Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AER404C5.437ON38638619850.0
SAKL0G02596g5.437ON4003626202e-76
KLTH0F15994g5.437ON3902885112e-60
Kwal_55.214155.437ON3893575034e-59
KAFR0E038205.437ON3962874652e-53
TDEL0B021805.437ON4184014574e-52
ZYRO0F10098g5.437ON3733564483e-51
NCAS0F034005.437ON4153154489e-51
YDR370C5.437ON4423454307e-48
Smik_4.6365.437ON4463774238e-47
NDAI0B056905.437ON4233044201e-46
KLLA0E02245g5.437ON4033074145e-46
Skud_4.6395.437ON4423644132e-45
Suva_2.5425.437ON4423483922e-42
CAGL0A02860g5.437ON4022993683e-39
Kpol_1016.45.437ON4132983456e-36
KNAG0C048905.437ON4052733211e-32
TBLA0A028005.437ON4533203011e-29
TPHA0J026005.437ON4413002922e-28
TPHA0G036503.570ON377240980.001
Ecym_26003.570ON384223920.007
CAGL0C01925g3.570ON40061810.18
NCAS0E002403.570ON38040780.36
CAGL0D00990g4.233ON308216770.41
KLLA0E12893g3.570ON384243770.43
ZYRO0E09592g3.570ON380219770.47
Kpol_380.83.570ON37984760.69
NDAI0I032603.570ON377188721.9
AFR262CsingletonON775234722.2
AFR263C3.570ON376240703.2
TDEL0D063803.570ON37861703.6
Skud_7.213.570ON38961695.0
Suva_7.153.570ON38961685.6
YGL246C (RAI1)3.570ON38740677.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AER404C
         (386 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AER404C Chr5 complement(1412412..1413572) [1161 bp, 386 aa] {ON}...   769   0.0  
SAKL0G02596g Chr7 complement(214675..215877) [1203 bp, 400 aa] {...   243   2e-76
KLTH0F15994g Chr6 (1298649..1299821) [1173 bp, 390 aa] {ON} weak...   201   2e-60
Kwal_55.21415 s55 (826461..827630) [1170 bp, 389 aa] {ON} YDR370...   198   4e-59
KAFR0E03820 Chr5 (758469..759659) [1191 bp, 396 aa] {ON} Anc_5.4...   183   2e-53
TDEL0B02180 Chr2 (388145..389401) [1257 bp, 418 aa] {ON} Anc_5.4...   180   4e-52
ZYRO0F10098g Chr6 complement(818672..819793) [1122 bp, 373 aa] {...   177   3e-51
NCAS0F03400 Chr6 complement(686480..687727) [1248 bp, 415 aa] {O...   177   9e-51
YDR370C Chr4 complement(1217782..1219110) [1329 bp, 442 aa] {ON}...   170   7e-48
Smik_4.636 Chr4 complement(1137846..1139186) [1341 bp, 446 aa] {...   167   8e-47
NDAI0B05690 Chr2 (1387153..1388424) [1272 bp, 423 aa] {ON} Anc_5...   166   1e-46
KLLA0E02245g Chr5 complement(210001..211212) [1212 bp, 403 aa] {...   164   5e-46
Skud_4.639 Chr4 complement(1140646..1141974) [1329 bp, 442 aa] {...   163   2e-45
Suva_2.542 Chr2 complement(968396..969724) [1329 bp, 442 aa] {ON...   155   2e-42
CAGL0A02860g Chr1 complement(300736..301944) [1209 bp, 402 aa] {...   146   3e-39
Kpol_1016.4 s1016 (8493..9362,9366..9737) [1242 bp, 413 aa] {ON}...   137   6e-36
KNAG0C04890 Chr3 (945616..946833) [1218 bp, 405 aa] {ON} Anc_5.4...   128   1e-32
TBLA0A02800 Chr1 (675150..676511) [1362 bp, 453 aa] {ON} Anc_5.4...   120   1e-29
TPHA0J02600 Chr10 complement(577310..578635) [1326 bp, 441 aa] {...   117   2e-28
TPHA0G03650 Chr7 (776977..778110) [1134 bp, 377 aa] {ON} Anc_3.5...    42   0.001
Ecym_2600 Chr2 (1167583..1168737) [1155 bp, 384 aa] {ON} similar...    40   0.007
CAGL0C01925g Chr3 complement(202920..204122) [1203 bp, 400 aa] {...    36   0.18 
NCAS0E00240 Chr5 complement(34922..36064) [1143 bp, 380 aa] {ON}...    35   0.36 
CAGL0D00990g Chr4 (117147..118073) [927 bp, 308 aa] {ON} similar...    34   0.41 
KLLA0E12893g Chr5 complement(1140409..1141563) [1155 bp, 384 aa]...    34   0.43 
ZYRO0E09592g Chr5 (764748..765890) [1143 bp, 380 aa] {ON} simila...    34   0.47 
Kpol_380.8 s380 (14034..15173) [1140 bp, 379 aa] {ON} (14034..15...    34   0.69 
NDAI0I03260 Chr9 (765221..766354) [1134 bp, 377 aa] {ON} Anc_3.570     32   1.9  
AFR262C Chr6 complement(904657..906984) [2328 bp, 775 aa] {ON} S...    32   2.2  
AFR263C Chr6 complement(907124..908254) [1131 bp, 376 aa] {ON} S...    32   3.2  
TDEL0D06380 Chr4 (1146443..1147579) [1137 bp, 378 aa] {ON} Anc_3...    32   3.6  
Skud_7.21 Chr7 complement(41773..42942) [1170 bp, 389 aa] {ON} Y...    31   5.0  
Suva_7.15 Chr7 complement(32131..33300) [1170 bp, 389 aa] {ON} Y...    31   5.6  
YGL246C Chr7 complement(37617..38780) [1164 bp, 387 aa] {ON}  RA...    30   7.2  

>AER404C Chr5 complement(1412412..1413572) [1161 bp, 386 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR370C
          Length = 386

 Score =  769 bits (1985), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/386 (96%), Positives = 373/386 (96%)

Query: 1   MADDISTLAGKMRHLTLEKDLIVNVNMKKFPHGPITRRGKERSIRIFSESREVGTAFRQG 60
           MADDISTLAGKMRHLTLEKDLIVNVNMKKFPHGPITRRGKERSIRIFSESREVGTAFRQG
Sbjct: 1   MADDISTLAGKMRHLTLEKDLIVNVNMKKFPHGPITRRGKERSIRIFSESREVGTAFRQG 60

Query: 61  LVYXXXXXXXXXXXXXEICEYISHRSKSKLIGYVGSDLSVESETFHPVTSEELHCLHGLL 120
           LVY             EICEYISHRSKSKLIGYVGSDLSVESETFHPVTSEELHCLHGLL
Sbjct: 61  LVYDLDDKKNLPLLNDEICEYISHRSKSKLIGYVGSDLSVESETFHPVTSEELHCLHGLL 120

Query: 121 KFIAKWEADNEVNYASRSKFTIVSPRHHILDILMIPFGNERCRLVFTAHRGLFVITLAPS 180
           KFIAKWEADNEVNYASRSKFTIVSPRHHILDILMIPFGNERCRLVFTAHRGLFVITLAPS
Sbjct: 121 KFIAKWEADNEVNYASRSKFTIVSPRHHILDILMIPFGNERCRLVFTAHRGLFVITLAPS 180

Query: 181 QRPTGINSPSSATRKICYTGFELERLLTATSGTERGSFYSFIEAKLEPDITILLQCEMDA 240
           QRPTGINSPSSATRKICYTGFELERLLTATSGTERGSFYSFIEAKLEPDITILLQCEMDA
Sbjct: 181 QRPTGINSPSSATRKICYTGFELERLLTATSGTERGSFYSFIEAKLEPDITILLQCEMDA 240

Query: 241 YNPKRQKYTEIKSSVDFNVRNVRHLSKLLKIWAQTALLPSTDILVGFRDPSTHVLKTVVP 300
           YNPKRQKYTEIKSSVDFNVRNVRHLSKLLKIWAQTALLPSTDILVGFRDPSTHVLKTVVP
Sbjct: 241 YNPKRQKYTEIKSSVDFNVRNVRHLSKLLKIWAQTALLPSTDILVGFRDPSTHVLKTVVP 300

Query: 301 YSVDQIAEKLYIRDRTRSHPSYFNFNPEVAKDWTHYAIREICERLSSLVDATSSSPQSFL 360
           YSVDQIAEKLYIRDRTRSHPSYFNFNPEVAKDWTHYAIREICERLSSLVDATSSSPQSFL
Sbjct: 301 YSVDQIAEKLYIRDRTRSHPSYFNFNPEVAKDWTHYAIREICERLSSLVDATSSSPQSFL 360

Query: 361 VEIDKNLQMKIRPTVVDYSELLGQWA 386
           VEIDKNLQMKIRPTVVDYSELLGQWA
Sbjct: 361 VEIDKNLQMKIRPTVVDYSELLGQWA 386

>SAKL0G02596g Chr7 complement(214675..215877) [1203 bp, 400 aa] {ON}
           weakly similar to uniprot|Q06349 Saccharomyces
           cerevisiae YDR370C Hypothetical ORF
          Length = 400

 Score =  243 bits (620), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 143/362 (39%), Positives = 202/362 (55%), Gaps = 26/362 (7%)

Query: 22  IVNVNMKKFPHGPITRRGKERSIRIFSESREVGTAFRQ--GLVYXXXXXXXXXXXXXEIC 79
            V+ N+  FP  P          + F ESRE+GT  R      Y             +IC
Sbjct: 30  FVHSNVSHFPSVPC---------KFFQESREIGTFTRMVSSGKYLFDDKLGLRPLKDDIC 80

