Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AER402C5.435ON86986945830.0
Ecym_47615.435ON7983897278e-83
SAKL0G02552g5.435ON8344133621e-34
KLTH0F16038g5.435ON7924013432e-32
Kwal_55.214225.435ON7823973182e-29
YDR369C (XRS2)5.435ON8548663042e-27
KAFR0E038305.435ON8457672962e-26
KLLA0E02201g5.435ON8353932754e-24
ZYRO0F10054g5.435ON6604182728e-24
TDEL0E019005.435ON7624062443e-20
NDAI0B056805.435ON8567682443e-20
Skud_4.6385.435ON8434852291e-18
TBLA0A028205.435ON9258842174e-17
NCAS0F033905.435ON8614392022e-15
CAGL0A02838g5.435ON8284041899e-14
Suva_2.5415.435ON8693641721e-11
KNAG0C049005.435ON7691181701e-11
Smik_4.6355.435ON8631451648e-11
Kpol_1016.55.435ON8124051576e-10
TPHA0J025905.435ON7757331423e-08
Kwal_56.237028.284ON416125880.063
CAGL0G06622g2.177ON73394761.9
NCAS0I012703.332ON259104724.6
KNAG0I009608.307ON72732718.0
AGL033C4.31ON26599708.6
TBLA0E003503.546ON805102719.4
TPHA0G00200singletonON3234117719.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AER402C
         (869 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AER402C Chr5 complement(1407938..1410547) [2610 bp, 869 aa] {ON}...  1769   0.0  
Ecym_4761 Chr4 (1479649..1482045) [2397 bp, 798 aa] {ON} similar...   284   8e-83
SAKL0G02552g Chr7 complement(209978..212482) [2505 bp, 834 aa] {...   144   1e-34
KLTH0F16038g Chr6 (1302028..1304406) [2379 bp, 792 aa] {ON} weak...   136   2e-32
Kwal_55.21422 s55 (830578..832926) [2349 bp, 782 aa] {ON} YDR369...   127   2e-29
YDR369C Chr4 complement(1215016..1217580) [2565 bp, 854 aa] {ON}...   121   2e-27
KAFR0E03830 Chr5 (759871..762408) [2538 bp, 845 aa] {ON} Anc_5.4...   118   2e-26
KLLA0E02201g Chr5 complement(205466..207973) [2508 bp, 835 aa] {...   110   4e-24
ZYRO0F10054g Chr6 complement(814872..816854) [1983 bp, 660 aa] {...   109   8e-24
TDEL0E01900 Chr5 (359266..361554) [2289 bp, 762 aa] {ON} Anc_5.4...    99   3e-20
NDAI0B05680 Chr2 complement(1384354..1386924) [2571 bp, 856 aa] ...    99   3e-20
Skud_4.638 Chr4 complement(1137885..1140416) [2532 bp, 843 aa] {...    93   1e-18
TBLA0A02820 Chr1 (678796..681573) [2778 bp, 925 aa] {ON} Anc_5.4...    88   4e-17
NCAS0F03390 Chr6 complement(683109..685694) [2586 bp, 861 aa] {O...    82   2e-15
CAGL0A02838g Chr1 complement(297872..300358) [2487 bp, 828 aa] {...    77   9e-14
Suva_2.541 Chr2 complement(965557..968166) [2610 bp, 869 aa] {ON...    71   1e-11
KNAG0C04900 Chr3 (946975..949284) [2310 bp, 769 aa] {ON} Anc_5.4...    70   1e-11
Smik_4.635 Chr4 complement(1135040..1137631) [2592 bp, 863 aa] {...    68   8e-11
Kpol_1016.5 s1016 (10036..12474) [2439 bp, 812 aa] {ON} (10036.....    65   6e-10
TPHA0J02590 Chr10 complement(574619..576946) [2328 bp, 775 aa] {...    59   3e-08
Kwal_56.23702 s56 complement(668862..670112) [1251 bp, 416 aa] {...    39   0.063
CAGL0G06622g Chr7 complement(631859..634060) [2202 bp, 733 aa] {...    34   1.9  
NCAS0I01270 Chr9 (229975..230754) [780 bp, 259 aa] {ON} Anc_3.33...    32   4.6  
KNAG0I00960 Chr9 (181042..183225) [2184 bp, 727 aa] {ON} Anc_8.307     32   8.0  
AGL033C Chr7 complement(648872..649669) [798 bp, 265 aa] {ON} Sy...    32   8.6  
TBLA0E00350 Chr5 (61567..63984) [2418 bp, 805 aa] {ON} Anc_3.546...    32   9.4  
TPHA0G00200 Chr7 (17940..27644) [9705 bp, 3234 aa] {ON}                32   9.8  

>AER402C Chr5 complement(1407938..1410547) [2610 bp, 869 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR369C
           (XRS2)
          Length = 869

 Score = 1769 bits (4583), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 857/869 (98%), Positives = 857/869 (98%)

Query: 1   MWVFKCNYQKSGQLGALQNISCALCPEREFIVGRASKSTLVIEEKGVSRTHLRLEVIDDH 60
           MWVFKCNYQKSGQLGALQNISCALCPEREFIVGRASKSTLVIEEKGVSRTHLRLEVIDDH
Sbjct: 1   MWVFKCNYQKSGQLGALQNISCALCPEREFIVGRASKSTLVIEEKGVSRTHLRLEVIDDH 60

Query: 61  VNILLLGSQLKVGGEDASKGSVLPFGPSQSPVILEVGSHSVQCILEWAQWEFKVPNTLLQ 120
           VNILLLGSQLKVGGEDASKGSVLPFGPSQSPVILEVGSHSVQCILEWAQWEFKVPNTLLQ
Sbjct: 61  VNILLLGSQLKVGGEDASKGSVLPFGPSQSPVILEVGSHSVQCILEWAQWEFKVPNTLLQ 120

Query: 121 EDPALLEVIKGLGIRVVTSFSKATTHHIIRPHEDDQDYEKYLFALVKGIPILHLEFLKQF 180
           EDPALLEVIKGLGIRVVTSFSKATTHHIIRPHEDDQDYEKYLFALVKGIPILHLEFLKQF
Sbjct: 121 EDPALLEVIKGLGIRVVTSFSKATTHHIIRPHEDDQDYEKYLFALVKGIPILHLEFLKQF 180

Query: 181 TALLRQPVTDFDPQLRSIQEQHYAFRGFTKKAADLNGLHFIVNRKHDFEMLKYTLEIGGG 240
           TALLRQPVTDFDPQLRSIQEQHYAFRGFTKKAADLNGLHFIVNRKHDFEMLKYTLEIGGG
Sbjct: 181 TALLRQPVTDFDPQLRSIQEQHYAFRGFTKKAADLNGLHFIVNRKHDFEMLKYTLEIGGG 240

Query: 241 TVHFCHDINDLSACLKTIPINGALALKYDHGISAEVKKVDDTRYCEVLHSHGIQLFTVHE 300
           TVHFCHDINDLSACLKTIPINGALALKYDHGISAEVKKVDDTRYCEVLHSHGIQLFTVHE
Sbjct: 241 TVHFCHDINDLSACLKTIPINGALALKYDHGISAEVKKVDDTRYCEVLHSHGIQLFTVHE 300

Query: 301 LTKAILYDKLAQLLSKRPPTMMKLVEPVPSTISQTQEMKQESLSPISLGNTTIKDLPRKD 360
           LTKAILYDKLAQLLSKRPPTMMKLVEPVPSTISQTQEMKQESLSPISLGNTTIKDLPRKD
Sbjct: 301 LTKAILYDKLAQLLSKRPPTMMKLVEPVPSTISQTQEMKQESLSPISLGNTTIKDLPRKD 360

Query: 361 KTRKRLKKPQPLDSLSFFAGGLSRQNSSIGGTADLVKQESMSLGADTHYGSPNDVQSLPA 420
           KTRKRLKKPQPLDSLSFFAGGLSRQNSSIGGTADLVKQESMSLGADTHYGSPNDVQSLPA
Sbjct: 361 KTRKRLKKPQPLDSLSFFAGGLSRQNSSIGGTADLVKQESMSLGADTHYGSPNDVQSLPA 420

Query: 421 TQSPKKRRRPKVEPLGNLMTSQLQKAFDDPTISSAKVSPTEQEIIPVRESQAKKTPDPIG 480
           TQSPKKRRRPKVEPLGNLMTSQLQKAFDDPTISSAKVSPTEQEIIPVRESQAKKTPDPIG
Sbjct: 421 TQSPKKRRRPKVEPLGNLMTSQLQKAFDDPTISSAKVSPTEQEIIPVRESQAKKTPDPIG 480

Query: 481 AFNGTSQKGSIESNSRKRQPSPGYPYEPLPAGVGNGDILNKQWKSLDEQPPSKKPRMQET 540
           AFNGTSQKGSIESNSRKRQPSPGYPYEPLPAGVGNGDILNKQWKSLDEQPPSKKPRMQET
Sbjct: 481 AFNGTSQKGSIESNSRKRQPSPGYPYEPLPAGVGNGDILNKQWKSLDEQPPSKKPRMQET 540

Query: 541 DLYSEVMSGSSEEYREELTRSKLNSLDEESIKSRKRTSSEKPVNSCKRRQAPAVPEQNIV 600
           DLYSEVMSGSSEEYREELTRSKLNSLDEESIKSRKRTSSEKPVNSCKRRQAPAVPEQNIV
Sbjct: 541 DLYSEVMSGSSEEYREELTRSKLNSLDEESIKSRKRTSSEKPVNSCKRRQAPAVPEQNIV 600

