Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AER403C5.436ON48048024480.0
Ecym_47605.436ON47846214070.0
SAKL0G02574g5.436ON48446911641e-156
KLTH0F16016g5.436ON48446510291e-135
Kwal_55.214185.436ON48446710251e-135
KLLA0E02223g5.436ON4804669671e-126
TDEL0E018905.436ON4744647571e-94
ZYRO0F10076g5.436ON4824667413e-92
Kpol_1062.285.436ON4654723992e-42
TPHA0E017505.436ON4594812451e-21
TBLA0A028105.436ON4815002052e-16
YNL026W (SAM50)2.304ON4841571882e-14
KLLA0E08735g2.304ON4922391848e-14
Kpol_1003.512.304ON4781381831e-13
Ecym_33422.304ON4952021821e-13
KNAG0H019402.304ON4561611802e-13
Smik_14.3042.304ON5001591767e-13
KLTH0G10824g2.304ON4952021731e-12
Suva_14.3192.304ON4841591642e-11
AGR392C2.304ON4952691614e-11
Skud_14.3022.304ON4841571615e-11
TPHA0G008302.304ON4781831606e-11
SAKL0E07194g2.304ON4952001606e-11
CAGL0M06853g2.304ON4661601571e-10
KAFR0H032502.304ON4622031571e-10
Kwal_27.114562.304ON4962011534e-10
TDEL0G023402.304ON4942071527e-10
NCAS0G038602.304ON4611601454e-09
NCAS0G037502.304ON4611601454e-09
NDAI0G007102.304ON4912081455e-09
ZYRO0A02310g2.304ON4921991411e-08
TBLA0B060602.304ON5031651374e-08
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AER403C
         (480 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AER403C Chr5 complement(1410760..1412202) [1443 bp, 480 aa] {ON}...   947   0.0  
Ecym_4760 Chr4 (1477953..1479389) [1437 bp, 478 aa] {ON} similar...   546   0.0  
SAKL0G02574g Chr7 complement(212991..214445) [1455 bp, 484 aa] {...   452   e-156
KLTH0F16016g Chr6 (1299984..1301438) [1455 bp, 484 aa] {ON} cons...   400   e-135
Kwal_55.21418 s55 (828257..829711) [1455 bp, 484 aa] {ON} YNL026...   399   e-135
KLLA0E02223g Chr5 complement(208267..209709) [1443 bp, 480 aa] {...   377   e-126
TDEL0E01890 Chr5 (357689..359113) [1425 bp, 474 aa] {ON} Anc_5.436    296   1e-94
ZYRO0F10076g Chr6 complement(817036..818484) [1449 bp, 482 aa] {...   290   3e-92
Kpol_1062.28 s1062 (62316..63713) [1398 bp, 465 aa] {ON} (62316....   158   2e-42
TPHA0E01750 Chr5 (353257..354636) [1380 bp, 459 aa] {ON} Anc_5.436     99   1e-21
TBLA0A02810 Chr1 (676946..678391) [1446 bp, 481 aa] {ON} Anc_5.436     84   2e-16
YNL026W Chr14 (581920..583374) [1455 bp, 484 aa] {ON}  SAM50Esse...    77   2e-14
KLLA0E08735g Chr5 (779165..780643) [1479 bp, 492 aa] {ON} simila...    75   8e-14
Kpol_1003.51 s1003 (117089..118525) [1437 bp, 478 aa] {ON} (1170...    75   1e-13
Ecym_3342 Chr3 (649920..651407) [1488 bp, 495 aa] {ON} similar t...    75   1e-13
KNAG0H01940 Chr8 (342815..344185) [1371 bp, 456 aa] {ON} Anc_2.3...    74   2e-13
Smik_14.304 Chr14 (544403..545905) [1503 bp, 500 aa] {ON} YNL026...    72   7e-13
KLTH0G10824g Chr7 (910133..911620) [1488 bp, 495 aa] {ON} simila...    71   1e-12
Suva_14.319 Chr14 (564528..565982) [1455 bp, 484 aa] {ON} YNL026...    68   2e-11
AGR392C Chr7 complement(1450059..1451546) [1488 bp, 495 aa] {ON}...    67   4e-11
Skud_14.302 Chr14 (552625..554079) [1455 bp, 484 aa] {ON} YNL026...    67   5e-11
TPHA0G00830 Chr7 (155259..156695) [1437 bp, 478 aa] {ON} Anc_2.3...    66   6e-11
SAKL0E07194g Chr5 complement(590515..592002) [1488 bp, 495 aa] {...    66   6e-11
CAGL0M06853g Chr13 (697615..699015) [1401 bp, 466 aa] {ON} simil...    65   1e-10
KAFR0H03250 Chr8 (621316..622704) [1389 bp, 462 aa] {ON} Anc_2.3...    65   1e-10
Kwal_27.11456 s27 complement(809084..810574) [1491 bp, 496 aa] {...    64   4e-10
TDEL0G02340 Chr7 (451314..452798) [1485 bp, 494 aa] {ON} Anc_2.3...    63   7e-10
NCAS0G03860 Chr7 complement(715064..716449) [1386 bp, 461 aa] {O...    60   4e-09
NCAS0G03750 Chr7 (692032..693417) [1386 bp, 461 aa] {ON}               60   4e-09
NDAI0G00710 Chr7 complement(153261..154736) [1476 bp, 491 aa] {O...    60   5e-09
ZYRO0A02310g Chr1 (183977..185455) [1479 bp, 492 aa] {ON} simila...    59   1e-08
TBLA0B06060 Chr2 (1427723..1429234) [1512 bp, 503 aa] {ON} Anc_2...    57   4e-08

>AER403C Chr5 complement(1410760..1412202) [1443 bp, 480 aa] {ON}
           NOHBY530; No homolog in Saccharomyces cerevisiae'
          Length = 480

 Score =  947 bits (2448), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/480 (96%), Positives = 465/480 (96%)

Query: 1   MMDPMANLPLSTYPPTDQLGKSQTKPLYITSVQVEDGKDYPLSDGVLKSILSPVLAKPLQ 60
           MMDPMANLPLSTYPPTDQLGKSQTKPLYITSVQVEDGKDYPLSDGVLKSILSPVLAKPLQ
Sbjct: 1   MMDPMANLPLSTYPPTDQLGKSQTKPLYITSVQVEDGKDYPLSDGVLKSILSPVLAKPLQ 60

Query: 61  SLSSTLASLETIEKNLMYTGLYQDISITLDHDKSRLVNQFLSNIAPKEYDIEXXXXXXXX 120
           SLSSTLASLETIEKNLMYTGLYQDISITLDHDKSRLVNQFLSNIAPKEYDIE        
Sbjct: 61  SLSSTLASLETIEKNLMYTGLYQDISITLDHDKSRLVNQFLSNIAPKEYDIELPLPVKAL 120

Query: 121 XXXXXXXYQRLSLVTTTRDSYASAGGRLASVNKFGLAEVFSLQADVNYTPFSGKLDDKLV 180
                  YQRLSLVTTTRDSYASAGGRLASVNKFGLAEVFSLQADVNYTPFSGKLDDKLV
Sbjct: 121 VKVLPAPYQRLSLVTTTRDSYASAGGRLASVNKFGLAEVFSLQADVNYTPFSGKLDDKLV 180

Query: 181 DLRCLVPFQNNPSIKAVFDVNYAMLDLYNQPWINEDDQHKQRQIGFNIGIQKQWLSKRLY 240
           DLRCLVPFQNNPSIKAVFDVNYAMLDLYNQPWINEDDQHKQRQIGFNIGIQKQWLSKRLY
Sbjct: 181 DLRCLVPFQNNPSIKAVFDVNYAMLDLYNQPWINEDDQHKQRQIGFNIGIQKQWLSKRLY 240

Query: 241 SPTAFAGVSIVGRNLHGIQLDRASYHVSAWADSSLKTSFVTQFLHSNRKLIGTFPVQGMK 300
           SPTAFAGVSIVGRNLHGIQLDRASYHVSAWADSSLKTSFVTQFLHSNRKLIGTFPVQGMK
Sbjct: 241 SPTAFAGVSIVGRNLHGIQLDRASYHVSAWADSSLKTSFVTQFLHSNRKLIGTFPVQGMK 300

Query: 301 FNAVNELVLSQTVAGTPQEETFNKFLVTYEKHVSFLRNLVTTSLDLSCGSLISTKQAAKP 360
           FNAVNELVLSQTVAGTPQEETFNKFLVTYEKHVSFLRNLVTTSLDLSCGSLISTKQAAKP
Sbjct: 301 FNAVNELVLSQTVAGTPQEETFNKFLVTYEKHVSFLRNLVTTSLDLSCGSLISTKQAAKP 360

Query: 361 MVHIMDQFYLGGLSSLKGFHRNSVGSRGGDLFYRLSLKSSVHLPGTPLDSPLRLQAFFNA 420
           MVHIMDQFYLGGLSSLKGFHRNSVGSRGGDLFYRLSLKSSVHLPGTPLDSPLRLQAFFNA
Sbjct: 361 MVHIMDQFYLGGLSSLKGFHRNSVGSRGGDLFYRLSLKSSVHLPGTPLDSPLRLQAFFNA 420

Query: 421 GDVFHFRRQIPEDVAAATGLSLVYESPIANLDLTYALPLTSRPVDLAKPGFSFGVAIAYR 480
           GDVFHFRRQIPEDVAAATGLSLVYESPIANLDLTYALPLTSRPVDLAKPGFSFGVAIAYR
Sbjct: 421 GDVFHFRRQIPEDVAAATGLSLVYESPIANLDLTYALPLTSRPVDLAKPGFSFGVAIAYR 480

>Ecym_4760 Chr4 (1477953..1479389) [1437 bp, 478 aa] {ON} similar to
           Ashbya gossypii AER403C
          Length = 478

 Score =  546 bits (1407), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/462 (58%), Positives = 343/462 (74%), Gaps = 2/462 (0%)

Query: 19  LGKSQTKPLYITSVQVEDGKDYPLSDGVLKSILSPVLAKPLQSLSSTLASLETIEKNLMY 78
           L K QTKPL+ITSV V D K  PLS+ + +SIL PVL++P Q+L STL++L TIEK LMY
Sbjct: 17  LAKVQTKPLFITSVYVNDVKLSPLSNSIFESILKPVLSQPFQNLRSTLSALGTIEKKLMY 76