Query: 80  EYISHRSK--SKL-IGYVGSDLSVESETFHPVTSEELHCLHGLLKFIAKWEADNEVNYAS 136
           EYI + +K  SK+   Y+G DL    E + P++ +EL+ + G+L FI  WE  N   Y S
Sbjct: 81  EYIHNPAKNASKIKTQYLGYDLLNGFEDYIPLSEDELNNMDGILNFIGNWEEKNGKKYGS 140

Query: 137 RSKFTIVSPRHHILDILMIPFGNERCRLVFTAHRGLFVITLAPSQRP--TGINSPSSATR 194
            +KFTIVS RHH++D++M PF  E   L+ T   GL +I+   S+    +GI S  +  R
Sbjct: 141 ENKFTIVSNRHHLIDLIMCPFSLEEANLIVTHLDGLLIISSDKSKPKVDSGIRSKDTRVR 200

Query: 195 KICYTGFELERLLTATSGTERG---SFYSFIEAKLEPDITILLQCEMDAYNPKRQKYTEI 251
           K+CYTGFELE L+T       G    FYS +E KL   +++LLQ EMD+YNPK   Y E+
Sbjct: 201 KLCYTGFELENLVTKGKVDSPGMHTCFYSIVENKLTEGVSLLLQAEMDSYNPKTDNYVEL 260

Query: 252 KSSVDFNVRNVRHLSKLLKIWAQTALLPSTDILVGFRDPSTHVLKTVVPYSVDQIAEKLY 311
           K SV+F ++N  H  KLL++W QT L+P TD+LVGFRDP  + L  + PY+ D+I +K  
Sbjct: 261 KCSVNFQLKNSNHRRKLLRMWIQTGLVPRTDLLVGFRDPYYNQLDALKPYTRDEIYKKFS 320

Query: 312 IRDRTRSHPSYFNFNPEVAKDWTHYAIREICERLSSLVDA--TSSSPQSFLVEIDKNLQM 369
            R+   +   Y+NFN  VA  W+H+ I +I E    LVD   T    QSF + + ++LQ+
Sbjct: 321 TRNLNENR-KYYNFNSTVAVQWSHHVIAKITE----LVDKNLTDEPLQSFKLTLTRDLQL 375

Query: 370 KI 371
            +
Sbjct: 376 SL 377

>KLTH0F15994g Chr6 (1298649..1299821) [1173 bp, 390 aa] {ON} weakly
           similar to uniprot|Q06349 Saccharomyces cerevisiae
           YDR370C Hypothetical ORF
          Length = 390

 Score =  201 bits (511), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 101/288 (35%), Positives = 166/288 (57%), Gaps = 4/288 (1%)

Query: 88  SKLIGYVGSDLSVESETFHPVTSEELHCLHGLLKFIAKWEADNEVNYASRSKFTIVSPRH 147
           +K   YVG DL    + F P+T  +L  + G+ +F+ KWE D+   Y+S S FTIV  RH
Sbjct: 83  AKTNSYVGHDLLEHYDDFQPLTPNQLEDMSGVFEFLNKWEGDHGKPYSSGSDFTIVCSRH 142

Query: 148 HILDILMIPFGNERCRLVFTAHRGLFVITLAPS--QRPTGINSPSSATRKICYTGFELER 205
           +++D++M PF +E          G   I       ++  GI S  S  R+ICYTGFELE 
Sbjct: 143 NLIDLIMAPFSDEDVHFNVKYINGYLHIFPDKQFQKKDDGIYSSESNIRRICYTGFELED 202

Query: 206 LLTATS-GTERGSFYSFIEAKLEPDITILLQCEMDAYNPKRQKYTEIKSSVDFNVRNVRH 264
           L+T T  G  + +FYS ++ K+  +I +L + EMD +NP ++ YTEIK +    V++  H
Sbjct: 203 LVTETQPGAPKSAFYSLVQGKISKNIKLLFKAEMDCFNPAKRSYTEIKCTTGLKVKSAFH 262

Query: 265 LSKLLKIWAQTALLPSTDILVGFRDPSTHVLKTVVPYSVDQIAEKLYIRDRTRSHPSYFN 324
             KLL++W QT+L+PSTD+L+G RDP  H L +   Y+  ++ +K   R+ +     Y N
Sbjct: 263 RRKLLRMWVQTSLVPSTDLLIGLRDPYYHQLSSFECYTRQELYQKFNNRNLSLLKKKY-N 321

Query: 325 FNPEVAKDWTHYAIREICERLSSLVDATSSSPQSFLVEIDKNLQMKIR 372
           +N  ++  W  + ++ +C+ ++  V+ T +   SF + + K L++++R
Sbjct: 322 YNANISVQWFRHLVKRLCQTITPYVEKTPTEAVSFKLTLTKQLELRLR 369

>Kwal_55.21415 s55 (826461..827630) [1170 bp, 389 aa] {ON} YDR370C -
           Hypothetical ORF [contig 130] FULL
          Length = 389

 Score =  198 bits (503), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 115/357 (32%), Positives = 188/357 (52%), Gaps = 11/357 (3%)

Query: 23  VNVNMKKFPHGPITRRGKERSIRIFSESREVGTA--FRQGLVYXXXXXXXXXXXXXEICE 80
           V+ N K F H  I +  K   +  F E +EV T         +             ++CE
Sbjct: 17  VHANCKNFQHAQINQFPKN-VLPFFDEVQEVATITHLLDTDEFLLDDKLGMPELVQDLCE 75

Query: 81  YISHRSKSKLIGYVGSDLSVESETFHPVTSEELHCLHGLLKFIAKWEADNEVNYASRSKF 140
           +      +    Y+G DL    + + P+T ++L  + G+  F+ +W+  +  ++   + F
Sbjct: 76  FTESGKLANKGKYIGHDLLDHFDEYVPITPKQLEDMAGVQAFLERWKQLHGRSFCDNADF 135

Query: 141 TIVSPRHHILDILMIPFGNERCRLVFTAHRGLFVITLAPSQR----PTGINSPSSATRKI 196
           TIV  RH+++D++M+PF +E   L      G   + L+P  +      GI+S  +  +KI
Sbjct: 136 TIVCSRHNLIDLIMMPFSDEDVHLKIQFSNG--YLNLSPDAQYQKTDQGIHSGDTKIKKI 193

Query: 197 CYTGFELERLLTATSGTE-RGSFYSFIEAKLEPDITILLQCEMDAYNPKRQKYTEIKSSV 255
           CYTGFELE L+TATS  + R SFYS +E KL   I +LL+ EMD +N   + YTEIK S 
Sbjct: 194 CYTGFELENLITATSKPDVRSSFYSLVEGKLGDGIKLLLKAEMDCFNSSTRSYTEIKCSS 253

Query: 256 DFNVRNVRHLSKLLKIWAQTALLPSTDILVGFRDPSTHVLKTVVPYSVDQIAEKLYIRDR 315
              V++  H  KLL++W QT+L+PST++LVG RDP  H L +   Y+  Q+  K   +  
Sbjct: 254 GLKVKSTYHRRKLLRMWVQTSLVPSTNLLVGIRDPYYHQLTSFECYTRSQLYRKFNNQRL 313

Query: 316 TRSHPSYFNFNPEVAKDWTHYAIREICERLSSLVDATSSSPQSFLVEIDKNLQMKIR 372
           T    +Y N+N  ++  W  + I+++C+ +   ++  S    +F + + KNL +K+R
Sbjct: 314 TVMRKNY-NYNATISVQWFRHVIQQLCQMIKPFIEKGSKEEVNFRLTLRKNLTIKLR 369

>KAFR0E03820 Chr5 (758469..759659) [1191 bp, 396 aa] {ON} Anc_5.437
           YDR370C
          Length = 396

 Score =  183 bits (465), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 101/287 (35%), Positives = 158/287 (55%), Gaps = 11/287 (3%)

Query: 91  IGYVGSDLSVESETFHPVTSEELHCLHGLLKFIAKWEADNEVNYASRSKFTIVSPRHHIL 150
           + Y+GSDL    E F  ++ EEL        +I KWEA +   Y    K+TIVS RHHI+
Sbjct: 100 VKYIGSDLYQGFENFESMSREELDSALPCFAYIKKWEAHHHCKYTENKKYTIVSARHHIV 159

Query: 151 DILMIPFGNERCRLVFTAHRGLFVITLA-----PSQRPTGINSPSSATRKICYTGFELER 205
           +++M  F   +  +V + + G  ++T +     P     GI + +   +KICY+GF LE 
Sbjct: 160 NLIMSIFDTSKETIVNSTYLGNGLLTFSQDTSDPMTMNEGIFTKNKNLKKICYSGFALED 219

Query: 206 LLTATSGTERGSFYSFIEAKLEPDITILLQCEMDAYNPKRQKYTEIKSSVDFNVRNVRHL 265
           LLT +   ++   +S  E +L+ +IT+LL+CEMDAYN   Q YTE+K      + + +H 
Sbjct: 220 LLTKS---QKEPLFSITENQLDDNITLLLRCEMDAYNQLTQNYTELKCYAPLKMASPQHR 276

Query: 266 SKLLKIWAQTALLPSTDILVGFRDPSTHVLKTVVPYSVDQIAEKLYIRDRTRSHPSYFNF 325
            KLLK W QT +LPS+D++ G R P    L  +  YS D +  +   R+   +  S  NF
Sbjct: 277 KKLLKTWIQTGVLPSSDLMFGIRSPYNGELLDIEWYSRDGLYRRFNNRNLPENKKS-LNF 335