Query: 601 DAIKQIKEREVNRIRTTIVELGPEELTEDAIRQLKSLAIVQPVDMLRQQHTVDTVGSSPL 660
           DAIKQIKEREVNRIRTTIVELGPEELTEDAIRQLKSLAIVQPVDMLRQQHTVDTVGSSPL
Sbjct: 601 DAIKQIKEREVNRIRTTIVELGPEELTEDAIRQLKSLAIVQPVDMLRQQHTVDTVGSSPL 660

Query: 661 TFARKNYKNFKKVWPKYMNRKNSPETRNATAISNRKYLPLELYETDLQSRTLFEDGAPPR 720
           TFARKNYKNFKKVWPKYMNRKNSPETRNATAISNRKYLPLELYETDLQSRTLFEDGAPPR
Sbjct: 661 TFARKNYKNFKKVWPKYMNRKNSPETRNATAISNRKYLPLELYETDLQSRTLFEDGAPPR 720

Query: 721 QKDNISRSTSTSGLSNDLASNRGKDHPAPGSLFSNHALLGNDNAGPEPIFNFSSRSREDT 780
           QKDNISRSTSTSGLSNDLASNRGKDHPAPGSLFSNHALLGNDNAGPEPIFNFSSRSREDT
Sbjct: 721 QKDNISRSTSTSGLSNDLASNRGKDHPAPGSLFSNHALLGNDNAGPEPIFNFSSRSREDT 780

Query: 781 NSPTASPAPNLTHDNTLFVVDDENEDGDGMADTSIAQRVSRERHATTKPAEPDTAEPRHT 840
           NSPTASPAPNLTHDNTLFVVDDENEDGDGMADTSIAQRVSRERHATTKPAEPDTAEPRHT
Sbjct: 781 NSPTASPAPNLTHDNTLFVVDDENEDGDGMADTSIAQRVSRERHATTKPAEPDTAEPRHT 840

Query: 841 RRKHXXXXXXXXXXXXEDGEPTFAFKRAR 869
           RRKH            EDGEPTFAFKRAR
Sbjct: 841 RRKHAPRPSAAAADSDEDGEPTFAFKRAR 869

>Ecym_4761 Chr4 (1479649..1482045) [2397 bp, 798 aa] {ON} similar to
           Ashbya gossypii AER402C
          Length = 798

 Score =  284 bits (727), Expect = 8e-83,   Method: Compositional matrix adjust.
 Identities = 154/389 (39%), Positives = 228/389 (58%), Gaps = 11/389 (2%)

Query: 1   MWVFKCNYQKSGQLGALQNISCALCPEREFIVGRASKSTLVIEEKGVSRTHLRLEVIDDH 60
           MW+FKC YQ       L  IS  + P++ +IVGRASKS+LVI+E+GVSRTHL+L+   + 
Sbjct: 1   MWIFKCQYQNQKDPDTLNAISSVIKPDKNYIVGRASKSSLVIDERGVSRTHLQLKANRNI 60

Query: 61  VNILLLGSQLKVGGEDASKGSVLPFGPSQSPVILEVGSHSVQCILEWAQWEFKVPNTLLQ 120
           + I LLG+QLK+G +   KG    F P QSP+ LEVGSHS++C L W QWEFKVP+ L  
Sbjct: 61  IEITLLGAQLKIGHKTIEKGISCEFHPKQSPLRLEVGSHSIECKLLWTQWEFKVPSDLEI 120

Query: 121 EDPALLEVIKGLGIRVVTSFSKATTHHIIRPHEDDQDYEKYLFALVKGIPILHLEFLKQF 180
              AL ++   LGI++V S SK T+H I+R  +  +DY+KYLFALVKG+P++ + FLK  
Sbjct: 121 NYIALTKMFVQLGIKIVFSLSKETSHQIVRSRQGQKDYDKYLFALVKGLPLVEVGFLKGI 180

Query: 181 TALLRQPVTDFDPQLRSIQEQHYAFRGFTKKAADLNGLHFIVNRKHDFEMLKYTLEIGGG 240
           ++LL      F+ +++ ++ +   F  F      L GL+FIV  K +F++LKYT+E+GGG
Sbjct: 181 SSLLNSDTLKFESKVKELEREFSIFPEFNPIPNPLKGLYFIVPEKDEFDILKYTIEVGGG 240

Query: 241 TVHFCHDINDLSACLKTIPINGALALKYDHGISAEV---KKVDDTRYCEVLHSHGIQLFT 297
           TV+ C    D      TIP +  + +K  + IS  +   K  D     E  HS G +   
Sbjct: 241 TVYNCITFEDFVKVTSTIPSSKVILIKCSNNISPAIDTQKPTDHNILLEKAHSIGFKQHD 300

Query: 298 VHELTKAILYDKLAQLLSKRPPTMMKLV-----EPVPSTISQTQEMKQESLSPISLGNTT 352
             ELT A+L +   + L     +  +L+     + + +T +  ++  + ++S  S  N  
Sbjct: 301 TRELTIAVLNNNFEETLIDSSISDKRLISCNSNDKLKTTSTSLEDGLKVNVSATSGLNLN 360

Query: 353 IKDLPRKDKTRKRLKKPQPLDSLSFFAGG 381
            +  P K   ++R+   +PLDSLSFFAGG
Sbjct: 361 TEGPPAK---KRRINSVKPLDSLSFFAGG 386

 Score =  119 bits (299), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 85/246 (34%), Positives = 134/246 (54%), Gaps = 33/246 (13%)

Query: 599 IVDAIKQIKEREVNRIRTTIVELGPEELTEDAIRQLKSLAIVQPVDMLRQQHTVDT-VGS 657
           IV+AIK+IKEREV+RI+TTIVE+GP+ELTE+AI +L +LA+V+ VDMLR+  +      +
Sbjct: 526 IVNAIKEIKEREVSRIKTTIVEIGPDELTEEAICKLSTLAVVESVDMLRKTQSRHMKTET 585

Query: 658 SPLTFARKNYKNFKKVWPKYMNRKNSPETRNATAISNRKYLPLELYE----TDLQSRTLF 713
           +     R+N+K F KVWP Y+N+    +   A   SNR+ +PL++YE     +L    L 
Sbjct: 586 NKRHHVRRNFKRFVKVWPAYLNKAICQDPMGAQRYSNRQCVPLKVYEPMNKNELTDDQLV 645

Query: 714 EDGAPPRQKDNISRSTSTSGLSND--LASNRGKDHPAPGSLFSNHALLGNDNAGPEPIFN 771
           ++ +   + D ++ + ++  L ++  +AS     H           +L N    PE  F+
Sbjct: 646 DENSSEEKNDIMNETFTSDPLDHNIQMASKSIPRHHDSIYQSKYEQVLSN----PELEFS 701

Query: 772 FSS-RSREDTNSPTASPAPNLTHDNTLFVVDDENEDGDGM---------------ADTSI 815
           FS+ R+   + S T +P       N+LFVV+DE++D   +               +D SI
Sbjct: 702 FSTIRNSNSSESVTNNPG------NSLFVVEDESDDNTAVTYHNLSATSATRTEGSDVSI 755

Query: 816 AQRVSR 821
             R SR
Sbjct: 756 QARTSR 761

>SAKL0G02552g Chr7 complement(209978..212482) [2505 bp, 834 aa] {ON}
           weakly similar to uniprot|P33301 Saccharomyces
           cerevisiae YDR369C XRS2 classified as an early
           recombination function required for DNA repair but
           dispensable for mitotic recombination (xrs2 is hyper-Rec
           during vegatative growth) required for double strand
           breaks meiotic recombination and spore viability DNA
           repair protein
          Length = 834

 Score =  144 bits (362), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 114/413 (27%), Positives = 189/413 (45%), Gaps = 38/413 (9%)

Query: 1   MWVFKCNYQKSGQLGALQNISCALCPEREFIVGRASKSTLVIE-EKGVSRTHLRLEV-ID 58
           MW+ +  Y+   + G   +ISC L     + +GR++KS L I+ +K +SR H++L+V  +
Sbjct: 1   MWILR--YRYDTEDGNWCSISCCLKQGLIYDIGRSTKSPLHIKNDKSISRKHIQLKVNKE 58

Query: 59  DHVNILLLGSQLKVGGEDASKGSVLPFGPSQSPVILEVGSHSVQCILEWAQWEFKVPNTL 118
           + +N+L  G    +  E       L F P +  + LE+G   +   +EW    +KV + L
Sbjct: 59  NELNLLNTGKLTTLNAEVLMVDQSLNFHP-KGQLRLELGIKPIIATIEWQDQVWKVSHDL 117

Query: 119 LQEDPALLEVIKGLGIRVVTSFSKATTHHIIRPHEDDQDYEKYLFALVKGIPILHLEFLK 178
           L       +     GI V T+ S  T   II+ ++D   Y   LF+LVKGI I+   FL 
Sbjct: 118 LYNSMFKRQEFNSYGISVTTTMSTRTNLQIIKQNQDT--YSNCLFSLVKGIDIVRESFLS 175

Query: 179 QFTALLRQPVTDFDPQLRSIQEQHYAFRGFTKKAADLNGLHFIVNRKHDFEMLKYTLEIG 238
            F + L    TD+D   +++ ++H  F  FT   +    +  IV  K  + + KYT+E+ 
Sbjct: 176 DFQSHLYMTPTDYDGIWKNLLQKHMVFPNFTTCVSIFQNISIIVASKSIYNLFKYTIEVA 235

Query: 239 GGTVHFCHDINDLSACLK-------TIPINGALALKYDHGISAEVKKVDDTRYCEVL--- 288
           GG + +C ++      ++        I +         +  ++ +   +D R  E L   
Sbjct: 236 GGELLYCENMEKFEQFIQEAAHSKDVIILKHITEANLTNDKNSNIDMSEDARKLEELKAA 295