Query: 79  TGLYQDISITLDHDKSRLVNQFLSNIAPKEYDIEXXXXXXXXXXXXXXXYQRLSLVTTTR 138
           TGLY D++ITLD DKS+ ++ +L  +APKEY +E               YQ LSLVTTTR
Sbjct: 77  TGLYDDVNITLDQDKSQYISDYLEEVAPKEYGLELPVPIKAQIQLVPAFYQPLSLVTTTR 136

Query: 139 DSYASAGGRLASVNKFGLAEVFSLQADVNYTPFSGKLDDKLVDLRCLVPFQNNPSIKAVF 198
           DSYA+AG  L+S+NKF  AE   LQ ++N TPFSGK+D+KL+ L+CLVP Q  PS+KAVF
Sbjct: 137 DSYAAAGIHLSSLNKFQQAETIILQGELNCTPFSGKIDEKLLSLKCLVPLQKLPSMKAVF 196

Query: 199 DVNYAMLDLYNQPWINEDDQHKQRQIGFNIGIQKQWLSK-RLYSPTAFAGVSIVGRNLHG 257
           D+NYA++DL+ Q W+ E DQHKQ QIGFNIGIQ+Q +S  +   P  ++G+SI+GRNL  
Sbjct: 197 DINYALVDLFKQSWLPESDQHKQNQIGFNIGIQEQQISSSKFRGPIIYSGISILGRNLLD 256

Query: 258 IQLDRASYHVSAWADSSLKTSFVTQFLHSNRKLIGTFPVQGMKFNAVNELVLSQTVAGTP 317
           ++    S  +++W +SS K S+V Q L +N+K +GT P+ G KFN  NE VL QTVAG  
Sbjct: 257 LKKTEVSSSINSWVESS-KVSYVFQILQNNKKFLGTLPISGWKFNLFNEAVLGQTVAGEK 315

Query: 318 QEETFNKFLVTYEKHVSFLRNLVTTSLDLSCGSLISTKQAAKPMVHIMDQFYLGGLSSLK 377
           QE  F K   +YE + SFLRN + TSLDLS G++   K  ++  VHIMDQFYLGGLSSLK
Sbjct: 316 QESGFGKVAFSYEGYSSFLRNHIITSLDLSFGTIFRYKSGSELKVHIMDQFYLGGLSSLK 375

Query: 378 GFHRNSVGSRGGDLFYRLSLKSSVHLPGTPLDSPLRLQAFFNAGDVFHFRRQIPEDVAAA 437
           GF RNSVG+RGG+ FY+++ KSS H+PGTPL SPLRLQAF NAGDVF+  R IPED+A A
Sbjct: 376 GFQRNSVGTRGGNSFYKVAFKSSFHIPGTPLASPLRLQAFVNAGDVFNSERGIPEDLATA 435

Query: 438 TGLSLVYESPIANLDLTYALPLTSRPVDLAKPGFSFGVAIAY 479
           TG+SLVY+S +A+LDLTYALPL+ R  D+AKPGFSFGV+IAY
Sbjct: 436 TGISLVYQSHLASLDLTYALPLSLRAQDVAKPGFSFGVSIAY 477

>SAKL0G02574g Chr7 complement(212991..214445) [1455 bp, 484 aa] {ON}
           conserved hypothetical protein
          Length = 484

 Score =  452 bits (1164), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 232/469 (49%), Positives = 311/469 (66%), Gaps = 8/469 (1%)

Query: 17  DQLGKSQTKPLYITSVQVE-DGKDYPLSDGVLKSILSPVLAKPLQSLSSTLASLETIEKN 75
           D L +S TKPLYITSV V+ D +  PLSD + KSIL PVL++PLQ++ + + +   I+K 
Sbjct: 17  DALSQSATKPLYITSVSVDGDNQFTPLSDALYKSILDPVLSQPLQNIDNAMNNFSEIKKK 76

Query: 76  LMYTGLYQDISITLDHDKSRLVNQFLSNIAPKEYDIEXXXXXXXXXXXXXXXYQRLSLVT 135
           L +TGL+QD+ ITLD+D S     FL     KEY +E               Y +L L +
Sbjct: 77  LFFTGLFQDVKITLDNDVSGASFDFLKENVSKEYGVELPLPTVAKIDLIPALYNKLCLTS 136

Query: 136 TTRDSYASAGGRLASVNKFGLAEVFSLQADVNYTPFSGKLDDKLVDLRCLVPFQNNPSIK 195
            T D  +S GGR++ +N  G AE   LQ+D+NY PFSGKL++K +D + L+P Q NPSIK
Sbjct: 137 GTSDMLSSMGGRISFINALGKAETLILQSDINYVPFSGKLNEKSLDGKFLLPLQKNPSIK 196

Query: 196 AVFDVNYAMLDLYNQPWINEDDQHKQRQIGFNIGIQKQWLSKRL-YSPTAFAGVSIVGRN 254
           AV DVNYA +DL+ QP++   DQHKQ+Q  FNIG+QK WL  +   +P  F GVS V RN
Sbjct: 197 AVIDVNYAGIDLFKQPFLAAVDQHKQQQYSFNIGVQKNWLCNKTGNAPILFNGVSTVIRN 256

Query: 255 LHGIQ-LDRASYHVSAWADSSLKTSFVTQFLHSNRKLIGTFPVQGMKFNAVNELVLSQTV 313
           L+G   +   S  +  +  S +K+SFV+Q  +  RK +G FP+ G +FN VNE VL+Q  
Sbjct: 257 LYGFNDIANVSESIKQFNGSFIKSSFVSQITNDTRKFVGLFPISGSRFNLVNEYVLTQAF 316

Query: 314 AGT---PQEETFNKFLVTYEKHVSFLRNLVTTSLDLSCGSLISTKQAAKPMVHIMDQFYL 370
           +     PQE  F+K  ++YE+H S+L N +T+SLD SCG++I T   A  +VH MD+FYL
Sbjct: 317 SKNKTVPQENNFDKACLSYEQHNSYLNNRITSSLDFSCGAIIPTGSKA-AIVHTMDRFYL 375

Query: 371 GGLSSLKGFHRNSVGSRGGDLFYRLSLKSSVHLPGTPLDSPLRLQAFFNAGDVFHFRRQI 430
           GGL SLKGF  N+VGS GG+ FYRL + SS  LP    +SPLR Q FFNAGD  + +R++
Sbjct: 376 GGLKSLKGFELNTVGSSGGNFFYRLGITSSYRLPNATANSPLRFQVFFNAGDSLN-KREL 434

Query: 431 PEDVAAATGLSLVYESPIANLDLTYALPLTSRPVDLAKPGFSFGVAIAY 479
           P+  AAATG SLVY++ +AN+DLTYALPLT R  D+AKPGFSFGV +++
Sbjct: 435 PQSFAAATGFSLVYKTALANMDLTYALPLTEREQDVAKPGFSFGVELSF 483

>KLTH0F16016g Chr6 (1299984..1301438) [1455 bp, 484 aa] {ON}
           conserved hypothetical protein
          Length = 484

 Score =  400 bits (1029), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 212/465 (45%), Positives = 298/465 (64%), Gaps = 10/465 (2%)

Query: 21  KSQTKPLYITSVQVE-DGKDYPLSDGVLKSILSPVLAKPLQSLSSTLASLETIEKNLMYT 79
           +S  KPLY TS+ V+ D    PLS+ V  S+L PVL +PLQ+L  +L++   I+K L+YT
Sbjct: 21  RSSLKPLYFTSISVDGDNGSSPLSNTVYNSVLEPVLVQPLQTLDQSLSNFAEIKKKLIYT 80

Query: 80  GLYQDISITLDHDKSRLVNQFLSNIAPKEYDIEXXXXXXXXXXXXXXXYQRLSLVTTTRD 139
           GL++D+ I+LD++ S    Q L     K Y +E                 R SL + T D
Sbjct: 81  GLFRDVKISLDNEVSSDELQSLPKDLVKGYALEMPIPTIARIRLTPINLNRASLTSFTGD 140

Query: 140 SYASAGGRLASVNKFGLAEVFSLQADVNYTPFSGKLDDKLVDLRCLVPFQNNPSIKAVFD 199
           + +S GGR + +N FG AEV +LQ  + Y PF    D+K+++ + L+P Q NPS+KAVFD
Sbjct: 141 TLSSMGGRYSVINNFGKAEVLTLQGKLAYQPFQSTFDEKVLEAKLLIPLQKNPSVKAVFD 200

Query: 200 VNYAMLDLYNQPWINEDDQHKQRQIGFNIGIQKQWLS-KRLYSPTAFAGVSIVGRNLHGI 258
            NYA +DL  QP+I + DQH+Q+Q+  N+G+QKQW++ K   +P  + G S+V RNL  +
Sbjct: 201 ANYANIDLNGQPFIEKRDQHRQKQVSVNVGVQKQWVNIKTGLAPVLYNGFSVVARNLDEV 260

Query: 259 QLDRASYHVSAWADSSLKTSFVTQFLHSNRKLIGTFPVQGMKFNAVNELVLSQTV---AG 315
           +   AS  +  +    +K SFV+Q L  NRK  G FP  G+KF+  NE VLS++    AG
Sbjct: 261 R-KEASEAIRQFDAPFVKNSFVSQLLVDNRKFFGLFPASGLKFSINNEYVLSESFDKKAG 319

Query: 316 TP--QEETFNKFLVTYEKHVSFLRNLVTTSLDLSCGSLISTKQAAKPMVHIMDQFYLGGL 373
           T   Q E F+K  V +E H +F  N +  SL+L+CG + S  +++  +VH +D+FYLGG+
Sbjct: 320 TAVSQNEGFDKLAVDFEAHRAFFGNKIINSLELACGGIFSAGKSSS-LVHHIDKFYLGGM 378

