: 72 NFQK 75

>Smik_10.442 Chr10 (693234..694277) [1044 bp, 347 aa] {ON} YJR147W
          (REAL)
          Length = 347

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 37/64 (57%), Gaps = 1/64 (1%)

Query: 26 AFIHKLYSMLEDDNMKDLIWWSASQNSFLIKPNEKFSKA-LATFFKHTNVASFVRQLNMY 84
          AF+  L+ +L+ +    +I WSA  + F+I   ++F+K  L  FF   + A+F +QL+ Y
Sbjct: 6  AFLSILFEILQGNAYSSIIQWSADGSKFIIWNPDQFTKVILERFFSIASFAAFAKQLSKY 65

Query: 85 GFHK 88
           F K
Sbjct: 66 KFQK 69

>Suva_12.241 Chr12 (384063..385112) [1050 bp, 349 aa] {ON} YJR147W
          (REAL)
          Length = 349

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 37/66 (56%), Gaps = 2/66 (3%)

Query: 26 AFIHKLYSMLEDDNMKDLIWWSASQNSFLIKPNEKFSKA-LATFFKHT-NVASFVRQLNM 83
           F+ KL+ +L+ +   ++I W      F+I   ++F+K  L  FF    + ASFVRQL+ 
Sbjct: 6  VFVSKLFQLLQSNAYSEIIQWLPDGTRFVIWNTDQFAKVILKRFFPSLPSFASFVRQLSK 65

Query: 84 YGFHKV 89
          Y F K+
Sbjct: 66 YEFQKM 71

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.126    0.373 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 70,724,065
Number of extensions: 3010151
Number of successful extensions: 9740
Number of sequences better than 10.0: 140
Number of HSP's gapped: 9967
Number of HSP's successfully gapped: 152
Length of query: 695
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 578
Effective length of database: 40,065,477
Effective search space: 23157845706
Effective search space used: 23157845706
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 69 (31.2 bits)