Query: 289 -HSHGIQLFTVHELTKAILYDKLAQLLSKRPPTMM-----------------KLVEPVPS 330
             S G +L  V++L  A+L     QLL K P  +                  + + PVP 
Sbjct: 296 AESLGYKLHDVNDLVDAVLKRDPRQLLEKIPTKISFRSEKDLEEPKLPLKIDEFITPVPD 355

Query: 331 TISQTQEMKQESLSPISLGNTTIKD--LPRKDKTRKRLKKPQPLDSLSFFAGG 381
            +S+T   K +  +  +  +  I +  +P K K   R  K +PLDSL FFAGG
Sbjct: 356 KVSETAPFKGQLENSTARNDFEIMEQKIPVKRKRTNR-SKVRPLDSLDFFAGG 407

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 78/298 (26%), Positives = 128/298 (42%), Gaps = 65/298 (21%)

Query: 599 IVDAIKQIKEREVNRIRTTIVELGPEELTEDAIRQLKSLAIVQPVDMLRQQ----HTVDT 654
           +V+AI+  K REV+R++ T++++   ELTE+AI  L +LAIV+  D++R+     H + +
Sbjct: 575 LVEAIQDTKSREVSRLKNTLIQIDKNELTENAINSLSNLAIVEKKDLIRKNSERGHCISS 634

Query: 655 VGSSPLTFARKNYKNFKKVWPKYMNRKNSPE-----TRNATAISNRKYLPLELYETDLQS 709
              + L   RKN+K F KV P+   R+          +N+  +  R+Y+PL+ ++     
Sbjct: 635 --DTCLWEGRKNFKKFIKVQPRRSQRETFDSDGKNIVKNSAFLITREYVPLKKFD----- 687

Query: 710 RTLFEDGAPPRQKDNISRSTSTSGLSNDLASNRGKDHPAPGSLFSNHALLGNDNAGPEPI 769
                    P +K+ I     T  L++  ++N G   PA        +   +D  G  P+
Sbjct: 688 ---------PNEKEQID---DTFFLNH--SANEGP-IPAQPRRIDETSNFTDDEEG--PV 730

Query: 770 FNFSSRSREDTNSPTASPAPNLT-------------HDNTLFVVDDENEDGDGMADTSI- 815
           FNF    R  +  P+ SP    T              +N LFV D+++     + D SI 
Sbjct: 731 FNF---KRTKSKDPSISPRKEHTLTNGDIEMKETSRSENRLFVTDEDDFQSLNITDNSIE 787

Query: 816 --AQRVSRERHATTKPAEPDTAE--PRHTRRKHXXXXXXXXXXXXEDGEPTFAFKRAR 869
              + +S       KP+        PR T                +D EP F F   R
Sbjct: 788 APERSISNPLRVNDKPSSGGNTSRLPRFTE-----------ASDDDDDEPRFRFSSRR 834

>KLTH0F16038g Chr6 (1302028..1304406) [2379 bp, 792 aa] {ON} weakly
           similar to uniprot|P33301 Saccharomyces cerevisiae
           YDR369C XRS2 classified as an early recombination
           function required for DNA repair but dispensable for
           mitotic recombination (xrs2 is hyper-Rec during
           vegatative growth) required for double strand breaks
           meiotic recombination and spore viability DNA repair
           protein
          Length = 792

 Score =  136 bits (343), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 111/401 (27%), Positives = 188/401 (46%), Gaps = 41/401 (10%)

Query: 1   MWVFKCNYQKSGQLGALQNISCALCPEREFIVGRASKSTLVIE-EKGVSRTHLRLEV-ID 58
           MW+ +  YQ   + G+   +SC L    +++VGR+ KS L I+ +K +SR H++LEV  +
Sbjct: 1   MWILR--YQYIDETGSEIRVSCCLKKGTQYVVGRSVKSPLQIKGDKSISRKHVQLEVRQN 58

Query: 59  DHVNILLLGSQLKVGGEDASKGSVLPFGPSQSPVILEVGSHSVQCILEWAQWEFKVPNTL 118
             + +L  G   K+GG++     +L FG  QS V LE+G+  V+  + +    +K+P+  
Sbjct: 59  SKLEVLNAGKLTKIGGDNVKMDQMLEFGADQS-VALEMGAGPVKGTVTYEPAIWKIPH-- 115

Query: 119 LQEDPALLEVIKG----LGIRVVTSFSKATTHHIIRPHEDDQDYEKYLFALVKGIPILHL 174
              D A+ E +K       I+V  S +  T+  II+ H+  + +   LFALVK IPI+  
Sbjct: 116 ---DLAITESLKNHLSLYDIQVTNSLTSKTSVQIIKEHQ--KSHGNCLFALVKKIPIMCE 170

Query: 175 EFLKQFTALLRQPVTDFDPQLRSIQEQHYAFRGFTKKAADLNGLHFIVNRKHDFEMLKYT 234
            F+  F +       DFD +   I  ++  F     K A   GL+F+V  +  F + K  
Sbjct: 171 GFIGDFVSQFADTQIDFDAKWEQITLKNAPFLELQTKDAAFKGLNFVVTNQKTFAIYKSI 230

Query: 235 LEIGGGTVHFCHDINDLSACL-KTIP----------INGALALKYDHGISAEVKKVDDTR 283
           ++ G G +  C D+++L   + K I           I  A AL  +   S  +++    +
Sbjct: 231 IDAGSGNLWLCGDVSNLGTFIEKQIKSENVVILIHLIEEAPALASEQNNSMHIQEAKLLK 290

Query: 284 YCEVLHSHGIQLFTVHELTKAILYDKLAQLLSKRPPTMMKLVEPVPSTISQTQEMKQESL 343
                 S G +   V+++  A+L + +  LL + P            +I+ +Q +     
Sbjct: 291 --NKARSLGFKTRDVNDIVDAVLKNDILSLLDRVPQEKALEENSAGGSIAGSQVLAD--- 345

Query: 344 SPISLGNTTIKDLPRKDKTRKRL-KKPQPLDSLSFFAGGLS 383
                    + D P     RKR  ++ QPL+SL+FF GG S
Sbjct: 346 --------IVADAPNLRNKRKRANRQIQPLNSLAFFGGGSS 378

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 73/118 (61%), Gaps = 11/118 (9%)

Query: 597 QNIVDAIKQIKEREVNRIRTTIVELGPEELTEDAIRQLKSLAIVQPVDMLRQ-----QHT 651
           ++++ A ++ K+ EV+R++  + ++G EELTE+AI +L +LA V+ VD++R+     +++
Sbjct: 526 RSLIQAFQEAKQHEVHRLKKNMADVGSEELTEEAINKLDNLASVEKVDLMRRPSEVPENS 585

Query: 652 VDTVGSSPLTFARKNYKNFKKVWPKYMNRKNSPE-----TRNATAISNRKYLPLELYE 704
              + ++P    RKN+K F K+WP + +R +SP+      RN   +  R Y+ L  Y+
Sbjct: 586 NQRILTNPQWARRKNFKKFVKLWPSHSSR-SSPDNITDAVRNKAYLITRDYVSLCPYD 642

>Kwal_55.21422 s55 (830578..832926) [2349 bp, 782 aa] {ON} YDR369C
           (XRS2) - DNA repair protein [contig 130] FULL
          Length = 782

 Score =  127 bits (318), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 104/397 (26%), Positives = 187/397 (47%), Gaps = 35/397 (8%)

Query: 1   MWVFKCNYQKSGQLGALQNISCALCPEREFIVGRASKSTLVIE-EKGVSRTHLRLEVIDD 59
           MW+ +  YQ     G   ++SC L    ++ +GR++K+ L I+ +K +SR H+ LEV D 
Sbjct: 1   MWILR--YQYVAGNGMDVHVSCCLKQGLQYSIGRSTKNPLQIKSDKSISRNHVELEV-DQ 57

Query: 60  HVNILL--LGSQLKVGGEDASKGSVLPFGPSQSPVILEVGSHSVQCILEWAQWEFKVPNT 117
             N++L  +G   KV G+    G  L F   +  V+ E+G+  ++  +   Q  +K+P+ 
Sbjct: 58  SCNVVLRVVGKLTKVSGKSVKAGQHLQFTADEE-VLFEMGASPIKATVVKQQSFWKIPHD 116

Query: 118 LLQEDPALLEVIKGLGIRVVTSFSKATTHHIIRPHEDDQDYEKYLFALVKGIPILHLEFL 177
           L     +L   +    I+V  S S  T+  II+  +  + +   LF+L+K IPIL   F+
Sbjct: 117 L-SLSQSLSRHLADFDIQVTNSLSSTTSIQIIK--DSSKSFSNCLFSLIKNIPILREHFI 173

Query: 178 KQFTALLRQPVTDFDPQLRSIQEQHYAFRGFTKKAADLNGLHFIVNRKHDFEMLKYTLEI 237
             F   +     DFD +   +  ++  F  +  +      +HF+V  +  F + K+ ++ 
Sbjct: 174 GDFVTQINDVHADFDSRWDRMVVENAQFPNYKCECRPFTTIHFLVTNRRAFAIFKHIIDA 233

Query: 238 GGGTVHFCHDINDLSACL--KTIPINGALALKYDHGISAEVKKVD----DTRYCEVLHSH 291
           G GT+  C DI++L   +  K    N  L +  ++G S+          D +  ++L + 
Sbjct: 234 GSGTLWLCDDISNLDHFIKHKITSDNVILLVHLNNGKSSISSTEQSSDLDVQEAKLLKNK 293