Query: 374 SSLKGFHRNSVGSRGGDLFYRLSLKSSVHLPGTPLDSPLRLQAFFNAGDVFHFRRQIPED 433
           SSLKGF RNSVG  GG LFY+L L SS  LP TP +SPLRLQ FFNAGDV   ++     
Sbjct: 379 SSLKGFERNSVGQHGGKLFYKLGLASSFKLPNTPANSPLRLQFFFNAGDV-QNKKPTQFS 437

Query: 434 VAAATGLSLVYESPIANLDLTYALPLTSRPVDLAKPGFSFGVAIA 478
            AA++G+SL+Y+S +AN+DLTYA PLT+R  D+ KPGFSFGV+++
Sbjct: 438 CAASSGVSLLYKSSLANMDLTYAFPLTNRGQDIQKPGFSFGVSLS 482

>Kwal_55.21418 s55 (828257..829711) [1455 bp, 484 aa] {ON} YNL026W -
           Essential protein with similarity to S. pombe
           hypothetical protein E241976 [contig 130] FULL
          Length = 484

 Score =  399 bits (1025), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 210/467 (44%), Positives = 296/467 (63%), Gaps = 10/467 (2%)

Query: 19  LGKSQTKPLYITSVQVEDGKDY-PLSDGVLKSILSPVLAKPLQSLSSTLASLETIEKNLM 77
           L KS  KPLY TS+ V+  K   PLSD    S+L PVL++PLQ+L  +LA+   I+K L+
Sbjct: 19  LQKSSLKPLYFTSISVDGEKKLRPLSDATYNSVLEPVLSQPLQTLEQSLANFTEIKKKLI 78

Query: 78  YTGLYQDISITLDHDKSRLVNQFLSNIAPKEYDIEXXXXXXXXXXXXXXXYQRLSLVTTT 137
           YTG++ D+ I+LD D S    + L   A KE  +E               + +L   ++T
Sbjct: 79  YTGMFSDVKISLDKDTSGNGLKDLHQDAIKELSLESPVPTIARILLKPLEFNKLCFTSST 138

Query: 138 RDSYASAGGRLASVNKFGLAEVFSLQADVNYTPFSGKLDDKLVDLRCLVPFQNNPSIKAV 197
            D+  S G R + VN  G AE+ +LQ++V Y PF     +K +D + +VP Q NPS+KAV
Sbjct: 139 NDTVPSLGARYSFVNALGKAEIVTLQSEVKYIPFKNTALEKTLDAKVVVPLQKNPSVKAV 198

Query: 198 FDVNYAMLDLYNQPWINEDDQHKQRQIGFNIGIQKQWLSKRL-YSPTAFAGVSIVGRNLH 256
           FD NYA +DL+ QP++ + DQH+QRQ+  N+G+QKQWL+ ++  SP  + G S+V RNLH
Sbjct: 199 FDTNYANIDLHGQPFVEKKDQHRQRQVSVNVGVQKQWLTSKMNLSPVFYNGFSVVARNLH 258

Query: 257 GIQLDRASYHVSAWADSSLKTSFVTQFLHSNRKLIGTFPVQGMKFNAVNELVLSQTV--- 313
            +  + AS  +  +    LK SFV+Q +  NRK  G FP  G+K    NE VLSQ     
Sbjct: 259 DVP-NEASGAIRQFNAPFLKNSFVSQLVIDNRKFFGLFPASGVKIALNNEYVLSQRFEKD 317

Query: 314 AGTPQ--EETFNKFLVTYEKHVSFLRNLVTTSLDLSCGSLISTKQAAKPMVHIMDQFYLG 371
           +G     +E FNK  ++ E   SF +N +  SLD++CG ++ T  +A  +VH MD+FYLG
Sbjct: 318 SGNDMALDEGFNKCALSLEAQRSFFKNKIINSLDIACGGILPTGNSAS-LVHHMDKFYLG 376

Query: 372 GLSSLKGFHRNSVGSRGGDLFYRLSLKSSVHLPGTPLDSPLRLQAFFNAGDVFHFRRQIP 431
           GL+SLKGF RN+VG  GG+ FY+L + SS  LP TP  SPLRLQ F NAG+V +  +   
Sbjct: 377 GLASLKGFERNAVGQHGGNFFYKLHVASSFKLPRTPQQSPLRLQFFLNAGEVSN-EKPTS 435

Query: 432 EDVAAATGLSLVYESPIANLDLTYALPLTSRPVDLAKPGFSFGVAIA 478
              AA++G+SL+Y+SP+AN+DLTYALPL++R  D+AKPGFSFGV+++
Sbjct: 436 VSCAASSGISLLYKSPLANMDLTYALPLSNRAQDVAKPGFSFGVSLS 482

>KLLA0E02223g Chr5 complement(208267..209709) [1443 bp, 480 aa] {ON}
           conserved hypothetical protein
          Length = 480

 Score =  377 bits (967), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 202/466 (43%), Positives = 282/466 (60%), Gaps = 8/466 (1%)

Query: 22  SQTKPLYITSVQVE-DGKDYPLSDGVLKSILSPVLAKPLQSLSSTLASLETIEKNLMYTG 80
           S  K +Y T V V+ D +  P+SD + +SI + +LA PLQ + S   S E I+K L++TG
Sbjct: 14  SCNKTVYFTKVTVDGDNQLSPVSDDLYQSIFNRILADPLQKVDSAFKSCEDIQKKLLFTG 73

Query: 81  LYQDISITLDHDKSRLVNQFLSNIAPKEYDIEXXXXXXXXXXXXXXXYQRLSLVTTTRDS 140
           L+Q   ITLDHD     ++ L+   PK  DIE               Y + SL TTTRD+
Sbjct: 74  LFQSAEITLDHDVDVRSSRLLTENVPKTLDIELPIPTIAQVKLVPAVYNKGSLSTTTRDT 133

Query: 141 YASAGGRLASVNKFGLAEVFSLQADVNYTPFSGKLDDKLVDLRCLVPFQNNPSIKAVFDV 200
           Y+SAG RL  +NKFG AE  SLQ DVNYTPF+GKLD++L+  +  +PF  NPS+KA    
Sbjct: 134 YSSAGARLFWINKFGNAETISLQGDVNYTPFNGKLDERLLGAKLALPFPKNPSVKAAVYA 193

Query: 201 NYAMLDLYNQPWINEDDQHKQRQIGFNIGIQKQWLSKRLYSP-TAFAGVSIVGRNLHGIQ 259
           N+  LDL+ QP+I E D+HKQ Q G + GI+K +L     S    F G+++V RN++G  
Sbjct: 194 NHTYLDLFKQPFIGESDEHKQSQFGLSAGIEKNFLYNNNKSVIETFNGMTMVARNIYGFA 253

Query: 260 LDRA-SYHVSAWADSSLKTSFVTQFLHSNRKLIGTFPVQGMKFNAVNELVLSQTVAGT-- 316
              A S  +  +  +  K+SF+++    +R+    FPV G +    +E +LSQ    +  
Sbjct: 254 DALAVSDSIKQFQGTFTKSSFISELKSDSREFYNRFPVSGKRVQLFHEYILSQGFTNSKP 313

Query: 317 -PQEETFNKFLVTYEKHVSFLRNLVTTSLDLSCGSLISTKQAAKPMVHIMDQFYLGGLSS 375
            P E  F+K  V+YE H  F    + TSL L  G++   K  +KP+VH++D FYLGG  S
Sbjct: 314 LPHESNFDKLSVSYETHRPFFNTKLVTSLHLDAGAIFPWKNKSKPLVHLLDSFYLGGPKS 373

Query: 376 LKGFHRNSVGSRGGDLFYRLSLKSSVHLPGTPLDSPLRLQAFFNAGDVFHFRR--QIPED 433
           LKGF RN VG+RGG  FY+L + SS  LP TP+DSPLRLQ+F N GDV +  R   +   
Sbjct: 374 LKGFERNCVGNRGGLYFYKLGISSSFKLPNTPIDSPLRLQSFINFGDVLNNWRDANLERK 433

Query: 434 VAAATGLSLVYESPIANLDLTYALPLTSRPVDLAKPGFSFGVAIAY 479
            A +TG+SL+Y +  ANLDL+Y+LPL  R  D+AKPG +FG+ +++
Sbjct: 434 PALSTGISLIYSASFANLDLSYSLPLRVRDYDIAKPGLTFGLDLSF 479

>TDEL0E01890 Chr5 (357689..359113) [1425 bp, 474 aa] {ON} Anc_5.436
          Length = 474

 Score =  296 bits (757), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 174/464 (37%), Positives = 259/464 (55%), Gaps = 9/464 (1%)

Query: 22  SQTKPLYITSVQVE-DGKDYPLSDGVLKSILSPVLAKPLQSLSSTLASLETIEKNLMYTG 80
           S+TKPLYI+ + ++ D    PLS  V K+IL   L+ P+Q++ S+L +   I + L+ TG
Sbjct: 13  SETKPLYISKISIDGDNSLSPLSGSVYKAILDQALSHPVQNVGSSLYTFGDIRRKLLCTG 72

Query: 81  LYQDISITLDHDKSRLVNQFLSNIAPKEYDIEXXXXXXXXXXXX-XXXYQRLSLVTTTRD 139
           LYQD+ ITL+ D     ++F +  +PKEY IE                Y   +  T+  D
Sbjct: 73  LYQDVRITLEQDHDAKSSEFANKDSPKEYGIESPLATHARIILKPSGVYNSTAGTTSLVD 132

Query: 140 SYASAGGRLASVNKFGLAEVFSLQADVNYTPFSGKLDDKLVDLRCLVPFQNNPSIKAVFD 199
             AS     + +N  G A+  S    + Y P + K + K +     +P   NPS++A  +
Sbjct: 133 DSASVAISRSYMNLLGRADSESFHLGLKYNPQTSKWEGKSLKGSFSLPLAKNPSVRASLN 192

Query: 200 VNYAMLDLYNQPWINEDDQHKQRQIGFNIGIQKQWLSKRLYS-PTAFAGVSIVGRNLHGI 258
            +   ++  ++ +I E D H + Q   + G+QK+W+ ++  S P  +AG++   R++ G+
Sbjct: 193 FDGVKVNQRSKSYIAETDDHDEMQYSLSTGLQKRWILEQTNSVPNFYAGITSTNRDISGL 252