Query: 326 NPEVAKDWTHYAIREICERLSSLVDATSSSPQSFLVEIDKNLQMKIR 372
           N  +A +W+H+ I+ ICE +S   +    +PQ+F +++D    + IR
Sbjct: 336 NANIAVEWSHHCIKTICELISD--NLQGDAPQAFQIKVDTFRNISIR 380

>TDEL0B02180 Chr2 (388145..389401) [1257 bp, 418 aa] {ON} Anc_5.437
           YDR370C
          Length = 418

 Score =  180 bits (457), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 119/401 (29%), Positives = 194/401 (48%), Gaps = 36/401 (8%)

Query: 4   DISTLAGKMRHLTLEKDLIVNVNMKKFPHGPITRRGKERSIR------------------ 45
           D ST +    HL   K  + ++ ++  PHGP  +R K++S +                  
Sbjct: 6   DSSTASSLEVHLLGNK--LNSLGLQDSPHGPSKQRRKQQSGKRTVCIPFSKFEHSDLDYF 63

Query: 46  ------IFSESREVGTAFRQGLVYXXXXXXXXXXXXXEICEYI--SHRSKSKLIGYVGSD 97
                  F    EV T ++ G ++             ++   +   +R     + Y+G D
Sbjct: 64  PDDTADFFEGCEEVAT-YQNGYLFMKDSSKKPLYPCLQMFAALIAENRGPKNKLPYIGCD 122

Query: 98  LSVESETFHPVTSEELHCLHGLLKFIAKWEADNEVNYASRSKFTIVSPRHHILDILMIPF 157
           L    E + P+ S EL       ++I KWE        +  K TI+SPRHH++D++M  F
Sbjct: 123 LYQGHERYKPLPSSELDSSIACFEYIKKWERRKISKSFNSGKVTIISPRHHVVDLVMALF 182

Query: 158 GNERCRLVFTA-HRGLFVITLAPSQRP-TGINSPSSATRKICYTGFELERLLTATSGTER 215
            ++   ++ T   +G  + +   S+    G+NS +S TRKICY+GF LE  LT +     
Sbjct: 183 HDDEVSIICTNIGKGKLIFSGDRSKEERNGLNSKNSMTRKICYSGFALEDKLTTSHDERM 242

Query: 216 GSFYSFIEAKLEPDITILLQCEMDAYNPKRQKYTEIKSSVDFNVRNVRHLSKLLKIWAQT 275
           G FYS +E K+   +++LL+CEMDAYNP   +YTE+K     NV++  H  KLLK W Q 
Sbjct: 243 GPFYSIVEGKINERLSLLLRCEMDAYNPIFNRYTELKCFTKLNVQDTAHRRKLLKTWVQI 302

Query: 276 ALLPSTDILVGFRDPSTHVLKTVVPYSVDQIAEKLYIRDRTRSHPSYFNFNPEVAKDWTH 335
            L+P +D+++G RD     L+ +  YS   + +K       R++  Y NFN  +A +W  
Sbjct: 303 GLIPDSDLIIGTRDTQVGQLEDLTWYSRGSLYKKFNNPSIARNN-KYLNFNANIAVEWCF 361

Query: 336 YAIREICERL--SSLVDATSSSP--QSFLVEIDKNLQMKIR 372
           + I  IC+ +  +SL       P  +SF V +DK+  + ++
Sbjct: 362 HCIESICDLVMKNSLSSPDDPYPKYESFKVIVDKSHNIIVK 402

>ZYRO0F10098g Chr6 complement(818672..819793) [1122 bp, 373 aa] {ON}
           similar to uniprot|Q06349 Saccharomyces cerevisiae
           YDR370C Hypothetical ORF
          Length = 373

 Score =  177 bits (448), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 111/356 (31%), Positives = 188/356 (52%), Gaps = 16/356 (4%)

Query: 26  NMKKFPHGPITRRGKERSIRIFSESREVGTAFRQGLVYXXXXXXXXXXXXXEI---CEYI 82
           N  + P  P  +     + R  SE R + T +++   Y              +      +
Sbjct: 9   NRAQLPSVPFNQFQHSSAFRFPSEPRNLFTKYKEASYYYGGQLHDSISDSIGLKSPGNKL 68

Query: 83  SH-RSKSKLIGYVGSDLSVESETFHPVTSEELHCLHGLLKFIAKWEADNEVNYASRSKFT 141
           SH RS S    ++GSDL    E F P++ E L    G  ++I KWE DN  +Y+ RS F 
Sbjct: 69  SHDRSCSNKRDFLGSDLYQGWEDFLPLSPEILDSSRGCYQWINKWENDNHTSYSQRSPFV 128

Query: 142 IVSPRHHILDILMIPFGNERCRLVFTAHRGLFVITLA------PSQRPTGINSPSSATRK 195
           ++SPRH+++++ M  F   +  ++ T H G   I L+       S + T  N+  + T+K
Sbjct: 129 VISPRHYLVELTMQLFQQSKYSILCT-HLGDGKIVLSQVENDKKSHQHTSRNT--TMTKK 185

Query: 196 ICYTGFELERLLTATSGTERGSFYSFIEAKLEPDITILLQCEMDAYNPKRQKYTEIKSSV 255
           I ++G+ LE LLT     E   F++ IEA+L+ +I+++L+CE+D+YN   + +TE+K   
Sbjct: 186 ILHSGYALEDLLTRGPRVEDDPFFAIIEAELDANISLVLRCELDSYNELTETFTELKCYA 245

Query: 256 DFNVRNVRHLSKLLKIWAQTALLPSTDILVGFRDPSTHVLKTVVPYSVDQIAEKLYIRDR 315
             N+ N  H  KLLK W Q A+ P  D+L+G R+    +L+ +  ++  ++  K+  R+ 
Sbjct: 246 PLNMHNAYHREKLLKTWIQLAISPRCDLLIGVRNTHMGLLQDLQYFTNKELYRKINDRNL 305

Query: 316 TRSHPSYFNFNPEVAKDWTHYAIREICERLSSLVDATSSSPQSFLVEIDKNLQMKI 371
            +S P  FN+N ++A  W  + IR IC+ +   VD   SSPQ F + ID++ ++++
Sbjct: 306 PKS-PKRFNYNADLAVQWCQHCIRSICKLVGENVD--RSSPQCFKLTIDESHKIQL 358

>NCAS0F03400 Chr6 complement(686480..687727) [1248 bp, 415 aa] {ON}
           Anc_5.437 YDR370C
          Length = 415

 Score =  177 bits (448), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 110/315 (34%), Positives = 162/315 (51%), Gaps = 42/315 (13%)

Query: 93  YVGSDLSVESETFHPVTSEELHCLHGLLKFIAKWEADNEVNYASRSKFTIVSPRHHILDI 152
           Y+GSDL    ETF P+++++L  L   + FI  WE      Y    KF IVS RHHI+++
Sbjct: 95  YLGSDLYDGFETFVPMSAKDLDSLEPCMSFIKDWERKASTKYKPGRKFNIVSTRHHIVEM 154

Query: 153 LMIPF-----------------------GNERCRLVFTAHRGLFVITLAPSQRPTGINSP 189
            M  F                       G+E  RL+FT        +   +    GI S 
Sbjct: 155 TMKLFTGKTNNYNNTKKVQDYVLNVVYTGDETGRLLFTKD-----WSNTGNSMNEGIYSK 209

Query: 190 SSATRKICYTGFELERLLTATS-----------GTERGSFYSFIEAKLEPDITILLQCEM 238
           +   ++ICY+GF LE L+T T+           G E+  F + +E KL+ DI ILL+CE+
Sbjct: 210 NIILKRICYSGFALEDLMTETTSELEKEGEKLTGGEKAVF-AVVENKLDDDICILLRCEL 268

Query: 239 DAYNPKRQKYTEIKSSVDFNVRNVRHLSKLLKIWAQTALLPSTDILVGFRDPSTHVLKTV 298
           DA+N   +K+TE+K      + N  H  KLLK W QT +LP +DIL+G RD S   L+ V
Sbjct: 269 DAFNGAEKKFTELKCFSPLKMSNFSHRRKLLKAWVQTGVLPDSDILIGIRDSSFGELEDV 328

Query: 299 VPYSVDQIAEKLYIRDRTRSHPSYFNFNPEVAKDWTHYAIREICERLSSLVDATS-SSPQ 357
             YS D++  K+  R+   S   + NFN +VA  W+ + IR IC+ +   +D  + S+PQ
Sbjct: 329 EWYSRDRLRSKINNRNLPESKIDW-NFNAQVATQWSQHCIRSICKLVDENLDQKAISNPQ 387

Query: 358 SFLVEIDKNLQMKIR 372
            F + ID    ++I+
Sbjct: 388 GFQIRIDSRRNIRIK 402

>YDR370C Chr4 complement(1217782..1219110) [1329 bp, 442 aa] {ON}
           Putative protein of unknown function
          Length = 442

 Score =  170 bits (430), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 110/345 (31%), Positives = 171/345 (49%), Gaps = 33/345 (9%)

Query: 46  IFSESREVGTAFRQGLVYXXXXXXXXXXXXXEICEYISH---RSKSKLIGYVGSDLSVES 102
           IF ES+EV   F  G  Y              I E        +K + + Y+G DL    
Sbjct: 87  IFHESKEVA-LFTNGRAYTILRKDLIPNLKESIAELYESSLLEAKKRKVPYLGHDLFANI 145