Query: 292 ----GIQLFTVHELTKAILYDKLAQLLSKRPPTMMKLVEPVPSTISQTQEMKQESLSPIS 347
               G ++  V+++  A+L     +LL + P      V  +PS       +++      +
Sbjct: 294 AQNLGFRIHDVNDIVGAVLDHNFEKLLERVP------VRNLPSKAPTGFPLEE------A 341

Query: 348 LGNTTIK--DLPRKDKTRKRL-KKPQPLDSLSFFAGG 381
              + IK  D P+    RKR  ++  PLDSL+FF GG
Sbjct: 342 TNKSVIKSADTPKPSNKRKRTNRQVVPLDSLAFFGGG 378

>YDR369C Chr4 complement(1215016..1217580) [2565 bp, 854 aa] {ON}
           XRS2Protein required for DNA repair; component of the
           Mre11 complex, which is involved in double strand
           breaks, meiotic recombination, telomere maintenance, and
           checkpoint signaling
          Length = 854

 Score =  121 bits (304), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 204/866 (23%), Positives = 350/866 (40%), Gaps = 207/866 (23%)

Query: 1   MWVFKCNYQKSGQLGALQNISCALCPEREFIVGRASKSTLVIE-EKGVSRTHL--RLEVI 57
           MWV +  YQ + + G++  ISC L   + + +GR+SK+ L+I+ +K +SR H+  + E+ 
Sbjct: 1   MWVVR--YQNTLEDGSISFISCCLQAFKTYSIGRSSKNPLIIKNDKSISRQHITFKWEIN 58

Query: 58  DD----HVNILLL--GSQLKVGGEDASKGSVLPFGPSQ--SPVILEVGSHSVQCILEWAQ 109
           +     H ++ L+  G    +  +    G       S      I+E+G+  ++   EW  
Sbjct: 59  NSSDLKHSSLCLVNKGKLTSLNKKFMKVGETFTINASDVLKSTIIELGTTPIRIEFEWIN 118

Query: 110 WEFKVPNTLLQEDPALLEVIKGLGIRVVTSFSKATTHHIIRPHEDDQDYE-KYLFALVKG 168
             + +P  L Q    L E     GI    S +    + +I  +   +D   + L+ALV  
Sbjct: 119 EVWNIPPHLTQFRTMLSE----YGISTEISINDIPANLMISDYPKSEDNSIRELYALVST 174

Query: 169 IPI------------------LHLEFLKQFTALLRQP---VTDFDPQLRSIQEQHYAFRG 207
           IP+                   +L+F + +  ++  P   V DFDP +            
Sbjct: 175 IPMKKSRFLMELCNTLLPTSKTNLKFDEMWNDMISNPEYNVFDFDPNI------------ 222

Query: 208 FTKKAADLNGLHFIVNRKHDFEMLKYTLEIGGGTVHFCHDINDLSACLKTIPINGALALK 267
              K   LN +  +   K +                       LS+ L+T  IN      
Sbjct: 223 LLSKFMRLNNIRVLTTIKSEPR---------------------LSSLLRTFNIN---LFA 258

Query: 268 YDHGISAEVKKVDD----TRYCEVLHS----HGIQLFTVHELTKAILYDKLAQLLSKRPP 319
           +D+ I +  K VD     T Y  +  +    +G  L T+  +  +I+   L+ +++ +  
Sbjct: 259 FDN-IDSLYKYVDSLEASTEYLILTTTDKKENGKILCTIKTMLTSIIDGTLSAVINMKGA 317

Query: 320 TMMKL-------VEPVPSTISQTQEMKQESLSPISLGNTTIKDLPRKDKTRKRLKKPQPL 372
           +   L       +    STI +T    +   SP+         + +K K  +R  +  PL
Sbjct: 318 SSRTLDNGKFDQISEGMSTILKTSRAPEVEASPV---------VSKKRKLNRR--RVLPL 366

Query: 373 DSLSFFAGGLSRQNSSIGGTADLVKQESMSLGADTHYGSPNDVQSLPATQSPKKRRRPKV 432
           DSL FFAGGLS +  ++     L   + ++ GA++                         
Sbjct: 367 DSLDFFAGGLSTK--TLSENRSLTDAKRLNCGAESK------------------------ 400

Query: 433 EPLGNLMTSQLQKAFDDPTISSAKVSPTEQEIIPVRESQAKKTPDPIGAFNGTSQKGSI- 491
                              ISS  ++  +++  P  ++  K T D IG  +G S  G+I 
Sbjct: 401 -----------------TVISSPNIAEADEKHAPFLQNALKPTED-IGKKSGHSSPGAII 442

Query: 492 ------------ESNSRKRQPSPGYPYEPLP--AGVGN-------GDILNKQWKSLDEQP 530
                       E +  K   S   P   LP  AG+G+        D       S+D+  
Sbjct: 443 VSSPNLGTVNTSEDSLDKSLQSHKLPQPSLPEVAGIGSQTISSNSADYETAAVNSMDDAE 502

Query: 531 PSKKPRMQETDLYSEVMSGSSEEYREELTRSKLNSLDEESIKSRKRTSSEKPVNSCKRRQ 590
            +K  R+     + + +   S+  R      KL++   E I S  + + + PV     ++
Sbjct: 503 VTKNFRVN----HHQNIEQPSKNIR------KLSNYSRE-ISSPLQENCKSPVKELSIKE 551

Query: 591 APAVPEQNIVDAIKQIKEREVNRIRTTIVELGPEELTEDAIRQLKSLAIVQPVDMLRQQH 650
               P    V+AI++ K REV R+++TIVEL  EEL+E+AI QLK+LAIV+P + L ++ 
Sbjct: 552 KSGTPHA-FVEAIQETKNREVKRVKSTIVELKDEELSEEAINQLKNLAIVEPSNNLLRK- 609

Query: 651 TVDTVGS--------------SPLTFARKNYKNFKKVWPKYM--------NRKNSPETRN 688
           + D+ G+               P    RKN+K F KV PK          N ++S   RN
Sbjct: 610 SFDSEGNKTSRTTEKWENSLMEPEWHKRKNFKTFVKVRPKSKAHKEEGKNNTQSSDFIRN 669

Query: 689 ATAISNRKYLPLELY-ETDLQSRTLFEDGAPPRQKDNISRSTSTSGLSNDLASNRGKDHP 747
           A  +  R Y+PL+ Y + D  ++   E+         + R  S + +S+++ SN  +   
Sbjct: 670 AAFLITRNYVPLKKYSKKDTTTKWGTEENEDMFALTEMERFGSNTFMSDNINSNTIQKRS 729

Query: 748 APGSLFSNHALLGNDNAGPEPIFNFS 773
              + F+N     + N G E  F+FS
Sbjct: 730 QALNRFTNE---DSSNEGEEDSFSFS 752

>KAFR0E03830 Chr5 (759871..762408) [2538 bp, 845 aa] {ON} Anc_5.435
           YDR369C
          Length = 845

 Score =  118 bits (296), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 185/767 (24%), Positives = 325/767 (42%), Gaps = 144/767 (18%)

Query: 1   MWVFKCNYQKSGQLGALQNISCALCPEREFIVGRASKSTLVIE-EKGVSRTHL--RLEVI 57
           MW+ +  Y+   + G L+ +SC L   + + +GR+SK+ L I+ +K +SR H+  R +  
Sbjct: 1   MWILR--YENELEDGTLRKVSCCLQKWKMYSIGRSSKNPLTIKNDKSISRQHITIRWDCN 58

Query: 58  DDHV-NILLLGSQLKVGGED----ASKGSVLPFGPSQSPVILEVGSHSVQCILEWAQWEF 112
           ++    +L + +Q K+   D     S  S      + S V++++G+  V   + W    +
Sbjct: 59  NEGTGTVLSVVNQGKLTAIDENYMKSDESKAFDDETYSTVVVKLGTKPVVVRISWTPIFW 118

Query: 113 KVPNTLLQEDPALLEVIKGLGIRVVTSFSKATTHHI-IRPHEDDQDYEKYLFALVKG--- 168
            +    LQ + +    I  +GI   T    +    I +  +++  ++ + +FAL+K    
Sbjct: 119 DLSKDFLQFEKS----INSMGI--CTQMQSSNVRDISLVINDEKSNWSRIMFALLKQNCT 172

Query: 169 --IPILHLEFLKQFTALLRQPVTDFD---PQLRSIQEQHYAFRGFTKKAADL----NGLH 219
              P+L  E       LL    T+FD    QL      +  + GFT +  D+      + 
Sbjct: 173 LVKPVLLSEVCN---VLLADCQTNFDEIWAQLFESFSNYTVYPGFTVEGNDILRAFQDVQ 229

Query: 220 F--IVNRKHD-FEMLKYTLEIGGGTVHFCHDINDLSACLKTIPIN--GALALKYDHGISA 274
           F  + +  HD    LK T+    G        +DL   +KT+  N    +ALK +     
Sbjct: 230 FYTVGSISHDDLLYLKATVSELQGNFKSFDTADDLVTYIKTVNHNLLKCIALKQEDPAPD 289

Query: 275 EVKKVDDTRYCEVLHSHGIQLFTVHELTKAIL---------------------------- 306
           E++              GI+++ + E+ +AIL                            
Sbjct: 290 EIQ--------------GIKIYAIKEIVQAILDGNFKNLPTHIGRSNTSRKRNFTDSISH 335

Query: 307 YDKLAQLLSK-RPPTMMKLVEPVPSTISQTQEMKQE---SLSPISLGNTTIKDLPRKDKT 362
           Y++ AQ  S   P     L     +TIS   E  +E   SL P ++        P   K 
Sbjct: 336 YNEDAQRNSHVHPDNTSTLNTNTHATISAAAEASREGGESLEPPTVMG------PSPTKR 389