Query: 259 QLDRASYHVSAWADSSLKTSFVTQFLHSNRKLIGTFPVQGMKFNAVNELVLSQTVAGT-- 316
              +AS   S ++    K S  ++F +  RK  GTFPV G +    NE V+SQT   +  
Sbjct: 253 GA-QASKVFSNYSGKFNKVSLESKFHNDTRKYYGTFPVSGYELLVNNEYVISQTKGSSQV 311

Query: 317 -PQEETFNKFLVTYEKHVSFLRNLVTTSLDLSCGSLISTKQAAKPMVHIMDQFYLGGLSS 375
            PQE+ F+KF  + + H S  +N +T SLDL  G +I   +  K  VH MD++YLGGL S
Sbjct: 312 LPQEDNFSKFDFSLQHHTSHWKNKLTNSLDLQFGGIIPFSE--KTEVHPMDKWYLGGLDS 369

Query: 376 LKGFHRNSVGSRGGDLFYRLSLKSSVHLPGTPLDSPLRLQAFFNAGDVFHFRRQIPEDVA 435
           +KGF  N VG  G   FY+++L +S  L  TP+DSPLRL  F N G+ F+         A
Sbjct: 370 MKGFQTNGVGFGGNSFFYKVALTASQKLINTPIDSPLRLNFFMNLGNAFNDLNTATNSYA 429

Query: 436 AATGLSLVYESPIANLDLTYALPLTSRPVDLAKPGFSFGVAIAY 479
           AATG+SL Y++P AN+DLTYA PLTSR  D+ KPGFSFGV  +Y
Sbjct: 430 AATGISLTYKTPQANMDLTYAHPLTSRSQDITKPGFSFGVTFSY 473

>ZYRO0F10076g Chr6 complement(817036..818484) [1449 bp, 482 aa] {ON}
           similar to gnl|GLV|KLLA0E02222g Kluyveromyces lactis
           KLLA0E02222g and some similarites with YNL026W
           uniprot|P53969 Saccharomyces cerevisiae YNL026W SAM50
           Essential component of the Sorting and Assembly
           Machinery (SAM complex) of the mitochondrial outer
           membrane the authentic non-tagged protein was localized
           to the mitochondria
          Length = 482

 Score =  290 bits (741), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 176/466 (37%), Positives = 250/466 (53%), Gaps = 7/466 (1%)

Query: 19  LGKSQTKPLYITSVQVE-DGKDYPLSDGVLKSILSPVLAKPLQSLSSTLASLETIEKNLM 77
           L  ++TKPLYI+ + ++ D    PLSD + ++I    L +PLQS+ +++   E I K L+
Sbjct: 18  LHDNETKPLYISKIVLDGDNGSSPLSDSLCRAIFGEALNQPLQSVENSINIFEDIRKKLL 77

Query: 78  YTGLYQDISITLDHDKSRLVNQFLSNIAPKEYDIEXXXXXXXXXXXXXXXYQRLSLVTTT 137
           +TGL+ D++ITLD D        L+    + Y IE               Y  +S  TT 
Sbjct: 78  FTGLFSDVNITLDKDPDTTSLSQLNKEISESYGIETPLSTQAKVLLKRPDYNTISGTTTL 137

Query: 138 RDSYASAGGRLASVNKFGLAEVFSLQADVNYTPFSGKLDDKLVDLRCLVPFQNNPSIKAV 197
            D   S  G     N  G A+  +L+   N+ P + + D K       +P    PS++A+
Sbjct: 138 SDDNISLAGSKTWKNLLGQADAENLRLGFNWNPVTSQWDGKDARFSFSLPLVKVPSVRAI 197

Query: 198 FDVNYAMLDLYNQPWINEDDQHKQRQIGFNIGIQKQWLSKRLYS-PTAFAGVSIVGRNLH 256
            +       L ++P++  +D+H Q+Q     G QK+W+     S P  + GVS+V RNL+
Sbjct: 198 VEAEGIQRSLCSKPFVAPEDEHVQQQYAVGAGFQKRWICNISKSVPLLYTGVSVVRRNLN 257

Query: 257 GIQLDRASYHVSAWADSSLKTSFVTQFLHSNRKLIGTFPVQGMKFNAVNELVLSQTVAGT 316
             +   AS   + +     KTSFVT F H  R+ IG FP+ G +F   NE V+SQ+   +
Sbjct: 258 EFK-PTASELYAPFKGPFDKTSFVTSFTHDTRRFIGNFPLSGCQFQLNNEYVISQSQGSS 316

Query: 317 PQ---EETFNKFLVTYEKHVSFLRNLVTTSLDLSCGSLISTKQAAKPMVHIMDQFYLGGL 373
            Q   +  FNK     E H S  ++ +T S  L  G +      A+  VH +D+F LGGL
Sbjct: 317 KQLNHDNNFNKTAFHLEHHASHWKDKITRSFQLQGGGIYPLGSEAQ-TVHPLDRFQLGGL 375

Query: 374 SSLKGFHRNSVGSRGGDLFYRLSLKSSVHLPGTPLDSPLRLQAFFNAGDVFHFRRQIPED 433
           +SLKGFH N VG+ G + FY+L L  S  L  TP  SPLRLQ FFN G+     + I   
Sbjct: 376 NSLKGFHLNGVGTGGQNFFYKLGLSISHKLINTPTKSPLRLQYFFNLGNASSDYKTIFNS 435

Query: 434 VAAATGLSLVYESPIANLDLTYALPLTSRPVDLAKPGFSFGVAIAY 479
            AAATGLSLVY++P A LDLTYA PLTSRP DL+KPG S GV++ +
Sbjct: 436 YAAATGLSLVYKTPQALLDLTYAHPLTSRPQDLSKPGLSLGVSLTF 481

>Kpol_1062.28 s1062 (62316..63713) [1398 bp, 465 aa] {ON}
           (62316..63713) [1398 nt, 466 aa]
          Length = 465

 Score =  158 bits (399), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 138/472 (29%), Positives = 215/472 (45%), Gaps = 31/472 (6%)

Query: 17  DQLGKSQTKPLYITSVQVE-DGKDYPLSDGVLKSILSPVLAKPLQSLSSTLASLETIEKN 75
           + +  S+TKPLYI+ V VE D  D+PLS   L+++L  V++ P+Q++ + L S   I++N
Sbjct: 15  ENISSSRTKPLYISQVSVENDSSDHPLSSSFLQNVLENVVSNPIQNVDTALGSFIDIKRN 74

Query: 76  LMYTGLYQDISITLDHDK-SRLVNQFLSNIAPKEYDIEXXXXXXXXXXXXXXXYQRLSLV 134
           L++TGLY D+ +TL  DK   L+N  L  +  K                       L   
Sbjct: 75  LLFTGLYNDVDVTLGADKGGSLLNLSLKMVTDKIGIESIVPTSATIRLKPNDLVTNLQTT 134

Query: 135 TTTRDSYASAGGRLASVNKFGLAEVFSLQADVNYTPFSGKLDDKLVDLRCLVPFQNNPSI 194
            TT  +  S        N  G+A+  ++     Y   S     K      ++PF   PS+
Sbjct: 135 FTTTSNDCSVNFHKLWPNFLGIADREAIDFGAKYNLQSTSWIQKYFKGEFILPFTKVPSL 194

Query: 195 KAVFDVNYAMLDLYNQPWINEDD-QHKQR-QIGFNIGIQKQWLSKRLYS-PTAFAGVSIV 251
           + V  V+           ++ED   H QR    +  GIQK WL   L + P  ++G+SIV
Sbjct: 195 RTVLSVD-----------VSEDKVSHLQRLNCNYKAGIQKLWLKDDLNTFPVFYSGLSIV 243

Query: 252 GRN--LHG-IQLDRASYHVSAWADSSLKTSFVTQFLHSNRKLIGTFPVQGMKFNAVNELV 308
                 +G I +D  S   +     S ++ ++T F   + K +G+FP  G   N  NE V
Sbjct: 244 NNKPIFNGEIPIDVPSPEQTP----SYQSGWLTTFSKDSTKWLGSFPNSGECLNLKNEYV 299

Query: 309 LSQTVA-GTPQEETFNKFLVTYEKHVSFLRNLVTTSLDLSCGSLISTKQAAKPMVHIMDQ 367
           LSQ  +   P     N+F   +EK+VS L + V T++ ++ G      ++ +        
Sbjct: 300 LSQLDSDNKPINTNINRFEANFEKYVSILNSRVITTVLMNGGFQFPIDESTRST------ 353

Query: 368 FYLGGLSSLKGFHRNSVGSRGGDLFYRLSLKSSVHLPGTPLDSPLRLQAFFNAGDVFHFR 427
            ++G     +      +     D+ ++    SS  LP T LDSPLRLQ      + F   
Sbjct: 354 -FVGESWDKRNSLIKDIILNKSDMNFKCGFISSFKLPNTELDSPLRLQISALTENKFKGL 412

Query: 428 RQIPEDVAAATGLSLVYESPIANLDLTYALPLTSRPVDLAKPGFSFGVAIAY 479
               +  AA TG+SLVY++   N+ L+Y +PL       A  GFSF +AI Y
Sbjct: 413 ANYFDGCAADTGVSLVYKTKDTNMALSYKVPLMQSSNSPATSGFSFDIAITY 464

>TPHA0E01750 Chr5 (353257..354636) [1380 bp, 459 aa] {ON} Anc_5.436
          Length = 459

 Score = 99.0 bits (245), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 114/481 (23%), Positives = 216/481 (44%), Gaps = 44/481 (9%)

Query: 17  DQLGKSQTKPLYITSVQVEDGK-DYPLSDGVLKSILSPVLAKPLQSLSSTLASLETIEKN 75
           D +  S TKP+Y+T V V++G     LSD   ++IL  V++ P++S+       + I  N
Sbjct: 4   DSIVFSDTKPIYVTQVLVKNGGPGVVLSDTFYENILYDVISNPVKSVQDVNLIFQNIRNN 63

Query: 76  LMYTGLYQDISITLDHD-KSRLVNQFLSNIAPKEYDIEXXXXXXXXXXXX---XXXYQRL 131
           L+ +GLY+++ + LD D ++ L+N  L  ++ ++  IE                  Y+  
Sbjct: 64  LILSGLYKNVDVKLDLDERASLLNHSLK-LSTEQIGIESVVPISATLNMTPLYLTPYKNY 122