Query: 103 ETFHPVTSEELHCLHGLLKFIAKWEADNE-VNYASRSKFTIVSPRHHILDILMIPFG--N 159
           + F P+T  EL  +     +I  W  DN   ++    KFT+V+ RHHI+D+ M  F   N
Sbjct: 146 DEFVPMTISELDSVSPCFSYIENWILDNPGKDFKIGKKFTVVTTRHHIVDLTMHLFNRRN 205

Query: 160 ERCRLVFTAHRGLFVITLAPSQRPT------GINSPSSATRKICYTGFELERLLTATSGT 213
            +  L+ T + G  +++   + +        GI S     +KICY+GFE E  +T  S  
Sbjct: 206 RQTSLIVT-YMGAGLLSFCRNVKKDSQMSKEGIYSNDPNMKKICYSGFEFENWVTENSKV 264

Query: 214 -----ERGSFYSFIEAKLEPDITILLQCEMDAYNPKRQKYTEIKSSVDFNVRNVRHLSKL 268
                 +   +S +E+KL  +I +L++CEMDA+NP  +  TE+K     ++ N  H  KL
Sbjct: 265 ADLTGSKCPIFSLVESKLSEEIGLLIRCEMDAFNPVSETNTELKCFAPLSMHNSNHRRKL 324

Query: 269 LKIWAQTALLPSTDILVGFRDPSTHVLKTVVPYSVDQIAEKLYIRDRTRSHPSY------ 322
           LK W QT LLP++DI++G RD  +  L  +  YS D + +K        +HP        
Sbjct: 325 LKTWVQTGLLPNSDIMIGLRDSHSGQLLDIQWYSRDLLCKKF-------NHPGLPTNKKE 377

Query: 323 FNFNPEVAKDWTHYAIREICERL-SSLVDATSSSPQSFLVEIDKN 366
            N+N ++A +W HY I  IC+ + +++ D +S+ P+SF + ID N
Sbjct: 378 LNYNAQIAVEWCHYCIEAICKLVEANISDYSSTKPESFEIGIDTN 422

>Smik_4.636 Chr4 complement(1137846..1139186) [1341 bp, 446 aa] {ON}
           YDR370C (REAL)
          Length = 446

 Score =  167 bits (423), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 119/377 (31%), Positives = 185/377 (49%), Gaps = 31/377 (8%)

Query: 27  MKKFPHGPITRRGKERSIRIFSESREVGTAFRQGLVYXXXXXX---XXXXXXXEICEYIS 83
           M KFP  P           IF ES+EV   F  G  Y                E+CE   
Sbjct: 76  MHKFPAKPPRD--------IFHESKEVAL-FTNGQAYTTVRKDILPNLKGDIAELCERSL 126

Query: 84  HRSKSKLIGYVGSDLSVESETFHPVTSEELHCLHGLLKFIAKWEADNEV-NYASRSKFTI 142
             ++ + + Y+G DL      F P+T  EL  +   + +I  W  +N   ++    KFT+
Sbjct: 127 LDARERKLPYLGHDLFANIGQFVPMTISELDSILPCISYIENWRLNNHGEDFKIGRKFTV 186

Query: 143 VSPRHHILDILMIPFG--NERCRLVFTAHRGLFVITLAPSQR------PTGINSPSSATR 194
           V+ RHHI+D+ M  F   N++  LV T + G  +I+ + +Q+        GI S     +
Sbjct: 187 VTTRHHIVDMTMHLFDRRNKKRSLVAT-YMGAGLISFSRNQKNDSRMSKEGIYSSDPNMK 245

Query: 195 KICYTGFELERLLT-----ATSGTERGSFYSFIEAKLEPDITILLQCEMDAYNPKRQKYT 249
           KICY+GFE E  +T     A     +   +S +E+KL  +I +L++CEMDA+NP     T
Sbjct: 246 KICYSGFEFENWVTEGIKAADLNGSKLPVFSVVESKLSEEIGLLIRCEMDAFNPVSGANT 305

Query: 250 EIKSSVDFNVRNVRHLSKLLKIWAQTALLPSTDILVGFRDPSTHVLKTVVPYSVDQIAEK 309
           E+K     ++ N  H  KLLK W QT L P++DI++G RD  +  L  +  YS D +  K
Sbjct: 306 ELKCFAPLSMHNSNHRRKLLKTWIQTGLSPNSDIMIGLRDSHSGQLLDIQWYSRDSLCMK 365

Query: 310 LYIRDRTRSHPSYFNFNPEVAKDWTHYAIREICERL-SSLVDATSSSPQSFLVEIDKNLQ 368
            +      S+    N+N +VA +W ++ I+ ICE L +++ D +  +P+SF + ID N  
Sbjct: 366 -FNHSGLPSNKRELNYNAKVAVEWCNHCIKSICELLGANISDYSCKNPESFEISIDSNNT 424

Query: 369 MKIR--PTVVDYSELLG 383
           + I     +  + EL G
Sbjct: 425 IAITKLKNIPKHVELFG 441

>NDAI0B05690 Chr2 (1387153..1388424) [1272 bp, 423 aa] {ON}
           Anc_5.437 YDR370C
          Length = 423

 Score =  166 bits (420), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 102/304 (33%), Positives = 158/304 (51%), Gaps = 29/304 (9%)

Query: 93  YVGSDLSVESETFHPVTSEELHCLHGLLKFIAKWEADNEVNYASRSKFTIVSPRHHILDI 152
           Y+GSDL    E+F P+  +EL  +    K+I  WE  N+ +Y   +KFTIVS RHHI+++
Sbjct: 110 YLGSDLYDGYESFIPMDPDELDSIEPCFKYIESWELQNKHDYQLGNKFTIVSARHHIVEM 169

Query: 153 LMIPFGNERCRLVFT-------AHRGLFVITLAPSQRPTG-INSPSSATRKICYTGFELE 204
            M  F N+R    F           G+ + +   +++  G I S     RKI Y+GF LE
Sbjct: 170 TMCIF-NKRKMDDFILNVTYKGGSNGMLLFSRDVNKKDDGGIYSKDGVVRKISYSGFALE 228

Query: 205 RLLTATSGTERG------------SFYSFIEAKLEPDITILLQCEMDAYNPKRQKYTEIK 252
            LLT                    + ++ IE KL  DI++LL+CEMD+YNP  + +TE+K
Sbjct: 229 DLLTTNKNDHNADNSDVTLVGGDKAVFAIIENKLNDDISLLLRCEMDSYNPVNKCFTEMK 288

Query: 253 SSVDFNVRNVRHLSKLLKIWAQTALLPSTDILVGFRDPSTHVLKTVVPYSVDQIAEKLYI 312
                 + N  H  KLLK W QT ++P++DIL+G RDP    L  +  +S       LY 
Sbjct: 289 CFARLKMNNHNHRRKLLKAWVQTGVIPNSDILIGIRDPMFGELNDIEWFS----RMNLYR 344

Query: 313 RDRTRSHPSY---FNFNPEVAKDWTHYAIREICERLSSLVDATS-SSPQSFLVEIDKNLQ 368
           +   R+ P      N+N E+A  W+ + I+ IC+ +   +D T  ++ QSF + I+ +  
Sbjct: 345 QINNRNLPEAKLDLNYNAEIAVQWSQHCIKSICKLVDESIDKTRLNTSQSFQIRINASRA 404

Query: 369 MKIR 372
           ++I+
Sbjct: 405 IQIK 408

>KLLA0E02245g Chr5 complement(210001..211212) [1212 bp, 403 aa] {ON}
           weakly similar to uniprot|Q06349 Saccharomyces
           cerevisiae YDR370C Hypothetical ORF
          Length = 403

 Score =  164 bits (414), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 104/307 (33%), Positives = 162/307 (52%), Gaps = 17/307 (5%)

Query: 77  EICEYISH---RSKSKLIGYVGSDLSVESETFHPVTSEELHCLHGLLKFIAKWEADNEVN 133
           E+C YI      +K+    ++G DL+   + + P+    L+ L  L +   ++E      
Sbjct: 95  EVCTYIKDSKWENKAVKDSFIGIDLTKGYDDYVPLDRNVLNSLVILKEAYQRYEKT---- 150

Query: 134 YASRSKFTIVSPRHHILDILMIPFGNERCRLVFTAH--RGLFVITLAPSQRPTGIN-SPS 190
             +  K T VS RHHI+DI+M PF +E   L+ T    + + +       +P GI+ + +
Sbjct: 151 -LNPEKTTFVSLRHHIIDIIMCPFLDEPLSLLMTVQPDKNILISVDKSKDKPNGIHETRN 209

Query: 191 SATRKICYTGFELERLL--TATSG--TERGSFYSFIEAKLEPDITILLQCEMDAYNPKRQ 246
           S  +KICYTGF LE LL  + T G   E   +YS +   L  +I +L+Q EMD+ N    
Sbjct: 210 SFNKKICYTGFALEDLLIESPTEGHILEHELYYSIVHGSLNDEIDLLIQAEMDSINTLTD 269

Query: 247 KYTEIKSSVDFNVRNVRHLSKLLKIWAQTALLPSTDILVGFRDPSTHVLKTVVPYSVDQI 306
            YTEIKSSV F + N  H  KLL++W QT LLP +D+L+GFR+  ++ L+ +  Y +  I
Sbjct: 270 TYTEIKSSVHFKLGNTYHRRKLLRMWIQTNLLPKSDLLIGFRNSYSNELEQLKAYKIQDI 329