Query: 363 RKRLKKP-QPLDSLSFFAGGLSRQNSSIGGTADLVKQESMSLGADTHYGSPNDVQSLPAT 421
           R+ +++  +PLDSLSFFAGG +  ++++   + +V   + +  +D     PN V+S    
Sbjct: 390 RRLVRRTVKPLDSLSFFAGGSTNPSTTLKTVSPVVPSNASNTTSDEK---PNKVESKLGV 446

Query: 422 QSPKKRRRPKVEPLGNLMTSQLQKAFDDPTISSAKVSPTEQEIIPVRESQAKKTPDPIGA 481
            +   RR  +     +++ + LQ     PT +              R  Q K      G 
Sbjct: 447 NNA--RRDEQTNDQVDVVQTALQSLSSQPTTN--------------RSIQNK------GI 484

Query: 482 FNGTSQKGSIESNSRKRQPSPGYPYEPLPAGVGNGDILNKQWKSLDEQPPSKKPRM-QET 540
               +    + + S KR+     P +PL   V    ++         QP      + QET
Sbjct: 485 LRTENNDEMLTNASIKRR---NMPLKPLSPDVDTNLLI---------QPIDSNSNVSQET 532

Query: 541 DLYSEVMSGSSEEYREELTRSKLNSLDEESIKSRKRTSS--EKPVNSCKRRQAPAVPEQN 598
           ++  E M  +        T S++N     +I SRK  S   +  V+  KR ++PA     
Sbjct: 533 NVPKESMEDNDNSSN---TLSEVN----RNILSRKSESGPHKFDVSLTKRSKSPAA---- 581

Query: 599 IVDAIKQIKEREVNRIRTTIVELGPEELTEDAIRQLKSLAIVQPV-DMLRQQHTVDTVGS 657
            ++A++  K REV RIRT IV++ P EL+E+AI +L +L IV+   +++R++        
Sbjct: 582 FIEAVQSTKTREVKRIRTKIVDVSPSELSEEAINKLSNLTIVESNPNLIRERRADKNDSV 641

Query: 658 SPLTFARKNYKNFKKVWPKYMNRKNSPETRNATAISNRKYLPLELYE 704
           + +   R+N+K F KVWP++  R      RN   +  R Y+ L+ Y+
Sbjct: 642 NDMWKGRRNFKKFNKVWPQH--RDGYDSLRNNAFLIIRNYVELKPYD 686

>KLLA0E02201g Chr5 complement(205466..207973) [2508 bp, 835 aa] {ON}
           weakly similar to uniprot|P33301 Saccharomyces
           cerevisiae YDR369C XRS2 classified as an early
           recombination function required for DNA repair but
           dispensable for mitotic recombination (xrs2 is hyper-Rec
           during vegatative growth) required for double strand
           breaks meiotic recombination and spore viability DNA
           repair protein
          Length = 835

 Score =  110 bits (275), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 96/393 (24%), Positives = 177/393 (45%), Gaps = 46/393 (11%)

Query: 1   MWVFKCNYQKSGQLGALQNISCALCPEREFIVGRASKSTLVIE-EKGVSRTHLRLEVIDD 59
           MW+    +    +      +  AL    E+ +GR++K T  I+ +K +SR HL ++    
Sbjct: 1   MWIVSFIFDDEAEKS--HKVCKALQYGVEYSIGRSAKCTFRIQTDKSISRVHLLIKFDGS 58

Query: 60  HVNILLLGSQLKVGGEDASKGSVLPFGPS----QSPVILEVGSHSVQCILEWAQWEFKVP 115
            + I   G   K   E      ++P   +        ++ +G   +   + +   E+K+P
Sbjct: 59  DLIITNKGKLTKFNEE------IIPLDETIVVHNQNTVINIGGMPIDVNVRYFYEEWKIP 112

Query: 116 NTL-LQEDPALLEVIKGLGIRVVTSFSKATTHHIIRPHEDDQDYEKYLFALVKGIPILHL 174
           + L L E  +L   +   G+++  SFSK TT  I     D   Y   LFAL+KG+P++ +
Sbjct: 113 HRLELNETKSL---VSDFGVKLSESFSKKTTTQIC---SDSSSYSGCLFALLKGVPVVSI 166

Query: 175 EFLKQFTALLRQP-VTDFDPQLRSIQEQHYAFRGFTKKAADLNGLHFIVNRKHDFEMLKY 233
           EFL Q   LL+Q    DF    + +  +H  F  +      L+ +  IV  +  ++ L+Y
Sbjct: 167 EFLNQMGKLLQQGNYLDFQSMYQGLLNRHKLFPSYRYVPNVLSNMTLIVFEQKMYDTLRY 226

Query: 234 TLEIGGGTVHFCHDINDLSACLKT-----IPINGALALKYDHGISAEVKKVDDTRYCEVL 288
           T+E+GGG      + ++L   L T     + +  +++ K +   +  +++ D +   E  
Sbjct: 227 TIEVGGGDAKLLANSSELDKFLSTNHEPAVVLGSSISQKMNSESTKLLEEFDKS-IAETS 285

Query: 289 HSHGIQLFTVHELTKAILYDKLAQLLSKRPPTMMKLVEPVPSTISQTQEMKQESLSPISL 348
             HG++L  +++    +L +K+  L   +   ++ L  P P      Q+ K +S      
Sbjct: 286 LRHGVKLLNINQFVNILLENKINGL---KKRDVVDLTSPSP-----VQQKKIQSAKASVN 337

Query: 349 GNTTIKDLPRKDKTRKRLKKPQPLDSLSFFAGG 381
           G        +K K++  +   Q LDSL+FF GG
Sbjct: 338 G--------KKTKSKPNI---QSLDSLNFFGGG 359

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 57/113 (50%), Gaps = 8/113 (7%)

Query: 598 NIVDAIKQIKEREVNRIRTTIVELGPEELTEDAIRQLKSLAIVQPVDML-RQQHTVDTVG 656
           NI+ AI + K++EV R++  I+E+   ELTE A+   K  A +  + +  R   ++    
Sbjct: 593 NIITAIAETKQKEVKRLQEGIIEVDQSELTESALIDFKDAAKINTIQIKPRVLASIPISN 652

Query: 657 SSPLTFARKNYKNFKKVWPKYMNRKN----SPETRNATAISNRKYLPLELYET 705
            +     RKN+K FKK WP Y+ R      S  T N      R+Y+ +  Y++
Sbjct: 653 GNTKWLGRKNFKKFKKNWPSYLRRTTEGLCSDNTSNQIG---REYITMRKYDS 702

>ZYRO0F10054g Chr6 complement(814872..816854) [1983 bp, 660 aa] {ON}
           weakly similar to uniprot|P33301 Saccharomyces
           cerevisiae YDR369C XRS2 classified as an early
           recombination function required for DNA repair but
           dispensable for mitotic recombination (xrs2 is hyper-Rec
           during vegatative growth) required for double strand
           breaks meiotic recombination and spore viability DNA
           repair protein
          Length = 660

 Score =  109 bits (272), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 108/418 (25%), Positives = 186/418 (44%), Gaps = 74/418 (17%)

Query: 1   MWVFKCNYQKSGQLGALQNISCALCPEREFIVGRASKSTLVIE-EKGVSRTHLRL--EVI 57
           MW+ +  YQ   + G L+++SC L     + +GR+SK+ L I+ +K +SR H+ +  +  
Sbjct: 1   MWILR--YQYDLEDGNLKHVSCCLRLGETYNIGRSSKNLLNIKNDKSISRQHVSICWDGK 58

Query: 58  DDHVNILLLGSQLKVGGEDASKGSVLPFGPSQSPVILEVGSHSVQCILEWAQWEFKVPNT 117
           D  + ++  G    V  +    G  + FG S   V++E+G+  ++  L+W    + VP  
Sbjct: 59  DRQLKLINQGKMTAVSEKYLKMGESISFGKSMGTVLVELGTKPLKMQLQWMDSIWMVPQG 118

Query: 118 LLQEDPALLEVIKGLGIRVVTS-FSKATTHHIIRPHEDDQDYEKYLFALVKGIPILHLEF 176
              +  AL E    LGI V++S  S+A    I    ++ Q+Y ++L+ LVK IP+++LEF
Sbjct: 119 SRSDHSALEE----LGIEVLSSELSRANLIVI----DEQQNYSRWLYGLVKRIPLMNLEF 170

Query: 177 LKQFTALLRQPVTDFDPQLRSI-QEQHYAFRGFTKKAADLNGLHFI-VNRKHDFEMLKYT 234
           L   +  +    T+FD     I  +    ++ +  +A  L  L F+ V +  D  +    
Sbjct: 171 LNVVSQKVSGHETEFDSIWTKIMNDGSLRYKSWEVQAQVLQNLEFLTVGKDEDTSL---A 227

Query: 235 LEIGGGTVHFCHDINDLSACLKTI-PINGALALKYDHGISAEVKKVDDTRYCEVLHSHGI 293
           +E  GG       + +L   +K    ++  + LK     + E+  +  T           
Sbjct: 228 IEAAGGKYSAVLSVEELREAVKRKGDLSNVVILKSHLTPAEELAPLGKT----------- 276

Query: 294 QLFTVHELTKAILYDKLAQL-------LSKRPPTMMKLVEPVPSTISQTQEMKQESLSPI 346
             FTV ++ +AIL D++  L       ++KRP   + + +PV                  
Sbjct: 277 --FTVQDVVEAILKDEVNSLKNGVIGEVAKRPEAEVPMEKPVTK---------------- 318

Query: 347 SLGNTTIKDLPRKDKTRKRLKKP--QPLDSLSFFAGGLSRQNSSIGGTADLVKQESMS 402
                           ++RL +P  +PLD LSFFAGG S + S    T  L  QE  S
Sbjct: 319 ----------------KRRLNRPRVKPLDILSFFAGGDSMKESQGESTMKLNSQEEES 360