Query: 132 SLVTTTRDSYASAGGRLASVNKFGLAE--VFSLQADVNYTPFSGKLDDKLVDLRCLVPFQ 189
               T+    + +  R   +N FG ++     L AD+N T    ++D K +D +  +P  
Sbjct: 123 VTFNTSNTQNSVSLNR-DWINLFGTSDTGTIKLSADLNQT--KSEIDKKSIDAKFTMPLL 179

Query: 190 NNPSIKAVFDVNYAMLDLYNQPWINEDDQHKQRQIGFNIGIQKQWLSKRLYS-PTAFAGV 248
            N SI+ + +   ++    N            +Q   NIG+ K  L   + S P  ++G+
Sbjct: 180 RNSSIRTILESKCSIAKPRNDTM---------KQFELNIGLTKLKLIGGIKSLPIFYSGL 230

Query: 249 SIVGRNLH-GIQLDRASYH--VSAWADSSLKT-SFVTQFLHSNRKLIGTFPVQGMKFNAV 304
           +I  +    G   D  S    +   +D  + + S  ++++  +R     FP  G  F  V
Sbjct: 231 NIQRKQTTLGPLSDEESETEIIGNISDEVINSLSLKSEYITDSRFYTSKFPSGGHLFKLV 290

Query: 305 NELVLSQTVAGTPQ-EETFNKFLVTYEKHVSFLRNLVTTSLDLSCGSLISTKQAAKPMVH 363
           ++ VL++T + + + ++  +   +++EKH+S L + +T+       S I       P+  
Sbjct: 291 HQHVLNETNSISNEIKKNISNINMSFEKHISTLNDQITS-------SFIFDGHVGVPLQS 343

Query: 364 IM-----DQFYLGGLSSLKGFHRNSVGSRGGDLFYRLSLKSSVHLPGTPLDSPLRLQAFF 418
                   +F+       K   +N +      + +++ L SS  +P  P+ SP+R Q   
Sbjct: 344 TFANLNSGEFWDNEKEIFKTLCQNDI-----KVSHKVGLVSSFRVPNIPITSPIRFQLSV 398

Query: 419 NAGDVFHFRRQIPEDVAAATGLSLVYESPIANLDLTYALPLTSRPVDLAKPGFSFGVAIA 478
              +      +  ++ +A TG+SLVY+   + + L+Y +PL     D    G SF VA+ 
Sbjct: 399 LGINKSKRMAEYLKNYSADTGVSLVYKGDHSQMKLSYQIPLI-HGNDNKHSGLSFDVAVT 457

Query: 479 Y 479
           Y
Sbjct: 458 Y 458

>TBLA0A02810 Chr1 (676946..678391) [1446 bp, 481 aa] {ON} Anc_5.436
          Length = 481

 Score = 83.6 bits (205), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 119/500 (23%), Positives = 213/500 (42%), Gaps = 68/500 (13%)

Query: 15  PTDQLGKSQTKPLYITSVQV-EDGKDYPLSDGVLKSILSPVLAKPLQSLSSTLASLETIE 73
           P++ L  + TKPLYI+ V +    +D  +SD  LKS+L+PVL+ PLQ+L +TL + E IE
Sbjct: 14  PSNDL--NSTKPLYISKVTITSSNEDLFVSDSFLKSLLNPVLSTPLQNLKTTLQTFENIE 71

Query: 74  KNLMYTGLYQDISITLDHDK--SRLVNQFLSNIAPKEYDIEXXXXXXXXXXXXXXXYQRL 131
             L  T L++D+ I+LD ++  S  +     +I+   YDI+                + L
Sbjct: 72  DKLYQTDLFEDVKISLDTNQATSSKIKTLFDDIS--VYDIKVDSPIPITANIFIKPNKPL 129

Query: 132 S------LVTTTRDSYASAGGRLASVNKFGLAEVFSLQADVNYTPFSGKLDDKLVD---L 182
                   ++  +  ++ +   + S+N+   A+   + A   Y   S K  +   D    
Sbjct: 130 VDPNYTWTISNNKSIFSWSKNWINSLNR---ADQHYINASATYDLDSTKWKNFKFDGLST 186

Query: 183 RCLVPFQNNPSIKAVFDVNYAMLDLYNQPWIN---EDDQHKQRQIGFNIGIQKQWLSKRL 239
             LVPF    S+K+V  ++       ++ +I    E    K  +    +G++    S  L
Sbjct: 187 YPLVPFT---SVKSVSGISLFKPLQQSKDYIQYLVESGFRKDMRFPEEVGVK----SSNL 239

Query: 240 YSPTAFAGVSIVGRNLHGIQLDRASYHVSAWADSSLKTSFVTQFLHSNRKLIGTFPVQGM 299
           Y+  A  G      N + + L++    +        KTS +++F   +R  +   P  G 
Sbjct: 240 YTGLAINGAIKDEGNNNCLVLNKT---ILENMQIYKKTSILSKFSTDSRIFVKGIPRYGS 296

Query: 300 KFNAVNELV---LSQTVAGTPQ---EETFNKFLVTYEKHVSFLRNLVTTSLDLSCGSLIS 353
            FN   E V   L+ +   +P+       ++F + +EK+ +  ++ +       C  L+ 
Sbjct: 297 YFNIYYEYVLNGLNDSKKLSPELLHLSNVSRFGINFEKYFTLFQDAIL------CSLLVR 350

Query: 354 TKQAAKPMVHIM---------DQFYLGGLSSLKGFHRNSVGSRGGDLFYRLSLKSSVHLP 404
           T  + KP +++          ++F +      +   +N      G  FY + L +SV L 
Sbjct: 351 TGTSIKPSINMFNWETKRREANEFPVPSYLEERPHEKND-----GIAFYNVCLNASVPLF 405

Query: 405 GTPLDSPLRLQAFFNAGDVFHFRRQIPE-----DVAAATGLSLVYESPIANLDLTYALPL 459
                SPLR Q   N+  +  +    P      D+    G  LVY+S  A  D+ Y LP+
Sbjct: 406 SKCKFSPLRFQ---NSIQLERYNNCCPHKQRKPDITGTLG--LVYKSESAYFDIGYTLPI 460

Query: 460 TSRPVDLAKPGFSFGVAIAY 479
                   K GF+   +I++
Sbjct: 461 GKIAGHDTKAGFAMNASISF 480

>YNL026W Chr14 (581920..583374) [1455 bp, 484 aa] {ON}
           SAM50Essential component of the Sorting and Assembly
           Machinery (SAM or TOB complex) of the mitochondrial
           outer membrane, which binds precursors of beta-barrel
           proteins and facilitates their outer membrane insertion;
           homologous to bacterial Omp85
          Length = 484

 Score = 77.0 bits (188), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 48/157 (30%), Positives = 75/157 (47%), Gaps = 15/157 (9%)

Query: 338 NLVTTSLDLSCGSLISTKQAAKPMVHIMDQFYLGGLSSLKGFHRNSVGSR------GGDL 391
           + +T S  +  G L +        VHI D+F  GG S ++GF    +G R      GGD 
Sbjct: 327 DFITFSTTIKTGYLKNLSSQQSLPVHICDKFQSGGPSDIRGFQTFGLGPRDLYDAVGGDA 386

Query: 392 FYRLSLKSSVHLPGTPLD-SPLRLQAFFNAGDVFHFRR--------QIPEDVAAATGLSL 442
           F    L     LP   ++ S  RL  FFN G + +           Q+ ++ + +TG+ L
Sbjct: 387 FVSYGLSVFSRLPWKKVEKSNFRLHWFFNGGKLVNHDNTSLGNCIGQLSKEHSTSTGIGL 446

Query: 443 VYESPIANLDLTYALPLTSRPVDLAKPGFSFGVAIAY 479
           V   P+A  +L + LP+T+   DL + GF FG+ +A+
Sbjct: 447 VLRHPMARFELNFTLPITAHENDLIRKGFQFGLGLAF 483

>KLLA0E08735g Chr5 (779165..780643) [1479 bp, 492 aa] {ON} similar
           to uniprot|P53969 Saccharomyces cerevisiae YNL026W SAM50
           Essential component of the Sorting and Assembly
           Machinery (SAM complex) of the mitochondrial outer
           membrane the authentic non-tagged protein was localized
           to the mitochondria
          Length = 492

 Score = 75.5 bits (184), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 68/239 (28%), Positives = 105/239 (43%), Gaps = 30/239 (12%)

Query: 258 IQLDRASYHVSAWADSSLKTSFVTQFLHSNRKLIGTFPVQGMKFNAVNELVLSQTVAGTP 317
           ++ D AS H+   A   +K S V       R  I   P  G  +  +NE+ L +    T 
Sbjct: 266 VRSDFASSHLLFSAGDDVKHSVVHSITRDTRDNI-IAPSSGQMWKFINEVSLGK-FWKTN 323

Query: 318 QEETFNKFLVTYEKHVSFLRNLVTTSLDLSCGSLISTKQAAKPMVHIMDQFYLGGLSSLK 377
            E  F K          F RN +T S  +  G + +      P+ H+ D+FY GG + ++
Sbjct: 324 LEYNFTKSW--------FNRNFITMSSTVKAGYIHNFHAKTYPL-HLADKFYNGGSNDVR 374

Query: 378 GFHRNSVGSR------GGD--LFYRLSLKSSVHLPGTPL-DSPLRLQAFFNAGDVFHFRR 428
            F    +G +      GGD  L Y LSL S   LP     DS  RL  FFN G + +   
Sbjct: 375 SFQLMGLGPKDIYDYVGGDTSLSYGLSLFS--RLPFKRFYDSNFRLHLFFNGGRLINRNN 432

Query: 429 --------QIPEDVAAATGLSLVYESPIANLDLTYALPLTSRPVDLAKPGFSFGVAIAY 479
                   Q+    + +TG  LV+  P+A  +L + +P+T+   D  + GF +G+ I++
Sbjct: 433 ANTTDTLMQMLSQHSLSTGFGLVFRHPVARFELNFTVPITAHTSDATRKGFQYGIGISF 491