Query: 307 AEKLYIRDRTRSHPSYFNFNPEVAKDWTHYAIREICERLSSLVDATSSSPQSFLVEIDKN 366
             K+           ++ FNP VA DW  +  + + + L  L+ +  S+  +F V+ID N
Sbjct: 330 YHKINNSSIVGKPGKFYKFNPNVANDWFQHIFQVLKQNL--LLLSQESTSTTFKVQIDTN 387

Query: 367 LQMKIRP 373
           L + I P
Sbjct: 388 LTLSISP 394

>Skud_4.639 Chr4 complement(1140646..1141974) [1329 bp, 442 aa] {ON}
           YDR370C (REAL)
          Length = 442

 Score =  163 bits (413), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 116/364 (31%), Positives = 178/364 (48%), Gaps = 29/364 (7%)

Query: 30  FPHGPITRRGKERSIRIFSESREVG--TAFRQGLVYXXXXXXXXXXXXXEICEYISHRSK 87
           F H  I    ++    IF +S+EV   T ++                  E+ E     ++
Sbjct: 71  FVHTSIHDLSRKPPGDIFQDSKEVALFTNYQAYTTARKDLIPSLRDGITELYESSLLEAR 130

Query: 88  SKLIGYVGSDLSVESETFHPVTSEELHCLHGLLKFIAKWEADNE-VNYASRSKFTIVSPR 146
            + + Y+G DL    + F P+T  EL  +   + ++  W+  N   N+    KFTIVS R
Sbjct: 131 RRKVPYLGHDLFANIDQFVPMTISELDSISPCISYVENWKLSNHGKNFKIGKKFTIVSAR 190

Query: 147 HHILDILMIPFG--NERCRLVFT-AHRGLFVITLAPSQ----RPTGINSPSSATRKICYT 199
           HHI+D+ M  F   N+R  L+ T    GL   +  P         GI S     +KICY+
Sbjct: 191 HHIVDLTMHRFDRRNKRKSLIVTYMGAGLISFSRNPKNDFQMSKEGIYSSDPNMKKICYS 250

Query: 200 GFELERLLT----ATS-GTERGSFYSFIEAKLEPDITILLQCEMDAYNPKRQKYTEIKSS 254
           GFE E  +T    AT     +   +S +E+KL  DI +L++CE+DA+NP  +  TE+K  
Sbjct: 251 GFEFEHWVTEDIKATDLNGPKHPIFSVVESKLSEDIGLLMRCEIDAFNPVSRTNTELKCF 310

Query: 255 VDFNVRNVRHLSKLLKIWAQTALLPSTDILVGFRDPSTHVLKTVVPYSVDQIAEKLYIRD 314
              ++ N  H  KLLK W QT LLP++DI++G RD  +  L  +  YS D + +K     
Sbjct: 311 GPLSMHNSNHRKKLLKTWIQTGLLPNSDIVIGLRDSHSGQLLDIQWYSRDSLYKKF---- 366

Query: 315 RTRSHPSY------FNFNPEVAKDWTHYAIREICERL-SSLVDATSSSPQSFLVEIDKNL 367
              +HP         NFN +VA +W ++ I+ ICE + +++    S+ P+SF V ID N 
Sbjct: 367 ---NHPGLPPSKKELNFNAKVAVEWCNHCIKSICELVEANISHYNSTRPESFEVSIDANG 423

Query: 368 QMKI 371
            + I
Sbjct: 424 TIAI 427

>Suva_2.542 Chr2 complement(968396..969724) [1329 bp, 442 aa] {ON}
           YDR370C (REAL)
          Length = 442

 Score =  155 bits (392), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 108/348 (31%), Positives = 168/348 (48%), Gaps = 39/348 (11%)

Query: 46  IFSESREVGTAFRQGLVYXXXXXXXXXXXXXEICEYISHRSKSKLIG-------YVGSDL 98
           IF ES+EV   F    +Y              + E ISH  +S L+        Y+G DL
Sbjct: 87  IFYESKEVA-LFTDNQLYVAARKDVIP----NLKEDISHLYESPLLEARKLKTLYLGLDL 141

Query: 99  SVESETFHPVTSEELHCLHGLLKFIAKWEADNEVN-YASRSKFTIVSPRHHILDILMIPF 157
               +   P+T  EL  +   + +I  W  +N    +    KFT+V+ RHHI+D+ M PF
Sbjct: 142 FANIDELVPMTISELDTIAPCISYIEDWRLNNSGKPFKIGKKFTVVTTRHHIVDLTMHPF 201

Query: 158 GN-ERCRLVFTAHRGLFVITLAPSQR------PTGINSPSSATRKICYTGFELERLLT-- 208
               + + +   + G   I+L+ + +        GI S     +KIC++GFE E  LT  
Sbjct: 202 DRRNKQKSIIATYMGNGFISLSRNPKYDHKASKEGIYSGDPNIKKICHSGFEFENCLTEN 261

Query: 209 ---ATSGTERGSFYSFIEAKLEPDITILLQCEMDAYNPKRQKYTEIKSSVDFNVRNVRHL 265
              + S   +   +S +E KL  DI +L++CEMDA+NP  +  TE+K     +++N  H 
Sbjct: 262 TKNSGSSASKCPVFSIVEGKLSEDIGLLMRCEMDAFNPVSKTNTELKCFGPLSMQNSSHR 321

Query: 266 SKLLKIWAQTALLPSTDILVGFRDPSTHVLKTVVPYSVDQIAEKLYIRDRTRSHPSY--- 322
            KLLK W QT LLP++DI+VG RD  +  L  +  YS D +  K        +HP     
Sbjct: 322 KKLLKTWIQTGLLPNSDIMVGLRDSYSGQLLDIQWYSRDTLFRKF-------NHPGLPLN 374

Query: 323 ---FNFNPEVAKDWTHYAIREICERLSSLVDA-TSSSPQSFLVEIDKN 366
               N+N +VA +W  + I+ IC+ + + +     + P+ F + ID N
Sbjct: 375 KKEMNYNAKVAVEWCKHCIKSICDLVEANISRYNCNKPEPFEINIDAN 422

>CAGL0A02860g Chr1 complement(300736..301944) [1209 bp, 402 aa] {ON}
           similar to uniprot|Q06349 Saccharomyces cerevisiae
           YDR370c
          Length = 402

 Score =  146 bits (368), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 90/299 (30%), Positives = 156/299 (52%), Gaps = 21/299 (7%)

Query: 87  KSKLI-GYVGSDLSVESETFHPVTSEELHCLHGLLKFIAKWEADNEVNYASRSKFTIVSP 145
           K++L+  ++G  L    + + P+T++EL        ++ ++E  +   Y     F IV+ 
Sbjct: 104 KTQLVRPFLGISLYENHDKYSPMTAKELDTTEACSTYLDQYENSHGQKYGEDRDFVIVTA 163

Query: 146 RHHILDILMIPFGNERCRLVFTAHRGLFVIT----LAPSQRPT-------GINSPSSATR 194
           RHH++D+ ++PF  +     FT    L   T    L  SQ P        G+N+ +   +
Sbjct: 164 RHHMIDLAILPFSRQ-----FTNVNLLCAYTPGNLLEISQDPADNTNDKVGVNTDNPILK 218

Query: 195 KICYTGFELERLLTATSGTE-RGSFYSFIEAKLEPDITILLQCEMDAYNPKRQKYTEIKS 253
           KIC++GF LE +LT ++  E R   +  +E ++  +  +L++CE+DAYNP    YTE+K 
Sbjct: 219 KICFSGFALEDILTESANDEERNPTFLIVENEI-ANTRLLMRCEIDAYNPITSHYTELKC 277

Query: 254 SVDFNVRNVRHLSKLLKIWAQTALLPSTDILVGFRDPSTHVLKTVVPYSVDQIAEKLYIR 313
              +N  N  H  KLLK W QT ++P+TDI++G RD  +  L+ V  Y+ + +  KL  +
Sbjct: 278 YAKYNFGNPNHRRKLLKSWIQTGVIPTTDIVIGVRDTESGCLQDVRCYNRNLLYNKLISK 337

Query: 314 DRTRSHPSYFNFNPEVAKDWTHYAIREICERLSSLVDATS-SSPQSFLVEIDKNLQMKI 371
              R   S  N++P ++  W    I  +   ++SL+D      PQ F +++D N  ++I
Sbjct: 338 SLPRCD-SELNYDPAISVVWYRSLINTLTTTIASLLDKFGRDEPQLFSIKVDNNCNIRI 395

>Kpol_1016.4 s1016 (8493..9362,9366..9737) [1242 bp, 413 aa] {ON}
           (8493..9362,9366..9737) [1242 nt, 414 aa]
          Length = 413

 Score =  137 bits (345), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 90/298 (30%), Positives = 155/298 (52%), Gaps = 14/298 (4%)

Query: 85  RSKSKLIGYVGSDLSVESETFHPVTSEELHCLHGLLKFIAKWEADNE-VNYASRSKFTIV 143
            SK   + Y+GSDL   ++ + P+  + L        FI  WE ++   +Y + + +TI+
Sbjct: 102 NSKKYKLPYLGSDLYASTDKYGPLPEDVLDSPKPCFDFIRHWENEHRGEHYGAHADYTIL 161

Query: 144 SPRHHILDILMIPFGNER-CRLVFTA---HRGLFVIT-----LAPSQRPTGINSPSSATR 194
           SPRHHI +I+M  F +E+ C +         G+ +++      + +   TG+NS +  TR
Sbjct: 162 SPRHHITEIVMSLFEDEKNCSVYLLCTYLKNGIILLSKDDASSSSNSNTTGLNSSNPMTR 221