 Score = 80.9 bits (198), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 59/156 (37%), Positives = 89/156 (57%), Gaps = 18/156 (11%)

Query: 577 TSSEKPVNSCKRRQAPAV--------PEQN-IVDAIKQIKEREVNRIRTTIVELGPEELT 627
           +++EKP N+   R+ P +        P QN ++  I+  K  EV R+ +TI+++G EELT
Sbjct: 430 SAAEKPNNARPHRK-PTLSDYRKGESPSQNDMIQMIQDTKNHEVKRLNSTIIQVGDEELT 488

Query: 628 EDAIRQLKSLAIVQPVD-MLRQQHTVDTVGS-SPLTFARKNYKNFKKVWPKY-----MNR 680
           EDAI QL +L +V   D ++R++    TV S +P    RKN+KNF KVWPKY      +R
Sbjct: 489 EDAINQLGNLVLVDRNDNLMRRRDRSPTVDSHNPNWNNRKNFKNFVKVWPKYGGQDSTSR 548

Query: 681 KNSPET-RNATAISNRKYLPLELYETDLQSRTLFED 715
           + S +T RN   +  R+Y+P   Y +   S+   ED
Sbjct: 549 EGSSDTIRNRAFLLTRQYVPTRTYTSGDSSKQAQED 584

>TDEL0E01900 Chr5 (359266..361554) [2289 bp, 762 aa] {ON} Anc_5.435
           YDR369C
          Length = 762

 Score = 98.6 bits (244), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 110/406 (27%), Positives = 180/406 (44%), Gaps = 55/406 (13%)

Query: 1   MWVFKCNYQKSGQLGALQNISCALCPEREFIVGRASKSTLVIE-EKGVSRTHLRLEVIDD 59
           MW+ K  Y+     G ++ +S  L  ++ F +GR+SK+ L I+ +K +SR H+ + V D 
Sbjct: 1   MWILKYTYELED--GTIRRVSSCLVKQQTFSIGRSSKNPLNIKNDKSISRNHISV-VWDS 57

Query: 60  HVNILLLGSQLKVGGEDASKGSVLPFGPS---------QSPVILEVGSHSVQCILEWAQW 110
            V ++ L +Q   G   A+ G  L  G S         + P+I+E+G+  ++  + W   
Sbjct: 58  EVKLIRLINQ---GRLTAAGGKYLKVGESMDFEEKLHIREPIIIELGTKPIKVEVVWQDV 114

Query: 111 EFKVPNTLLQEDPALLEVIKGLGIRVVTSFSKATTHHIIRPHEDDQDYEKYLFALVKGIP 170
            F +P+ L Q    L  V  G+G++  T  +++TT  II   +    Y K LF L+ G  
Sbjct: 115 VFDLPSQLSQFIDTLDHV--GIGVKADTVDNRSTT--IIVTDKIKFAY-KCLFGLINGAV 169

Query: 171 ILHLEFLKQFTALLRQPVTDFDPQLRS-IQEQHYAF--RGFTKKAADLNGLHFIVNRKHD 227
           I + +FL + T +L +P T F+    S IQ + Y             L G  F +     
Sbjct: 170 IRNSQFLVEVTNILSKPTTTFEESWDSLIQNESYMLYPNNLGPHEVILKGYKFYLIASDV 229

Query: 228 FEM--LKYTLEIGGGTVHFCHDINDLSACLKT-IPINGALALKYDHGISAEVKKVDDTRY 284
             M  ++  LE G G +    +   L   LK     +  + LK     + E  K+   + 
Sbjct: 230 ITMAYVQEALERGNGELIVVENTEQLLDRLKQENSTDDLIVLK-----AEETTKIPGDK- 283

Query: 285 CEVLHSHGIQLFTVHELTKAILYDKLAQLLSKRPPTMMKLVEPVPSTISQTQE---MKQE 341
                   I+L T+ +L  A+ ++ +  LL   PP     +E  P  +  + +    K E
Sbjct: 284 --------IKLHTLVDLVNAVSHNTVKTLLGGVPP-----MEAGPGDVIGSHQPTLTKTE 330

Query: 342 SLSPISLGNT------TIKDLPRKDKTRKRLKKPQPLDSLSFFAGG 381
             S  SL N       T+    +    R+R  + +PLDSL FFAGG
Sbjct: 331 VSSSQSLSNKEHTPEHTVTPAEKPPVKRRRYNRVKPLDSLMFFAGG 376

 Score = 81.3 bits (199), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 72/120 (60%), Gaps = 13/120 (10%)

Query: 597 QNIVDAIKQIKEREVNRIRTTIVELGPEELTEDAIRQLKSLAIVQPVDMLRQQHTVDTVG 656
           + +VD IK  K REV R+++T+V++  +ELTEDAI QL  LAIVQP D L ++  +D+  
Sbjct: 516 EGLVDLIKDAKSREVKRLKSTLVQVDTDELTEDAINQLGDLAIVQPNDSLIRRQKIDSAE 575

Query: 657 SS-----PLTFARKNYKNFKKVWPKYMNRK--------NSPETRNATAISNRKYLPLELY 703
           +S     P    RKN+KNF KV  KY  ++        +S   RN+  +  R+Y+P ++Y
Sbjct: 576 TSRNDQHPPWDGRKNFKNFVKVQAKYKEQRMGENYREGSSDFIRNSGYLLTRQYVPSKIY 635

>NDAI0B05680 Chr2 complement(1384354..1386924) [2571 bp, 856 aa]
           {ON} Anc_5.435 YDR369C
          Length = 856

 Score = 98.6 bits (244), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 169/768 (22%), Positives = 302/768 (39%), Gaps = 162/768 (21%)

Query: 1   MWVFKCNYQKSGQLGALQNISCALCPEREFIVGRASKSTLVIE-EKGVSRTHLRLEVI-D 58
           MW+ +  YQ   + G ++ +S  L     + +GR+SK+ L I+ +K +SR H+ ++    
Sbjct: 1   MWILR--YQYGLEDGGIKKVSICLERSIAYSIGRSSKNPLSIKNDKSISRQHITIKWEPS 58

Query: 59  DHVNILLLGSQLKVGGEDASKGSVLPFGPSQSPVI-LEVGSHSVQCILEWAQWEFKVPNT 117
             ++++  G    V     +    L F    +  + + +G++ V   + W      +PN 
Sbjct: 59  GQLHLVNQGKLTSVKERYLAIDESLIFNVVDTKELDVHLGTNPVIVQIRWQPMNLYIPN- 117

Query: 118 LLQEDPALLEVIKGL----GIRVVTSFSKATTH---HIIRPHEDDQDYEKYLFALVKGIP 170
                  + E  +GL    GI V +   +  +H    ++ P+    DY   L AL  GIP
Sbjct: 118 -------MYEQFRGLLTKYGIEVTSDILQEDSHITAVVMTPN----DYYVPLLALALGIP 166

Query: 171 ILHLEFLKQFTALLRQPVTDFDPQLRSIQEQHY-----AFRGFTKKAADLNGLHFIV--N 223
           +   ++L + + +LR     FD  ++ I          +F              FI+  N
Sbjct: 167 VFKSQYLTEVSNMLRPDNITFDTDVQKINSMESLKLVPSFSLSNNSKNFFQDYFFIITLN 226

Query: 224 RKHDFE------MLKYTLEIGGGTVHFCHD----INDLSACLKTIPINGALALKYDHG-- 271
           +    E      +L+ +L++ GG      D     N ++  L T   N  +    D+G  
Sbjct: 227 KSSVSEHADKSFILRKSLQLIGGEEEIIKDPTELQNSVTKILSTSGKNIVIVTDEDNGKR 286

Query: 272 --ISAEVKKVDDTRYC------EVLHSHGIQLFTVHELTKAILYDKLAQLLSKRPPTMMK 323
             ++ E + V D          ++L S+  +   V      I  ++   +  + PP    
Sbjct: 287 MIMNFECRNVKDIFDSFVKNDPKLLKSNLTETGVVSPKAPEIFENEKLMVEIQEPPIEAA 346

Query: 324 LVEPVPSTISQTQEMKQESLSPISLGNTTIKDLPRKDKTRKRLKKPQPLDSLSFFAGGLS 383
           + E   S+    + +K     P+     T   + ++   RKR+K   PL+SL FF GG  
Sbjct: 347 ITEESTSS----KNLKHTPPEPV-----TTHIVKKRRLARKRVK---PLESLDFFVGG-- 392

Query: 384 RQNSSIGGTADLVKQESMSLGADTHYGSPNDVQSLPATQSPKKRRRPKVEPLGN--LMTS 441
                                  +  G+P +  S    Q   + + P V P+ N  +  S
Sbjct: 393 -----------------------STTGTPFETSSTTLQQEIIEPKVPDVAPILNEQIQQS 429

Query: 442 QLQKAFDDPTISSAKVSPTEQEIIPVRESQAKKTPDPIGAFNGTSQKGSIESNSRKRQPS 501
           Q+ K+ ++P           ++I  +  S  K+T     A    +    ++  +++    
Sbjct: 430 QVNKSINEPA----------KDIYSIGGSDRKET----AALTYATIDKHMQEPTQQIDDI 475

Query: 502 PGYPYEPLPAGVGNGDILNKQWKSLDEQPPSKKPRMQETDLYSEVMSGSSEEYREELTRS 561
           P    +  P G  N            EQ               E  S SSE  +  +   
Sbjct: 476 PSQHIDISPHGNSN------------EQ---------------EKRSNSSE--KSPMITQ 506