>Kpol_1003.51 s1003 (117089..118525) [1437 bp, 478 aa] {ON}
           (117089..118525) [1437 nt, 479 aa]
          Length = 478

 Score = 75.1 bits (183), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 76/138 (55%), Gaps = 20/138 (14%)

Query: 359 KPMVHIMDQFYLGGLSSLKGFHRNSVGSR------GGDLF--YRLSLKSSVHLPGTPL-D 409
           KP+ HI D+F+LGG + ++GF    +G +      GGD+F  Y +SL S   LP     D
Sbjct: 343 KPL-HISDKFHLGGSNDVRGFQLMGLGPKQINDAIGGDMFSAYGISLFSK--LPFKKFSD 399

Query: 410 SPLRLQAFFNAGDVFH-----FRRQIP---EDVAAATGLSLVYESPIANLDLTYALPLTS 461
           S  RL AFFN G + +     F R +    ++ + A G  ++++ P+A  +L + LPLTS
Sbjct: 400 SNFRLHAFFNGGKLVNQNTNTFDRNLQSLFKENSLAIGTGIIFKHPVARFELNFTLPLTS 459

Query: 462 RPVDLAKPGFSFGVAIAY 479
              D  + GF +G+ +++
Sbjct: 460 YSTDHVRKGFQYGIGMSF 477

>Ecym_3342 Chr3 (649920..651407) [1488 bp, 495 aa] {ON} similar to
           Ashbya gossypii AGR392C
          Length = 495

 Score = 74.7 bits (182), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 50/202 (24%), Positives = 93/202 (46%), Gaps = 27/202 (13%)

Query: 294 FPVQGMKFNAVNELVLSQTVAGTPQEETFNKFLVTYEKHVSFL-RNLVTTSLDLSCGSLI 352
           FP +G      NEL L           T+ K ++ +    S+L ++ +T S  +  G  I
Sbjct: 304 FPSRGQYIKLFNELSLG----------TYWKSILEFTDAKSWLDKDFITMSTTIK-GGYI 352

Query: 353 STKQAAKPMVHIMDQFYLGGLSSLKGFHRNSVGSR------GGDLFYRLSLKSSVHLPGT 406
           +   +    +H+ D+F+ GG + ++GF +  +G R      GGD F    +     LP  
Sbjct: 353 ANLNSDNKFIHMKDKFHSGGSNDVRGFQQMGLGPRDIYDSIGGDTFVAYGISVFSRLPVN 412

Query: 407 PL-DSPLRLQAFFNAGDVFHFRR--------QIPEDVAAATGLSLVYESPIANLDLTYAL 457
              +S  RL  F N G + +           Q+  + + ATG+ ++++ P+A  +L + L
Sbjct: 413 KWSNSGFRLHWFLNGGRLINHNNSDLSGVLDQLCMEHSIATGIGILFKHPVARFELNFTL 472

Query: 458 PLTSRPVDLAKPGFSFGVAIAY 479
           PL +   D  + GF +G+ +++
Sbjct: 473 PLAAHSSDSVRKGFQYGIGLSF 494

>KNAG0H01940 Chr8 (342815..344185) [1371 bp, 456 aa] {ON} Anc_2.304
           YNL026W
          Length = 456

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 50/161 (31%), Positives = 76/161 (47%), Gaps = 18/161 (11%)

Query: 335 FLRNLVTTSLDLSCGSLISTKQAAKPMVHIMDQFYLGGLSSLKGFHRNSVGSR------G 388
           F R+ +T S  L  G  I     AK  +H  D+F  GG + ++ F  N +G R      G
Sbjct: 297 FPRDFITLSTTLRSG-YIKNLNPAKSYIHFTDKFQNGGPNDVRNFQLNGIGPRHMHHSMG 355

Query: 389 GDLF--YRLSLKSSVHLPGTPLDSPLRLQAFFNAGDVFHFR--------RQIPEDVAAAT 438
           GD F  Y +SL S + L     DS  RL  +FN G + +          R++  + + + 
Sbjct: 356 GDAFIAYGVSLFSKIPLKRFQ-DSNFRLHWYFNGGKLINHNNLPIHTLLRELTLEHSTSI 414

Query: 439 GLSLVYESPIANLDLTYALPLTSRPVDLAKPGFSFGVAIAY 479
           G  +V   P+A  +L + +PLTS   DL + GF FG+   +
Sbjct: 415 GAGIVMRHPMARFELNFGVPLTSHVGDLQRKGFQFGLGFEF 455

>Smik_14.304 Chr14 (544403..545905) [1503 bp, 500 aa] {ON} YNL026W
           (REAL)
          Length = 500

 Score = 72.4 bits (176), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 78/159 (49%), Gaps = 19/159 (11%)

Query: 338 NLVTTSLDLSCGSL--ISTKQAAKPMVHIMDQFYLGGLSSLKGFHRNSVGSR------GG 389
           + +T S     G L  IS++Q+    VHI D+F  GG + ++ F    +G R      GG
Sbjct: 343 DFITFSTTFKTGYLKNISSQQSLP--VHICDKFQSGGPNDIRSFQTFGLGPRDLYDAIGG 400

Query: 390 DLFYRLSLKSSVHLPGTPLD-SPLRLQAFFNAGDVFHFRR--------QIPEDVAAATGL 440
           D F    +     LP   ++ S  RL  FFN G + +           Q+  + + +TG+
Sbjct: 401 DAFVSYGVSMFSRLPWKKVEKSNFRLHWFFNGGKLINHDNTSLSNCIGQLSREHSTSTGI 460

Query: 441 SLVYESPIANLDLTYALPLTSRPVDLAKPGFSFGVAIAY 479
            LV   P+A  +L ++LP+T+   DL + GF FG+ +A+
Sbjct: 461 GLVLRHPLARFELNFSLPITAHENDLMRKGFQFGLGLAF 499

>KLTH0G10824g Chr7 (910133..911620) [1488 bp, 495 aa] {ON} similar
           to uniprot|P53969 Saccharomyces cerevisiae YNL026W SAM50
           Essential component of the Sorting and Assembly
           Machinery (SAM complex) of the mitochondrial outer
           membrane the authentic non-tagged protein was localized
           to the mitochondria
          Length = 495

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 57/202 (28%), Positives = 91/202 (45%), Gaps = 28/202 (13%)

Query: 294 FPVQGMKFNAVNELVLSQTVAGTPQEETFNKFLVTYEKHVSFLRN-LVTTSLDLSCGSLI 352
           FP+ G  +   NEL  S+          + K      K  S+ +N   T S  L  G  I
Sbjct: 305 FPLAGSFYKLTNELSPSK----------YWKCFFEASKVKSWRKNDFFTASFTLK-GGYI 353

Query: 353 STKQAAKPMVHIMDQFYLGGLSSLKGFHRNSVG------SRGGDLFYRLSLKSSVHLPGT 406
           +   A+KP+ HI D+F+ GG + ++ F    +G      S GGD F    +     LP  
Sbjct: 354 NNFSASKPL-HISDKFHNGGSNDVRSFQLMGLGPKDLHDSLGGDAFVSYGVSLFSRLPFK 412

Query: 407 PL-DSPLRLQAFFNAGDVFHFR--------RQIPEDVAAATGLSLVYESPIANLDLTYAL 457
              DS  RL AFFN   + +            +  + + +TG+ LV   P+A  +L + +
Sbjct: 413 RWSDSNFRLHAFFNGARLINTNGDQLKNCISSLAREHSTSTGIGLVLGHPVARFELNFGI 472

Query: 458 PLTSRPVDLAKPGFSFGVAIAY 479
           PLT+   D A+ GF +G+ +++
Sbjct: 473 PLTAHTSDSARKGFQYGIGLSF 494

>Suva_14.319 Chr14 (564528..565982) [1455 bp, 484 aa] {ON} YNL026W
           (REAL)
          Length = 484

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 46/159 (28%), Positives = 76/159 (47%), Gaps = 19/159 (11%)

Query: 338 NLVTTSLDLSCGSL--ISTKQAAKPMVHIMDQFYLGGLSSLKGFHRNSVGSR------GG 389
           + +T S     G L  IS++Q+    VHI D+F  GG + ++ F    +G R      GG
Sbjct: 327 DFITFSTTFKTGYLKNISSQQSLP--VHICDKFQNGGPNDIRSFQTFGLGPRDLYDAIGG 384

Query: 390 DLFYRLSLKSSVHLPGTPLD-SPLRLQAFFNAGDVFHFRR--------QIPEDVAAATGL 440
           D F    +     LP   +  S  RL  FFN G + +           Q+ ++ + +TG+
Sbjct: 385 DAFVSYGVSVFSRLPWKKVQKSNFRLHWFFNGGKLINHDNMSLSNCIGQLSKEHSTSTGI 444

Query: 441 SLVYESPIANLDLTYALPLTSRPVDLAKPGFSFGVAIAY 479
            LV   P+A  +L ++LP+ +   DL + G  FG+ +A+
Sbjct: 445 GLVLRHPMARFELNFSLPIAAHENDLMRKGLQFGIGLAF 483

>AGR392C Chr7 complement(1450059..1451546) [1488 bp, 495 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL026W
           (SAM50)
          Length = 495

 Score = 66.6 bits (161), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 68/269 (25%), Positives = 113/269 (42%), Gaps = 36/269 (13%)

Query: 235 LSKRLYSPTAFAGVSIVGRNLHGIQLDRASYHVSAWA-DSSL-------KTSFVTQFLHS 286
           L  R    + F G+      LH  QL   +  ++  A D+SL       KTS ++  L S
Sbjct: 238 LGTRASLRSCFFGLRSWNHELHAEQLWCTTGCINGLASDASLLQCGDDVKTS-LSYVLSS 296

Query: 287 NRKLIGTFPVQGMKFNAVNELVLSQTVAGTPQEETFNKFLVTYEKHVSF-LRNLVTTSLD 345
           + +    F   G      +EL L           ++ K  V     VS+   + +T S  
Sbjct: 297 DTRDSAVFASTGRLLRWASELALG----------SYAKTQVQLSDAVSWGAGDFLTLSTT 346