Query: 195 KICYTGFELERLLTATSGTERGSFYSFIEAKLEPDITILLQCEMDAYNPKRQKYTEIKSS 254
           KICY+GF  E L+           +S +E+KL   I +LL+ E+D YN     +TE+K  
Sbjct: 222 KICYSGFAFEDLVLEDIAENARPIFSVVESKLTESINLLLRNELDGYNNVTNMFTELKCF 281

Query: 255 VDFNVRNVRHLSKLLKIWAQTALLPSTDILVGFRDPSTHVLKTVVPYSVDQIAEKLYIRD 314
               ++ +    ++LK W QT L+P +DI++G RD  + +L+ +V Y+   +  + +   
Sbjct: 282 AP--LKCMFSAKEVLKTWVQTGLIPESDIVIGIRDTQSGLLEDLVWYNRKDLC-RTFNNP 338

Query: 315 RTRSHPSYFNFNPEVAKDWTHYAIREICERLSSLVDATSSSPQSFLVEIDKNLQMKIR 372
                PS+FNFN  +A +W  + + E    L S   A S+ P SF ++ID +  + I+
Sbjct: 339 SLPPAPSHFNFNANIAVEWLKFTM-ESIVSLVSSSIADSNHPCSFKLKIDNHKTISIQ 395

>KNAG0C04890 Chr3 (945616..946833) [1218 bp, 405 aa] {ON} Anc_5.437
           YDR370C
          Length = 405

 Score =  128 bits (321), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 79/273 (28%), Positives = 136/273 (49%), Gaps = 13/273 (4%)

Query: 120 LKFIAKWE--ADNEVNYASRSKFTIVSPRHHILDILMIPFGNER-CRLVFTAHRGLFVI- 175
           L +I +W   +  E  +    +  IV PRHH++++ M  F N+   +LV T  RG F++ 
Sbjct: 130 LDYINEWNRGSKGEKKFGESYRHIIVGPRHHLVELTMALFANDSDYKLVCTVLRGKFIVL 189

Query: 176 ----TLAPSQRPTGINSPSSATRKICYTGFELERLLTATSGTERGSFYSFIEAKLEPDIT 231
                 +   R  GI      TR +CY+GF + ++ +   G     F+ +    +     
Sbjct: 190 SQFDDGSQRNRNEGITLSDRRTRMLCYSGFVICKIWSLNRGIIPSQFF-YYGTPIRRGHL 248

Query: 232 ILLQCEMDAYNPKRQKYTEIKSSVDFNVRNVRHLSKLLKIWAQTALLPSTDILVGFRDPS 291
               CEMDAYN     YTE+K     N+++  H SKLL+ W QT + P TD+++G R+  
Sbjct: 249 ATFTCEMDAYNQIENHYTELKCYGPLNMKSSYHKSKLLRTWVQTEVSPDTDVVIGCRNAY 308

Query: 292 THVLKTVVPYSVDQIAEKLYIRDRTRSHPSYFNFNPEVAKDWTHYAIREICERLSSLVDA 351
              L+ +   S + +  K   + + R+H + FN+N +VA +W+ YA++ I   +   ++ 
Sbjct: 309 DGTLQDITQLSRESLYRKFNNKHQPRAHTN-FNYNAQVAVEWSQYAMKAIIRLIEGNLNQ 367

Query: 352 TSS-SPQSFLVEIDKNLQMKIR--PTVVDYSEL 381
            S   PQ+F+V + +   + IR    V  Y+E+
Sbjct: 368 KSVLEPQAFVVTVYRGHDIGIRKLKGVPKYAEI 400

>TBLA0A02800 Chr1 (675150..676511) [1362 bp, 453 aa] {ON} Anc_5.437
           YDR370C
          Length = 453

 Score =  120 bits (301), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 90/320 (28%), Positives = 143/320 (44%), Gaps = 35/320 (10%)

Query: 86  SKSKLIGYVGSDLSVESETFHPVTSEELHCLHGLLKFIAKWE---ADNEVNYASRSKFTI 142
           SK     Y+G+DL  + E +H +  E LH      K+I  ++   A+ +  Y    +F I
Sbjct: 106 SKKYKAKYIGADLFKDYEKYHAMEKEPLHDPISCFKYIQYYDKKHANEKKKYGMDKEFVI 165

Query: 143 VSPRHHILDILMIPFGN----ERCRLVFTAHRGLFVITLAPSQRPTGINSPS---SATRK 195
           ++ RHHI D+++ PF      E   L+        +++   +  P          ++ RK
Sbjct: 166 ITSRHHINDLVLAPFKKISDPEVSVLLTYLGDNRILLSQDYAHEPPDWRENKQFYNSMRK 225

Query: 196 ICYTGFELERLLTATSGTER----------------GSFYSFIEAKLEPDITILLQCEMD 239
           I  +GF  E L+     + +                 +++S +E  + P +TILL+ EMD
Sbjct: 226 IVNSGFAFEDLVIKDYTSSKLTPSLEEQQKKDPSITNNYFSVVENDISPKLTILLRSEMD 285

Query: 240 AYNPKRQKYTEIKSSVDFNVRNVRHLSKLLKIWAQTALLPSTDILVGFRDPSTHVLKTVV 299
            YNP    YTE+K     N+ +  H  KLLK W Q   LP++D+LVG RD  T +L  + 
Sbjct: 286 GYNPLTNSYTELKCFTRLNMGSPFHRQKLLKTWVQIGQLPNSDLLVGSRDTQTGLLNDIT 345

Query: 300 PYSVDQIAEKL--YIRDRTRSHPSYFNFNPEVAKDWTHYAIREIC----ERLSSLVDATS 353
            +S D +  K   Y   R R H    N  P  A  W ++ +  I     + L     A S
Sbjct: 346 WFSRDDLVTKCDSYYSPRLRFHQ---NTTPTNASAWYYHVLSAITSLTRDYLKKTPKAPS 402

Query: 354 SSPQSFLVEIDKNLQMKIRP 373
           S P  F + ++KN  + + P
Sbjct: 403 SVPVPFRLIVEKNRTITLLP 422

>TPHA0J02600 Chr10 complement(577310..578635) [1326 bp, 441 aa] {ON}
           Anc_5.437 YDR370C
          Length = 441

 Score =  117 bits (292), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 84/300 (28%), Positives = 151/300 (50%), Gaps = 18/300 (6%)

Query: 86  SKSKLIGYVGSDLSVESETFHPVTSEELHCLHGLLKFIAKWEADNEVNYASRSKFTIVSP 145
           SK   + Y+G +L  E E F P+ S  L       +++   +   E +    + +T ++P
Sbjct: 131 SKKFKLPYMGYNLYDEIEKFGPMDSTLLDSTVPCFEYLRTLKISEE-DKLYNTPYTFMTP 189

Query: 146 RHHILDILMIPFGNERCRL-----VFTAHRG-LFVIT--LAPSQRPTGINSP--SSATRK 195
           RHH+ +++M  + +    L     +FT  +  L VI+  LA    P+  N    +S ++K
Sbjct: 190 RHHLTELMMTVYESRESELTGKSWLFTRIKDDLIVISEDLAKENNPSPQNHKLQNSFSKK 249

Query: 196 ICYTGFELERLLTATSGTERGSFYSFIEAKLEPDITILLQCEMDAYNPKRQKYTEIKSSV 255
           +  +GF  E L+          ++   E +L P  T +++ EMD+YN K + +TE+K   
Sbjct: 250 VINSGFTFEELVIENFQECHKPYFYISENRLTPKSTFIIRSEMDSYNNKTETFTELKCFN 309

Query: 256 DFNVRNVRHLSKLLKIWAQTALLPSTDILVGFRDPSTHVLKTVVPYSVDQIAEKLYIRDR 315
             ++   +H  KLLK W QT L P+ DI++G RD S+ +L+ ++ YS + + +KL    +
Sbjct: 310 KLHLGVAQHRKKLLKTWFQTGLSPNCDIVIGIRDTSSGILEDLLWYSRENMYQKL----Q 365

Query: 316 TRSHPSY---FNFNPEVAKDWTHYAIREICERLSSLVDATSSSPQSFLVEIDKNLQMKIR 372
             S P +   F+F P +   W ++ I  I    +     T+S+P ++ V IDK+  + I+
Sbjct: 366 DPSLPKFKNSFDFKPHIGIQWLNHCIHAIESAFTKDTSDTASNPMTYKVIIDKHKSIIIK 425

>TPHA0G03650 Chr7 (776977..778110) [1134 bp, 377 aa] {ON} Anc_3.570
           YGL246C
          Length = 377

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 63/240 (26%), Positives = 95/240 (39%), Gaps = 35/240 (14%)

Query: 95  GSDLSVESETFHPVTSE--ELHCLHGLLKFIAKWEADNEVNYASRSKFTIVSPRHHILDI 152
           G DL+   + F    SE  +   LHGLL  +  +E         + K  IV+ R  I  +
Sbjct: 56  GLDLNGGYKKFKDYYSEFKDASTLHGLLSSLKDYEQKKN----KKMKVDIVTFRGIIRKL 111

Query: 153 LMIPFGNERCRLVFTAHRGLFVITLAPSQRPTGINSPSSATRKICYTGFELERLLTA--- 209
           +M  F       V      LF   L      T +N+       + YTG++ E L T    
Sbjct: 112 IMSSFETNSKYNVVDLRIVLFDGQLFIKDVST-VNAKPEKVTPLEYTGYKFEALCTLPEP 170