Query: 562 KLNSLDEESIKSRKRTSSEKPVNSCKRRQAPAVPEQNIVDAIKQIKEREVNRIRTTIVEL 621
           ++N   +E I + K     K  +S  +R +   P +++V+ I+ IK REV R++++I  +
Sbjct: 507 QVNDEKDEKISNAKALKIGKREDS--KRYSETTP-KSMVETIQDIKNREVTRLQSSIAHV 563

Query: 622 GPEELTEDAIRQLKSLAIVQP-VDMLRQQHTVDTVGSSPLTF--------------ARKN 666
             EELTEDAI +  +LAIV+    ++R+    D    S  +                R+N
Sbjct: 564 DAEELTEDAINEFSNLAIVESNASLIRRTENNDNTNKSTNSVVRHDSPDNIMNVLEGRRN 623

Query: 667 YKNFKKVWPKYMNRKN-----------SPETRNATAISNRKYLPLELY 703
           +K F KV+PKY+  KN           S   RN   +  R Y+PL+ Y
Sbjct: 624 FKRFVKVYPKYIQNKNDSNNERGDNGASDFIRNNAFLITRNYVPLKQY 671

>Skud_4.638 Chr4 complement(1137885..1140416) [2532 bp, 843 aa] {ON}
           YDR369C (REAL)
          Length = 843

 Score = 92.8 bits (229), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 139/485 (28%), Positives = 212/485 (43%), Gaps = 115/485 (23%)

Query: 370 QPLDSLSFFAGGLSRQNSSIGGTADLVKQESMS--LGADTHYGSPNDVQSLPATQSPKKR 427
           QPLDSLSFFAGGLS ++SS     D    E +S  LG  T   SPN +  +  T S   R
Sbjct: 363 QPLDSLSFFAGGLSSKSSS--EHQDFADAEKLSPGLGLKTVISSPN-IGRMDETSSLAVR 419

Query: 428 RRPKVEPLGNLMTSQLQKAFDDPTISSAKVSPTEQEIIPVRESQAKKTP--DPIGAFNGT 485
              KV+   N      QK+     ISS ++         + E    K P   P+     T
Sbjct: 420 NIQKVDE--NNEKENGQKSTGAIVISSPELYAEH-----ISEDSEDKPPRLSPL-----T 467

Query: 486 SQKGSIESNSRKRQPSPGYPYEP--LPAGVGNG-----DILNKQWKSLDE--QPPSKKPR 536
             +  ++SN    + +P +  E   +     NG     DI+    ++L+E  +PP +   
Sbjct: 468 VTRPGLQSNPLISRTTPAHYMEDKRIAENYENGKSSTRDII----QTLEENHEPPEQS-- 521

Query: 537 MQETDLYSEVMSGSSEEYREELTRSKLNSLDEESIKSRKRTSSEKPVNSCKRRQAPAVPE 596
            QE + YS+V                    D +S           PV    +++    P 
Sbjct: 522 -QEKNSYSQV--------------------DRKS-----------PVKELLQKRKSNTP- 548

Query: 597 QNIVDAIKQIKEREVNRIRTTIVELGPEELTEDAIRQLKSLAIVQP-VDMLRQQHTVDTV 655
            + V+AI++ K REV R ++TIV+L  +EL+E+ I QLK+LAIV+P  D+LR+   + T 
Sbjct: 549 LSFVEAIQETKNREVERFKSTIVQLEDDELSEEGINQLKNLAIVEPNEDLLRKPQILGT- 607

Query: 656 GSSPLTFA--------------RKNYKNFKKVWPKYM--------NRKNSPETRNATAIS 693
            +S  T A              RKN+K F KVWPK+         + +NS   R+A  + 
Sbjct: 608 -NSVRTRAQKNESGIMRQEWHERKNFKTFIKVWPKFKMQNEGNKGDTQNSDFIRSAAFLI 666

Query: 694 NRKYLPLELYETDLQSRTL----FEDGAPPRQKDNISRSTSTSGLSNDLASNRGKDHPAP 749
            R Y+PL  Y  + ++        ED     + +N+  +T  SG ++     +G   P  
Sbjct: 667 TRNYVPLRKYSKNNKATECNGKENEDMLGLIEMENLVSNTGVSGNTSSAVIQQG---PRT 723

Query: 750 GSLFSNHALLGNDNAGPEPIFNFSSRSREDTNSPTASPAPNLTHDNTLFVVDDENEDGDG 809
            + F N  +    + G +  F+FS       +S  A PA      N LFV +D  +D + 
Sbjct: 724 QNTFINEDI---SDEGNQQSFSFSR------HSDIAQPAK-----NKLFVTED--DDKNN 767

Query: 810 MADTS 814
           M + S
Sbjct: 768 MVNDS 772

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 46/190 (24%), Positives = 87/190 (45%), Gaps = 20/190 (10%)

Query: 1   MWVFKCNYQKSGQLGALQNISCALCPEREFIVGRASKSTLVIE-EKGVSRTHLR------ 53
           MWV +  YQ + + G + +ISC L   + + +GR+SK++L+I+ +K +SR H+       
Sbjct: 1   MWVIR--YQNTVEDGHISHISCCLQASKSYSIGRSSKNSLIIKNDKSISRQHITFKWEIN 58

Query: 54  --LEVIDDHVNILLLGSQLKVGGEDASKGS-VLPFGPSQSPV-ILEVGSHSVQCILEWAQ 109
             L +   H++++  G    +  +    G   + + P  S +  +E+G+      + W  
Sbjct: 59  GGLNLKASHLSLINQGKLTSINKKFLKVGEKFIIYAPEVSNLTTIELGTSPFHIEVAWVS 118

Query: 110 WEFKVPNTLLQEDPALLEVIKGLGIRVVTSFSKATTHHIIR--PHEDDQDYEKYLFALVK 167
             + +P+ L +        +   GI   +S      + +I   P  DD    + L+ALV 
Sbjct: 119 EIWNIPSHLTE----FRTTLSQFGISTESSIDDGPINLMISDFPSSDDNGM-RELYALVN 173

Query: 168 GIPILHLEFL 177
            IP+  L  L
Sbjct: 174 AIPLKKLRLL 183

>TBLA0A02820 Chr1 (678796..681573) [2778 bp, 925 aa] {ON} Anc_5.435
           YDR369C
          Length = 925

 Score = 88.2 bits (217), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 198/884 (22%), Positives = 359/884 (40%), Gaps = 147/884 (16%)

Query: 1   MWVFKCNYQKSGQLGALQNISCALCPEREFIVGRASKSTLVIE-EKGVSRTHLRLE---V 56
           MW+   +Y+ +     L N+SC L     + +GR+ KS L ++ +K +SR H+       
Sbjct: 1   MWIISYSYKSADD--TLTNVSCCLKQNETYSIGRSKKSPLFVKNDKSISRQHVTFHWTGN 58

Query: 57  IDDHVNILLLGSQLKVGGEDASKGSVLPFGPS-QSPVILEVGSHSVQCILEWAQWEFKVP 115
           +++ +++L  G   +V     +    L F    + P  +E+G+  V     W    + +P
Sbjct: 59  LNNQLSLLNQGKLTRVNSRILNPAETLLFNADIEHPAEVELGATPVVVCGAWTNHVYNIP 118

Query: 116 NTLLQEDPALLEVIKGLGIRVVTSFSKATTHHII---RPHEDDQDYEKYLFALVKGIPIL 172
               Q +  L +   G  I      ++A T+ I    RP  ++       ++LV    IL
Sbjct: 119 IEFQQFESQLKDY--GFNINFGPQKNEAITYVIDIEPRPMNNNFISGTLYYSLVNKSIIL 176

Query: 173 HLEFLKQFTALLRQPVTDFDPQLRSIQEQHYA--FRGFTKKA--ADLNGLHFIVNRKHDF 228
              FL     LL   VT F+   +++ +      FR    ++   +L G+  IV   +  
Sbjct: 177 KSSFLTSLLNLLNPNVTTFNIDFQNLLDASKIEDFRNINLESLKVELTGIKLIVLNDNTT 236

Query: 229 EMLKY--TLEIGGGTVHFCHDINDLSACLKTIPINGALALKYDHGISAEVKKVDDTRYCE 286
           +++ +   +E+         D         TI IN   +   +  I   +    ++R+ E
Sbjct: 237 DLIYFIAAMEVINLPTITTED--------DTIFINTVKSHSEERLI---LLTTSNSRHIE 285

Query: 287 VLHSHGIQLFTVHELTKAILYDKLAQLLSKRPPTMMKLVEPVPSTISQTQEMKQES-LSP 345
            +  H  + F  ++  K    + L Q++ K  P  ++       TIS   E +  S LSP
Sbjct: 286 TIKVHTFKDF--YQGIKNQNINHLIQVIKKDSPHTIE--RNSRETISLNNENQTYSQLSP 341

Query: 346 I-----SLGNTTIKDLPRKDKT------------------RKRL--KKPQPLDSLSFFAG 380
                  + + TI D   K  +                  R+RL  K+ QPLDSL FF  
Sbjct: 342 YIEDNNKVNSNTISDSLLKQTSELIKPSVNDHAPEKPPVKRRRLNRKRVQPLDSLHFF-- 399

Query: 381 GLSRQNSSIGGTADLVKQESMSLGAD-THYGSPNDVQSLPATQSPKKRRRPKVEPLGNLM 439
                   +GG  +  +       +D  +  +P +V S       +++   K++    ++
Sbjct: 400 --------VGGNTNPTQNNLSQTESDLKNVANPRNVFS-------QRKSNDKIDK-DEII 443