Query: 346 LSCGSLISTKQAAKPMVHIMDQFYLGGLSSLKGFHRNSVG------SRGGDLFYRLSLKS 399
           L  G + + +   +P +HI D+F+ GG + ++GF    +G      S GGD F    L  
Sbjct: 347 LKAGYIKNLQPGLRP-IHIRDKFHCGGANDVRGFQLMGLGPKDAQDSLGGDAFLTYGLSL 405

Query: 400 SVHLPGTPL-DSPLRLQAFFNAGDVFHFR--------RQIPEDVAAATGLSLVYESPIAN 450
              LP      S  RL  F N G +              + E+ + + G  L+++ P+A 
Sbjct: 406 FSRLPVQRWAGSDFRLHWFLNGGRLLSHNGASLLDVGTTLLEEHSISCGTGLLFQHPVAR 465

Query: 451 LDLTYALPLTSRPVDLAKPGFSFGVAIAY 479
            +L + LPL +   D A+ GF +G+ +++
Sbjct: 466 FELNFTLPLATHSSDTARKGFQYGIGVSF 494

>Skud_14.302 Chr14 (552625..554079) [1455 bp, 484 aa] {ON} YNL026W
           (REAL)
          Length = 484

 Score = 66.6 bits (161), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 42/157 (26%), Positives = 71/157 (45%), Gaps = 15/157 (9%)

Query: 338 NLVTTSLDLSCGSLISTKQAAKPMVHIMDQFYLGGLSSLKGFHRNSVGSR------GGDL 391
           + +T S     G L +        +HI D+F  GG + ++ F    +G R      GGD 
Sbjct: 327 DFITFSTTFKTGYLENISSQRSLPIHICDKFQSGGPNDIRSFQTFGLGPRDLYDTIGGDA 386

Query: 392 FYRLSLKSSVHLPGTPLD-SPLRLQAFFNAGDVFHFRR--------QIPEDVAAATGLSL 442
           F    +     LP   +  S  RL  FFN G + +           ++ ++ + +TGL L
Sbjct: 387 FVSYGVSVFSRLPWEKVKKSNFRLHWFFNGGKLINHDNMSLSNCMGRLSKEHSTSTGLGL 446

Query: 443 VYESPIANLDLTYALPLTSRPVDLAKPGFSFGVAIAY 479
           V   P+A  +L ++LP+ +   DL + GF FG+ + +
Sbjct: 447 VLRHPMARFELNFSLPIAAHENDLMRKGFQFGLGLVF 483

>TPHA0G00830 Chr7 (155259..156695) [1437 bp, 478 aa] {ON} Anc_2.304
           YNL026W
          Length = 478

 Score = 66.2 bits (160), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 43/183 (23%), Positives = 88/183 (48%), Gaps = 22/183 (12%)

Query: 318 QEETFNKFL---VTYEKHVSFLRN-LVTTSLDLSCGSLISTKQAAKPMVHIMDQFYLGGL 373
            E   N++L   +     +SFL+N L+T +  +  G + +     +P+ HI D+F LGG 
Sbjct: 296 NEVALNRYLKSQIEVNTAMSFLKNSLITVNGTMRLGYISNISSTLRPL-HIGDRFQLGGG 354

Query: 374 SSLKGFHRNSVG------SRGGDLFYRLSLKSSVHLPGTPL-DSPLRLQAFFNAGDVFHF 426
           + ++ F    +G      S GG+ +    +     LP   L  S  ++  F N G + + 
Sbjct: 355 NDVRSFQPMGLGPKDIYDSIGGNSYTAYGISVFTALPFKSLMTSNFKIHTFINGGKLINH 414

Query: 427 R----------RQIPEDVAAATGLSLVYESPIANLDLTYALPLTSRPVDLAKPGFSFGVA 476
                      + + ++ + +TG+ ++++ P+A  +L + LPL +   D+ + GF +G+ 
Sbjct: 415 NSSNGTFTDAVKDLIKENSLSTGVGIIFKHPVARFELNFTLPLITHKSDMVRKGFQYGIG 474

Query: 477 IAY 479
           I++
Sbjct: 475 ISF 477

>SAKL0E07194g Chr5 complement(590515..592002) [1488 bp, 495 aa] {ON}
           similar to uniprot|P53969 Saccharomyces cerevisiae
           YNL026W SAM50 Essential component of the Sorting and
           Assembly Machinery (SAM complex) of the mitochondrial
           outer membrane the authentic non-tagged protein was
           localized to the mitochondria
          Length = 495

 Score = 66.2 bits (160), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 46/200 (23%), Positives = 91/200 (45%), Gaps = 25/200 (12%)

Query: 295 PVQGMKFNAVNELVLSQTVAGTPQEETFNKFLVTYEKHVSFLRNLVTTSLDLSCGSLIST 354
           P +G     +NEL L +    T +    N +         F  + +T +  L  G + + 
Sbjct: 305 PTRGNYAKLLNELALGKFWKTTLEFSQTNSW---------FTNDFITMTGTLKGGYISNF 355

Query: 355 KQAAKPMVHIMDQFYLGGLSSLKGFHRNSVG------SRGGDLFYRLSLKSSVHLPGTPL 408
              ++P+ H+ D+F+ GG + ++GF    +G      S GGD F    +     LP    
Sbjct: 356 HPKSQPL-HMGDKFHNGGSNDVRGFQAMGLGPKDLYDSMGGDAFVAYGVSLFSRLPVRRW 414

Query: 409 -DSPLRLQAFFNAGDVFHFR--------RQIPEDVAAATGLSLVYESPIANLDLTYALPL 459
            +S  RL  F N G + +          + + ++ + +TG+ LV++ P+A  +L + +P+
Sbjct: 415 YESNFRLHWFVNGGRLINHNNTNLSSCIKSLAQEHSTSTGVGLVFKHPVARFELNFTVPI 474

Query: 460 TSRPVDLAKPGFSFGVAIAY 479
           ++   D  + GF +G+ + +
Sbjct: 475 SAHSSDSVRKGFQYGIGLTF 494

>CAGL0M06853g Chr13 (697615..699015) [1401 bp, 466 aa] {ON} similar
           to uniprot|P53969 Saccharomyces cerevisiae YNL026w
          Length = 466

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 44/160 (27%), Positives = 71/160 (44%), Gaps = 16/160 (10%)

Query: 335 FLRNLVTTSLDLSCGSLISTKQAAKPMVHIMDQFYLGGLSSLKGFHRNSVGSR------G 388
           F  + +TT+  L  G L       K  +HI D+F  GG + ++ F    VG +      G
Sbjct: 307 FKNDFITTTTTLKGGYL-GNFHPDKKTLHINDKFMSGGPNDIRSFQSFGVGPKDLQDAIG 365

Query: 389 GDLFYRLSLKSSVHLPGTPL-DSPLRLQAFFNAGDVFHFRRQ--------IPEDVAAATG 439
           GD F    +     LP     DS  RL  FFN G + + + +        +    + + G
Sbjct: 366 GDTFLSYGVSIFSKLPIKKFEDSHFRLHWFFNGGKLINHQNKPVIDTLHDLSRQHSTSVG 425

Query: 440 LSLVYESPIANLDLTYALPLTSRPVDLAKPGFSFGVAIAY 479
             +V   P+A  +L ++LPLT    D  + GF FG+ +++
Sbjct: 426 CGIVLRHPVARFELNFSLPLTVSTEDSLRKGFQFGLGMSF 465

>KAFR0H03250 Chr8 (621316..622704) [1389 bp, 462 aa] {ON} Anc_2.304
           YNL026W
          Length = 462

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 50/203 (24%), Positives = 90/203 (44%), Gaps = 25/203 (12%)

Query: 293 TFPVQGMKFNAVNELVLSQTVAGTPQEETFNKFLVTYEKHVSFLRN-LVTTSLDLSCGSL 351
           T P +G  F   N+L       GT   + F + +  +    S+L++  +T S  +  G +
Sbjct: 268 TAPTKGRLFKINNDLGF-----GTNNLQ-FWRHVTEFNLVKSWLKDDFITMSNTIKFGYI 321

Query: 352 ISTKQAAKPMVHIMDQFYLGGLSSLKGFHRNSVGSR------GGDLFYRLSLKSSVHLPG 405
              K  ++  +H  D+F  GG + ++ F    +G R      GGD F    +     LP 
Sbjct: 322 ---KNLSQDYIHFTDKFQNGGPNDIRSFQSMGIGPRHNSYSLGGDAFLSYGVSIFSKLPI 378

Query: 406 TPL-DSPLRLQAFFNAG--------DVFHFRRQIPEDVAAATGLSLVYESPIANLDLTYA 456
               DS  RL  FFN G         +++  + +  + + + G+ +V   P+A  ++ +A
Sbjct: 379 QKFHDSNFRLHWFFNGGKLINHDNASIWNCMQNLTIENSTSAGVGVVLRHPMARFEMNFA 438

Query: 457 LPLTSRPVDLAKPGFSFGVAIAY 479
           +P+T    DL + GF FG+   +
Sbjct: 439 VPITDHQDDLTRKGFQFGLGFEF 461

>Kwal_27.11456 s27 complement(809084..810574) [1491 bp, 496 aa] {ON}
           YNL026W - 1:1 [contig 27] FULL
          Length = 496

 Score = 63.5 bits (153), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 49/201 (24%), Positives = 87/201 (43%), Gaps = 25/201 (12%)

Query: 294 FPVQGMKFNAVNELVLSQTVAGTPQEETFNKFLVTYEKHVSFLRNLVTTSLDLSCGSLIS 353
           FP+ G      NE+ L++          F K    +    S+  N   T+     G  I+
Sbjct: 305 FPLAGSFLKISNEIALNK----------FWKSSFEFSNVRSWCNNDFFTASGTVKGGYIN 354

Query: 354 TKQAAKPMVHIMDQFYLGGLSSLKGFHRNSVG------SRGGDLFYRLSLKSSVHLPGTP 407
                   +H+ D+F+ GG + ++ F    +G      S GGD F    +     LP   
Sbjct: 355 NFHPQTKPLHVSDKFHNGGSNDVRSFQLMGLGPKDLYDSMGGDAFVSYGVSIFSRLPIKR 414