Query: 210 ------TSGTER--------GSFYSFIEAKLEPDITILLQCEMDAYNPKRQK-------Y 248
                 T   +R          F S ++  +  +  ILL  E+DA    ++K       Y
Sbjct: 171 LPYVSRTKLNKRPKKIVSHGDEFVSVVKTGV-GNCKILLGAEVDAIFDFKEKGKDNLQHY 229

Query: 249 TEIKSSVDFNVRN--VRHLSKLLKIWAQTALLPSTDILVGFRDPSTHVLKTVVPYSVDQI 306
            E+K +   N  N   +  +KL K W Q  L+  T I  GFRD   ++LKT+  ++   I
Sbjct: 230 IELKCTAAINNINDTKKFENKLFKTWIQCFLIGITRITYGFRDEQ-YLLKTIEEFATSDI 288

>Ecym_2600 Chr2 (1167583..1168737) [1155 bp, 384 aa] {ON} similar to
           Ashbya gossypii AFR263C AFR262C
          Length = 384

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 59/223 (26%), Positives = 93/223 (41%), Gaps = 42/223 (18%)

Query: 116 LHGLLKFIAKWEADNEVNYASRSKFTIVSPRHHILDILMIPFGNERCRLVFTAHRGLFVI 175
           LHGLL  I K+E   E     + K  I++ R  +  ++     N +   V      L+V+
Sbjct: 80  LHGLLSTIQKYEERKE----KKIKADIITFRGVMRKLISCALENPKYNKV-----SLYVV 130

Query: 176 TLAPS---QRPTGINSPSSATRKI----CYTGFELERLLTAT---SGTERGSFYSF---I 222
           +       +  T +  PS+ T  I     Y+G++ E L T +   S T R    S    I
Sbjct: 131 SFNEQLIIKDATKVGQPSTGTDSIDYRNYYSGYKFETLTTLSKSFSETPRQVLESRPKKI 190

Query: 223 EAKLEPDITI----------LLQCEMDAY-------NPKRQKYTEIKSSVDFN-VRNVRH 264
            +  E  +T+          +L  E+D         +   + Y E+K S   N V + R 
Sbjct: 191 VSNGEQFVTVVRTGIGKCKLILGAEVDCVFDFKEVGSDNLKHYAELKCSKAVNTVADART 250

Query: 265 LS-KLLKIWAQTALLPSTDILVGFRDPSTHVLKTVVPYSVDQI 306
              KL K W Q  L+    I+ GFRD +  +LK+V  +S  +I
Sbjct: 251 FELKLFKTWVQCFLVGINRIIYGFRDENC-ILKSVEEFSTQEI 292

>CAGL0C01925g Chr3 complement(202920..204122) [1203 bp, 400 aa] {ON}
           similar to uniprot|P53063 Saccharomyces cerevisiae
           YGL246c RAI1
          Length = 400

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 34/61 (55%), Gaps = 3/61 (4%)

Query: 248 YTEIKSSVDFNVRN-VRHLSK-LLKIWAQTALLPSTDILVGFRDPSTHVLKTVVPYSVDQ 305
           YTE+K S   +  N VR   K + + W Q  L+    ++ GFRD   ++LKTV  +S ++
Sbjct: 244 YTELKCSSQISTTNDVRRFEKKMFRAWLQCFLVGVPRVIYGFRD-DQYMLKTVEEFSTEE 302

Query: 306 I 306
           I
Sbjct: 303 I 303

>NCAS0E00240 Chr5 complement(34922..36064) [1143 bp, 380 aa] {ON}
           Anc_3.570
          Length = 380

 Score = 34.7 bits (78), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 25/40 (62%), Gaps = 1/40 (2%)

Query: 267 KLLKIWAQTALLPSTDILVGFRDPSTHVLKTVVPYSVDQI 306
           K+ + W Q  L+    I+ GFRD + +VLKT+  YS D+I
Sbjct: 256 KIFRTWLQCFLVGIPRIIYGFRDEN-YVLKTIEEYSTDEI 294

>CAGL0D00990g Chr4 (117147..118073) [927 bp, 308 aa] {ON} similar to
           uniprot|Q07379 Saccharomyces cerevisiae YDL057w
          Length = 308

 Score = 34.3 bits (77), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 53/216 (24%), Positives = 90/216 (41%), Gaps = 49/216 (22%)

Query: 84  HRSKSKLIGYVGSDLSVESETFHPVTSEELHCLHGL----LKFIAKWEADNEVNYASRSK 139
           HR+K+KLI  V   LS ++  + P+ +   HCL  L    L+   +   D+E     +  
Sbjct: 44  HRAKNKLIVLVHGSLSHKNAIYQPLLA---HCLAELGYHSLRLDFRGLGDSEDVRDPKLG 100

Query: 140 FTIVSPRHHILDILMIPFGNERCRLVF-----TAH------RGL-----FVITLAPSQRP 183
            TI    H I  +       + C  +F     T H      RG+     F +++APS  P
Sbjct: 101 RTIEEDIHDIKTVYKATQEAQICANLFETESITFHAIVGHSRGVLAMFDFALSIAPSIIP 160

Query: 184 TGINSPSSATRKICYTGFELERLLTATSGT-----ERGSFYSFIEAKLEPDITILLQCEM 238
             +N         C   F+ + LL   S       E+G FY+          T L Q ++
Sbjct: 161 ILVN---------CSGRFDGQGLLKRCSENNPNWIEKGGFYA----------TTLRQGKL 201

Query: 239 DA-YNPKRQKYTEIKSSVDFNVRNVRHLSKLLKIWA 273
              + PK + ++ I+++   N RN+ H + ++ I+ 
Sbjct: 202 QKIWIPKEESFSVIRTNT-LNYRNLSHDTTVISIYG 236

>KLLA0E12893g Chr5 complement(1140409..1141563) [1155 bp, 384 aa]
           {ON} similar to uniprot|P53063 Saccharomyces cerevisiae
           YGL246C RAI1 Nuclear protein that binds to and
           stabilizes the exoribonuclease Rat1p required for
           pre-rRNA processing
          Length = 384

 Score = 34.3 bits (77), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 57/243 (23%), Positives = 98/243 (40%), Gaps = 39/243 (16%)

Query: 97  DLSVESETFHPVTSEELH--CLHGLLKFIAKWEADNEVNYASRSKFTIVSPRHHILDILM 154
           DL    + F    +EE     LHGLL  + ++E       + ++K  I++ R  I  ++ 
Sbjct: 58  DLLSGIKKFKECNTEEFDSTTLHGLLSTLEEYER----RKSKKTKVDIITFRGIIRKLIS 113

Query: 155 IPFGNERCRLV---FTAHRG-LFVITLAPSQRPTGIN-SPSSATRKICYTGFELERLLTA 209
             F + +   V     +  G LF+  +      T IN +  S   +  Y+G++ E L T 
Sbjct: 114 SAFDSSQFNPVNFRIVSFDGQLFIKEVKTDASETSINKNRESLQARAYYSGYKFEALATL 173

Query: 210 ---------TSGTER--------GSFYSFIEAKLEPDITILLQCEMDAY-------NPKR 245
                    T+  +R          F S +   +     IL+  E+D         +   
Sbjct: 174 SLPLPLVPRTTLEKRPKKIINNGDQFISMVRTGI-GKCKILIGAEVDCIFDFKEDSDDNL 232

Query: 246 QKYTEIKSSVDFNVRNVRHL--SKLLKIWAQTALLPSTDILVGFRDPSTHVLKTVVPYSV 303
           + Y E+K +   N  +  H    KL K W Q  L+    I+ GFRD +  +LKTV  ++ 
Sbjct: 233 KHYAELKCTTMVNTVSDAHKFERKLFKTWLQCFLVGINRIIYGFRDDN-FMLKTVEEFTT 291

Query: 304 DQI 306
            ++
Sbjct: 292 SEV 294

>ZYRO0E09592g Chr5 (764748..765890) [1143 bp, 380 aa] {ON} similar
           to uniprot|P53063 Saccharomyces cerevisiae YGL246C RAI1
           Nuclear protein that binds to and stabilizes the
           exoribonuclease Rat1p required for pre-rRNA processing
          Length = 380

 Score = 34.3 bits (77), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 51/219 (23%), Positives = 87/219 (39%), Gaps = 35/219 (15%)

Query: 116 LHGLLKFIAKWEADNEVNYASRSKFTIVSPRHHILDILMIPFGNERCR---LVFTAHRGL 172
           L GLL+ I  +E         + K  IV+ R  +  ++   F         L   +  G 
Sbjct: 79  LFGLLQSIQNYEQRKN----KKIKADIVTFRGIMRKLISAAFDTSNFNPIDLRIVSFDGQ 134

Query: 173 FVITLAPSQRPTGINSPSSATRKICYTGFELERLLTA---------TSGTER-------G 216
             I   P Q      +P S  +   Y+G++ E L T          T+  +R       G
Sbjct: 135 LFIKEVPKQEAKP--APGSPAQLAWYSGYKFETLATLPQPLPLVSRTTLDKRPKKLVNTG 192

Query: 217 SFYSFIEAKLEPDITILLQCEMDAYNPKRQK-------YTEIKSSVDFNV-RNVRHLS-K 267
             Y  +      ++ ++L  E+D     +++       Y E+K S D +   + R    K
Sbjct: 193 EEYITVVKTGVGNVKVILGAEVDCIFDFKEEGKDNLKHYAELKCSADVSTPADARKFERK 252

Query: 268 LLKIWAQTALLPSTDILVGFRDPSTHVLKTVVPYSVDQI 306
           + + W Q  L+    I+ GFRD + +VLKTV  Y+  ++
Sbjct: 253 VFRTWLQCFLVGIPRIIYGFRD-NNNVLKTVEEYTTTEV 290

>Kpol_380.8 s380 (14034..15173) [1140 bp, 379 aa] {ON}
           (14034..15173) [1140 nt, 380 aa]
          Length = 379

 Score = 33.9 bits (76), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 41/84 (48%), Gaps = 10/84 (11%)

Query: 232 ILLQCEMDA-YNPKRQKYTEIKSSVDFNVRNV--------RHLSKLLKIWAQTALLPSTD 282
           ++L  E+DA ++ K +    +K  V+    N         +   K+ K W Q  L+    
Sbjct: 207 LMLGAEVDAIFDFKEEDKDNLKHYVELKTTNAVLTPSDARKFEQKIFKTWIQCFLVGIPR 266

Query: 283 ILVGFRDPSTHVLKTVVPYSVDQI 306
           I+ GFRD +  +LK+V  +S D++
Sbjct: 267 IIYGFRD-NNFILKSVEEFSTDEV 289

>NDAI0I03260 Chr9 (765221..766354) [1134 bp, 377 aa] {ON} Anc_3.570
          Length = 377

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 41/188 (21%), Positives = 73/188 (38%), Gaps = 44/188 (23%)

Query: 144 SPRHHILDILMIPFGNERCRLVFTAHRGLFVITLAPSQRPTGINSPSSATRKICYTGFEL 203
           +P ++ +D+ ++ F  +    +F        +T   +Q P  +N         CYTG++ 
Sbjct: 118 TPEYNPVDLRIVSFDGQ----IFIKD-----VTKQETQDPIDLN---------CYTGYKF 159

Query: 204 ERLLTATSG----------------TERGSFYSFIEAKLEPDITILLQCEMDA-YNPKRQ 246
           E L T +                  +  G  Y  +         ++L  E+D  ++ K +
Sbjct: 160 ESLATLSQPLPLVSRTTLEKRPKKISSNGDEYIAVVKTGVGSSKLVLGAEIDCIFDFKEE 219

Query: 247 K------YTEIKSSVDFNVRNVRHL--SKLLKIWAQTALLPSTDILVGFRDPSTHVLKTV 298
                  Y E+K S         H    KL K W Q  L+    I+ GFRD   + LK+V
Sbjct: 220 NKDNLRHYAELKCSTQIITAADAHRFERKLFKTWLQCFLVGIPRIIYGFRD-ENYTLKSV 278

Query: 299 VPYSVDQI 306
             +S +++
Sbjct: 279 EEFSTEEV 286

>AFR262C Chr6 complement(904657..906984) [2328 bp, 775 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL246C
           (RAI1); Tandem gene duplication in this genome
          Length = 775

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 49/234 (20%), Positives = 91/234 (38%), Gaps = 29/234 (12%)

Query: 97  DLSVESETFHPVTSE---ELHCLHGLLKFIAKWEADNEVNYASRSKFTIVSPRHHILDIL 153
           DLS  +  F    +E   +   LHGLL+ + ++E       + +    I++ R  +  ++
Sbjct: 466 DLSAGARKFQDEQAEAEDDTGSLHGLLQTLMEYERRK----SKKVNADIIAFRGQVKRLI 521

Query: 154 MIPFGNER--CRLVFTAHRGLFVITLAPSQRPTGINSPSSATRKICYTGFELERL----- 206
              FG       +   +  G   I  A  +     +   S      Y+G++ ER+     
Sbjct: 522 HCAFGGHATDVDMYVMSFDGQLFIRAARKKLEFPTSPRESWAYLAYYSGYKFERMALLDR 581

Query: 207 --------LTATSGTE---RGSFYSFIEAKLEPDITILLQCEMDAYNPKRQKYTE-IKSS 254
                   +  + G +    G  Y  +      +  ++L  E+D     R+   + +K  
Sbjct: 582 PVAETPREVLESRGKQVVRNGPQYRTVMRTGVGEHKLVLGAEIDGIIDFREPTGDNLKHY 641

Query: 255 VDFNV--RNVRHLSKLLKIWAQTALLPSTDILVGFRDPSTHVLKTVVPYSVDQI 306
           V+  V  +N     KL   W Q  L+    +++GFRD    VLK+V  +S  +I
Sbjct: 642 VELKVCQKNRNFSEKLFSSWLQCFLVGINRVIIGFRD-EKFVLKSVEEFSTSEI 694

>AFR263C Chr6 complement(907124..908254) [1131 bp, 376 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL246C
           (RAI1); Tandem gene duplication in this genome
          Length = 376

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 49/240 (20%), Positives = 94/240 (39%), Gaps = 35/240 (14%)

Query: 97  DLSVESETFHPVTSE---ELHCLHGLLKFIAKWEADNEVNYASRSKFTIVSPRHHILDIL 153
           DLS  +  F    +E   +   LHGLL+ + ++E       + +    I++ R  +  ++
Sbjct: 58  DLSAGARKFQDEQAEAEDDTGSLHGLLQTLMEYERRK----SKKVNADIIAFRGQVKRLI 113

Query: 154 MIPFGNER--CRLVFTAHRGLFVITLAPSQRPTGINSPSSATRKICYTGFELERL----- 206
              FG       +   +  G   I  A  +     +   S      Y+G++ ER+     
Sbjct: 114 HCAFGGHATDVDMYVMSFDGQLFIRAARKKLEFPTSPRESWAYLAYYSGYKFERMALLDR 173

Query: 207 --------LTATSGTE---RGSFYSFIEAKLEPDITILLQCEMDA-YNPKRQKYTEIKSS 254
                   +  + G +    G  Y  +      +  ++L  E+D  ++ +      +K  
Sbjct: 174 PVAETPREVLESRGKQVVRNGPQYKTVVRTGVGEHKLVLGAEVDGIFDFREPTGDNLKHY 233

Query: 255 VDFNV-RNVRHL-------SKLLKIWAQTALLPSTDILVGFRDPSTHVLKTVVPYSVDQI 306
           V+  V + V+ L        KL  +W Q  L+    +++GFRD    VLK+V  +S  +I
Sbjct: 234 VELKVAKKVQTLKDATNFEQKLFSVWLQCFLVGINRVIIGFRD-EKFVLKSVEEFSTSEI 292

>TDEL0D06380 Chr4 (1146443..1147579) [1137 bp, 378 aa] {ON}
           Anc_3.570 YGL246C
          Length = 378

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 33/61 (54%), Gaps = 3/61 (4%)

Query: 248 YTEIKSSVDFNVR-NVRHLSK-LLKIWAQTALLPSTDILVGFRDPSTHVLKTVVPYSVDQ 305
           Y E+K S   + + + R   K + K W Q  L+    I+ GFRD +  +LKTV  ++ D+
Sbjct: 231 YAELKCSAMVSTQADARKFEKKIFKTWLQCFLVGIPRIIYGFRDDNC-ILKTVEEFAADE 289

Query: 306 I 306
           +
Sbjct: 290 V 290

>Skud_7.21 Chr7 complement(41773..42942) [1170 bp, 389 aa] {ON}
           YGL246C (REAL)
          Length = 389

 Score = 31.2 bits (69), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 3/61 (4%)

Query: 248 YTEIKSSVD-FNVRNVRHLS-KLLKIWAQTALLPSTDILVGFRDPSTHVLKTVVPYSVDQ 305
           Y E+K +    N+ +      KL + W Q  L+    I+ GF+D   +VLKTV  +S ++
Sbjct: 239 YAELKCTQQVMNISDTHKFERKLFRTWLQCFLVGIPRIIYGFKD-DQYVLKTVEEFSTEE 297

Query: 306 I 306
           +
Sbjct: 298 V 298

>Suva_7.15 Chr7 complement(32131..33300) [1170 bp, 389 aa] {ON}
           YGL246C (REAL)
          Length = 389

 Score = 30.8 bits (68), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 32/61 (52%), Gaps = 3/61 (4%)

Query: 248 YTEIKSSVD-FNVRNVRHLS-KLLKIWAQTALLPSTDILVGFRDPSTHVLKTVVPYSVDQ 305
           Y E+K +    NV +      KL + W Q  L+    I+ GF+D   +VLKTV  +S ++
Sbjct: 239 YAELKCTQQVMNVSDTHKFERKLFRTWLQCFLVGIPRIIYGFKD-DHYVLKTVEEFSTEE 297

Query: 306 I 306
           +
Sbjct: 298 V 298

>YGL246C Chr7 complement(37617..38780) [1164 bp, 387 aa] {ON}
           RAI1Nuclear protein with decapping endonuclease activity
           targeted toward mRNAs with unmethylated
           7-methylguanosine cap structures; binds to and
           stabilizes the exoribonuclease Rat1p; required for
           pre-rRNA processing; homologous to human DOM3Z
          Length = 387

 Score = 30.4 bits (67), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 24/40 (60%), Gaps = 1/40 (2%)

Query: 267 KLLKIWAQTALLPSTDILVGFRDPSTHVLKTVVPYSVDQI 306
           KL + W Q  L+    I+ GF+D   +VLKTV  +S +++
Sbjct: 260 KLFRTWLQCFLVGIPRIIYGFKDDH-YVLKTVEEFSTEEV 298

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.135    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 38,630,295
Number of extensions: 1559421
Number of successful extensions: 4171
Number of sequences better than 10.0: 43
Number of HSP's gapped: 4198
Number of HSP's successfully gapped: 44
Length of query: 386
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 275
Effective length of database: 40,753,473
Effective search space: 11207205075
Effective search space used: 11207205075
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)