Query: 408 L-DSPLRLQAFFNAGDVFH-----FRRQI---PEDVAAATGLSLVYESPIANLDLTYALP 458
             +S  RL AFFN   + +     F+  +     + + +TG+ LV+  P+A  +L + +P
Sbjct: 415 WSESNFRLHAFFNGARLINTNGTPFKSSLSTLASEHSTSTGVGLVFGHPVARFELNFCVP 474

Query: 459 LTSRPVDLAKPGFSFGVAIAY 479
           LT+   D  + GF +G+ +++
Sbjct: 475 LTAHSSDSIRKGFQYGIGLSF 495

>TDEL0G02340 Chr7 (451314..452798) [1485 bp, 494 aa] {ON} Anc_2.304
           YNL026W
          Length = 494

 Score = 63.2 bits (152), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 52/207 (25%), Positives = 85/207 (41%), Gaps = 39/207 (18%)

Query: 295 PVQGMKFNAVNELVLSQTVAGTPQEETFNKFLVTYEKHVSFLRNLVTTSLDLSCGSLIST 354
           P +G      NEL + Q   G  +    N +L        FL +  T    L  G + + 
Sbjct: 304 PSRGSLLKLTNELAIGQFWKGQIEVSQNNSWLKD-----DFLGSCCT----LRSGYIQNL 354

Query: 355 KQAAKPMVHIMDQFYLGGLSSLKGFHRNSVG------SRGGD--------LFYRLSLKSS 400
             + KP ++  D+F+ GG + ++ FH   +G      S GGD         F RL +K  
Sbjct: 355 SSSRKP-INTFDKFHNGGANDIRSFHIMGLGPKDLYDSIGGDAFVAYGVSFFSRLPIKRW 413

Query: 401 VHLPGTPLDSPLRLQAFFNAGDVFHFR--------RQIPEDVAAATGLSLVYESPIANLD 452
            H       S  RL  FFN G + +           Q+  + + + G  ++    +A  +
Sbjct: 414 SH-------SNFRLHWFFNGGKLINHNNAPFTNILEQLASEHSTSVGFGILLRHQVARFE 466

Query: 453 LTYALPLTSRPVDLAKPGFSFGVAIAY 479
           L + LPLT    D  + GF +G+ I++
Sbjct: 467 LNFTLPLTCHSGDALRKGFQYGIGISF 493

>NCAS0G03860 Chr7 complement(715064..716449) [1386 bp, 461 aa] {ON} 
          Length = 461

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 44/160 (27%), Positives = 68/160 (42%), Gaps = 18/160 (11%)

Query: 335 FLRNLVTTSLDLSCGSLISTKQAAKPMVHIMDQFYLGGLSSLKGFHRNSVG------SRG 388
           F  + VT S +   G + S    +   VHI D+F  GG + ++ F    +G      S G
Sbjct: 304 FDNDFVTMSCNFKTGYIHSLSSQS---VHISDKFQSGGPNDIRSFQSMGLGPKDHMNSIG 360

Query: 389 GDLFYRLSLKSSVHLPGTPLD-SPLRLQAFFNAGDVFHFRRQIPEDVAAA--------TG 439
           GD F    +     LP      S  RL  F N G++     Q   D  AA         G
Sbjct: 361 GDAFVSYGVSVFSRLPIEKWSASNFRLHGFINGGNLIDHNGQALTDCLAALSRQHSTSAG 420

Query: 440 LSLVYESPIANLDLTYALPLTSRPVDLAKPGFSFGVAIAY 479
           + ++   P+A  +L +++PLT    D  + G  FGV +++
Sbjct: 421 VGIILRHPMARFELNFSVPLTMHSGDDVRKGLQFGVGLSF 460

>NCAS0G03750 Chr7 (692032..693417) [1386 bp, 461 aa] {ON} 
          Length = 461

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 44/160 (27%), Positives = 68/160 (42%), Gaps = 18/160 (11%)

Query: 335 FLRNLVTTSLDLSCGSLISTKQAAKPMVHIMDQFYLGGLSSLKGFHRNSVG------SRG 388
           F  + VT S +   G + S    +   VHI D+F  GG + ++ F    +G      S G
Sbjct: 304 FDNDFVTMSCNFKTGYIHSLSSQS---VHISDKFQSGGPNDIRSFQSMGLGPKDHMNSIG 360

Query: 389 GDLFYRLSLKSSVHLPGTPLD-SPLRLQAFFNAGDVFHFRRQIPEDVAAA--------TG 439
           GD F    +     LP      S  RL  F N G++     Q   D  AA         G
Sbjct: 361 GDAFVSYGVSVFSRLPIEKWSASNFRLHGFINGGNLIDHNGQALTDCLAALSRQHSTSAG 420

Query: 440 LSLVYESPIANLDLTYALPLTSRPVDLAKPGFSFGVAIAY 479
           + ++   P+A  +L +++PLT    D  + G  FGV +++
Sbjct: 421 VGIILRHPMARFELNFSVPLTMHSGDDVRKGLQFGVGLSF 460

>NDAI0G00710 Chr7 complement(153261..154736) [1476 bp, 491 aa] {ON}
           Anc_2.304
          Length = 491

 Score = 60.5 bits (145), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 51/208 (24%), Positives = 86/208 (41%), Gaps = 22/208 (10%)

Query: 294 FPVQGMKFNAVNELVLSQTVAGTPQEETFNKFLVTYEKHVSFLRN-LVTTSLDLSCG--- 349
           FP  G  F   NEL      + T     F K  + + +  S+L N  +T +     G   
Sbjct: 283 FPSNGQLFKWFNELNFIGNRSSTANGGPFWKNQLEFTQIRSWLPNDFITMNCTFRTGYIK 342

Query: 350 SLISTKQAAK---PMVHIMDQFYLGGLSSLKGFHRNSVGSR------GGDLFYRLSLKSS 400
            L++  +  K     +HI D+F  GG + ++ F    +G +      GGD F    +   
Sbjct: 343 QLLTKNEVQKGSSSFLHISDKFQNGGPNDIRSFQTMGLGPKDIFNSIGGDAFVSYGISIF 402

Query: 401 VHLPGTPLD-SPLRLQAFFNAGDVFHFR--------RQIPEDVAAATGLSLVYESPIANL 451
             LP      S  RL  F N G + +            +    + +TG+ ++   P+A  
Sbjct: 403 SKLPIKDWSKSNFRLHWFLNGGKLINHNGMSINNCFTDLSRQHSISTGVGILLRHPMARF 462

Query: 452 DLTYALPLTSRPVDLAKPGFSFGVAIAY 479
           +L +++PLT    D  + GF FGV +++
Sbjct: 463 ELNFSVPLTIHQGDDVRKGFQFGVGLSF 490

>ZYRO0A02310g Chr1 (183977..185455) [1479 bp, 492 aa] {ON} similar
           to uniprot|P53969 Saccharomyces cerevisiae YNL026W SAM50
           Essential component of the Sorting and Assembly
           Machinery (SAM complex) of the mitochondrial outer
           membrane the authentic non-tagged protein was localized
           to the mitochondria
          Length = 492

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 51/199 (25%), Positives = 83/199 (41%), Gaps = 27/199 (13%)

Query: 297 QGMKFNAVNELVLSQTVAGTPQEETFNKFLVTYEKHVSFLRN-LVTTSLDLSCGSLISTK 355
           +G  F   NEL L +          F K  +   K  S+ R+  +T +  L  G  I   
Sbjct: 304 RGSLFRWYNELSLGK----------FWKSQIELSKAQSWFRDDWLTVNGTLKTG-YIHNF 352

Query: 356 QAAKPMVHIMDQFYLGGLSSLKGFHRNSVG------SRGGDLFYRLSLKSSVHLPGTPLD 409
                 ++I D+F  GG + ++ F    +G      S GGD F    +     LP   + 
Sbjct: 353 HPTSQSLNICDKFQNGGGNDVRSFQYMGLGPKDIYDSIGGDAFVSYGVSVFTRLPFHKIS 412

Query: 410 -SPLRLQAFFNAGDVFHFRRQIPEDV--------AAATGLSLVYESPIANLDLTYALPLT 460
            S  RL  F N G + +      +DV        + + G  LV + P+A  +L +ALP+T
Sbjct: 413 HSNFRLHWFLNGGKLINHNNSSLQDVIKNLSTQHSTSIGFGLVLKHPVARFELNFALPVT 472

Query: 461 SRPVDLAKPGFSFGVAIAY 479
               D  + GF +G+ +++
Sbjct: 473 CHTGDCIRKGFQYGIGLSF 491

>TBLA0B06060 Chr2 (1427723..1429234) [1512 bp, 503 aa] {ON}
           Anc_2.304 YNL026W
          Length = 503

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 74/165 (44%), Gaps = 17/165 (10%)

Query: 331 KHVSFLRN-LVTTSLDLSCGSLISTKQAAKPMVHIMDQFYLGGLSSLKGFHRNSVG---- 385
           K+ SF R+  +T +     G + +    +K  +H  D+F  GG + ++GF    +G    
Sbjct: 339 KNKSFFRDDFITMACTFKTGYIHNFFPNSKA-IHRNDKFQNGGANDIRGFQFMGLGPKDR 397

Query: 386 --SRGGDLFYRLSLKSSVHLPGTPL-DSPLRLQAFFNAGDVFHFR--------RQIPEDV 434
             S GGD F          +P     DS  R   F N G + +            + +  
Sbjct: 398 FDSVGGDAFISYGFSVMNKIPIWKFYDSNFRFHWFVNGGKLINSNGKGLLNTFNDLSKQN 457

Query: 435 AAATGLSLVYESPIANLDLTYALPLTSRPVDLAKPGFSFGVAIAY 479
           + + G+ +V+  P+A  +L +A+P+ +   D+ + GF +G+ +++
Sbjct: 458 SMSVGMGIVFRHPMARFELNFAIPVVTHSGDITRKGFQYGIGLSF 502

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 48,690,365
Number of extensions: 2053772
Number of successful extensions: 5105
Number of sequences better than 10.0: 37
Number of HSP's gapped: 5157
Number of HSP's successfully gapped: 37
Length of query: 480
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 367
Effective length of database: 40,524,141
Effective search space: 14872359747
Effective search space used: 14872359747
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)