Query: 440 TSQ-------LQKAFDDPTISSAKVSPTEQEIIPVRESQAKKTPDPIGAFNGTSQKGSIE 492
            SQ       L++    PT  + ++S +  E +    S ++ +P         S +  I 
Sbjct: 444 VSQPYTKEPFLKEDLSIPTSITKQMSLSNNETLQY-PSNSQHSP--------VSLQEPIC 494

Query: 493 SNSRKRQPSPGYPYEPLPAGVGN----GDILNKQWKSLDEQPPSKKPRMQETDL------ 542
           SN     PS G   +  P+ V N         K  K L  +  SKKP     D+      
Sbjct: 495 SNIGSNIPSIGKE-DTNPSLVTNKIMAASTSKKDVKILAAR--SKKPLNDSIDMDMSDQA 551

Query: 543 -YSEVMSGSSEEYREELTRSK--LNSLDEESIKSRKRTSSEK--PVNSCKRRQAPAVPEQ 597
             +++ S ++++  E+ T S   LN+  ++   S KR+  ++   V+  KR   P     
Sbjct: 552 ELTDIHSAATDQQYEKKTLSNYILNNKPDDQANSLKRSKEQEKGTVSPVKRSPTP----N 607

Query: 598 NIVDAIKQIKEREVNRIRTTIVELGPEELTEDAIRQLKSLAIVQP-VDML---RQQHTVD 653
           N + A++  K RE +R+ +  V++  EELTE+AI +  +LA+V+  VD++    +++   
Sbjct: 608 NFISALQDAKNRETDRLGSKFVKIYDEELTEEAINKFSNLAVVETNVDIVISEGKKNNES 667

Query: 654 TVGSSPLTFARKNYKNFKKVWPKYMNRKNSPE--------TRNATAISNRKYLPLELYET 705
                P    RKN+KNF K  PKY   K  P          RN+  +  R+Y+P++ ++ 
Sbjct: 668 ITDIDPKWKGRKNFKNFVKQLPKYR-MKTMPSGDNGVASFIRNSAFLLAREYVPMQEFKM 726

Query: 706 DLQSRTLFEDGAPPRQKDNISRSTSTSGLSNDLASNRGKDHPAPGSLFS--NHALLGNDN 763
           + Q   + E    P +                 +  + +  P+ G+  +        +D 
Sbjct: 727 NNQGNRIQEFPEFPVE----------------YSPQQAEQLPSNGASMNTITQTFSSDDL 770

Query: 764 AGPEPIFNFSSRSREDTNSPTASPAPNLTHDNTLFVVDDENEDG 807
              E  F+FS  S  D N+         T  N+LFV +D+++D 
Sbjct: 771 ETLEQSFSFSRASGGDINNNVYPHITKTTKGNSLFVTEDDDDDA 814

>NCAS0F03390 Chr6 complement(683109..685694) [2586 bp, 861 aa] {ON}
           Anc_5.435 YDR369C
          Length = 861

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 111/439 (25%), Positives = 182/439 (41%), Gaps = 61/439 (13%)

Query: 1   MWVFKCNYQKSGQLGALQNISCALCPEREFIVGRASKSTLVIE-EKGVSRTHLRLEVID- 58
           MWV +  YQ   + G+ Q IS  +     + +GR++K+ L I+ +K +SR HL L+  D 
Sbjct: 1   MWVLR--YQYDLEDGSTQKISRCIQKSVCYTIGRSNKNHLSIKNDKSISRQHLSLKWEDR 58

Query: 59  DHVNILLLGSQLKVGGEDASKGSVLPFGPSQSPVILEVGSHSVQCILEWAQWEFKVPNTL 118
           + ++I+  G    +G +    G  L FG   S + +++G+  V   LE+    + +PN L
Sbjct: 59  NDIHIINQGKLTYIGEQYLDVGQSLTFGNVNS-LSIKLGTKPVMVHLEFYSSNWLIPNGL 117

Query: 119 LQEDPALLEVIKGLGIRVVTSFSKATTHHI-IRPHEDDQDYEKYLFALVKGIPILHLEFL 177
            Q      E +K  G+ V T         I +   E +      L+  +K IP+   +F 
Sbjct: 118 TQ----FHETLKDFGVNVATQIPVDQKTQIDLIVDEINGSGLIPLWGFMKDIPVKKPQFF 173

Query: 178 KQFTALLRQPVTDFDPQLRSIQE-------QHY-AFRGFTKKAADLNGLHFIVNR--KHD 227
                +L     DFD     +QE        HY + +  ++   +   L    N   K  
Sbjct: 174 STACEILSSNDNDFDNSWHRLQETSNTLFCSHYISLKDRSRLFENYVILILFDNETNKDA 233

Query: 228 FEMLKYTLEIGGGTVHFCHDINDLSACLKTI-----PINGALALKYDHGISAEVKKVDDT 282
            + LK  L +GG  V+   D +DL+A    I       N  + L       +   ++ D 
Sbjct: 234 VKTLKTALNLGGAIVN---DFSDLNASKDYINNLKPTTNQHICLVKFGSFKSPNDQLPDL 290

Query: 283 RYCEVLHSHGIQLFTVHELTKAILYDKLAQLLSKRP------------------PTMMKL 324
            Y           F + ++  AI  DK+ +L++  P                  P+  K 
Sbjct: 291 EY-----------FKLEDIITAIRDDKIMKLITTIPEREQVMNQDVSLIPEITYPSDRKT 339

Query: 325 -VEPVPSTISQTQEMKQESLSPISLGNTTIKDLPRKDKTRKRLKKPQPLDSLSFFAGGLS 383
            ++P   T+      K+  LS    G  T+ + P   K R   ++ +PLDSL+FFAGG S
Sbjct: 340 NIQPSHHTVDSIHNDKKNVLSNRDPGEATLVN-PIVKKRRLNRQRVKPLDSLAFFAGGAS 398

Query: 384 RQNSS--IGGTADLVKQES 400
            +  S  +  TA   K ES
Sbjct: 399 PKIGSPAVQETAQATKDES 417

>CAGL0A02838g Chr1 complement(297872..300358) [2487 bp, 828 aa] {ON}
           similar to uniprot|P33301 Saccharomyces cerevisiae
           YDR369c XRS2
          Length = 828

 Score = 77.4 bits (189), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 103/404 (25%), Positives = 169/404 (41%), Gaps = 57/404 (14%)

Query: 1   MWVFKCNYQKSGQLGALQNISCALCPEREFIVGRASKSTLVIE-EKGVSRTHLRLEVIDD 59
           MWV + +Y +  + G ++ +SC +    ++ +GR+SK+ LVI+ +K +SR H+ L+    
Sbjct: 1   MWVLRYSYVE--ETGEVKKVSCCIRQNVQYTIGRSSKNNLVIKNDKSISRQHVSLKWSSS 58

Query: 60  HVNILLLGSQLKVGGEDASKGS--VLPFGPSQSPVILEVGSHSVQCILEWAQWEFKVPNT 117
              I L  +       +   GS  ++ +   ++ + + +G   V+ IL      F +PN+
Sbjct: 59  KNCIELTNTGKLTKSSEKYLGSNELITYSADETQIEMLLGVAPVKIILSRIDELFDIPNS 118

Query: 118 LLQEDPALLEVIKGLGIRVVTSFSKATTHHIIRPHEDDQDYEKYLFALVKGIPILHLEFL 177
           L Q      E ++ LGI++    +   +  +I     D  Y + LFA    I I     L
Sbjct: 119 LSQ----FRETLETLGIQISVDNANVNSTSLITV--GDFGYRE-LFAACNDINIYSSGLL 171

Query: 178 KQFTALLRQPVTDFDPQLRSIQEQHYA---FRGFTKKAADLNGLHFIVNRKHDFEMLKY- 233
            +    L     +FD + RS+Q  ++      G   +   + G  F +  K D+ ++ Y 
Sbjct: 172 TEICNKLVNDHDNFDAEWRSMQSSYHRNLDLEGLLSQFGGIRGKFFFLLYKIDWFIISYL 231

Query: 234 ---TLEIGGGTVHFCHDINDLSACLKT-----IPINGALALKYDHGISAEVKKV--DDTR 283
               L++        H  +DL   + +     IPI           IS E  K   +DT 
Sbjct: 232 KPFLLKLSVEIHDSIHKNDDLLRLISSKQADEIPI----------VISNEKIKYLPEDTL 281

Query: 284 YCEVLHSHGIQLFTVHELTKAILYDKLAQLLS-KRPPTMMKLVEPVPSTISQTQEMKQES 342
               +HS  I  F    +    LY    +  S +R P      E   + I Q +      
Sbjct: 282 Q---IHSDDIYKF----IESGDLYRNAIRYQSMERKPIYDLEDETTNAIIPQKR------ 328

Query: 343 LSPISLGNT---TIKDLPRKDKTRKRLKKPQPLDSLSFFAGGLS 383
               SL NT   T   L    K R R  K +PL+SLSFFAGG+S
Sbjct: 329 ----SLANTSQPTDTSLESTKKKRVRRHKVEPLNSLSFFAGGIS 368

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 127/529 (24%), Positives = 227/529 (42%), Gaps = 85/529 (16%)

Query: 245 CHDINDLSACLKTIPINGALALKYDH-GISAEVKKVDDTRYCEVLHSHGI--QLFTVHEL 301
           C+DIN  S+ L T   N    L  DH    AE + +  + Y   L   G+  Q   +   
Sbjct: 160 CNDINIYSSGLLTEICN---KLVNDHDNFDAEWRSMQSS-YHRNLDLEGLLSQFGGIRGK 215

Query: 302 TKAILYDKLAQLLSKRPPTMMKLVEPVPSTISQTQEM------KQESLSPISLGNTTIKD 355
              +LY     ++S   P ++KL   +  +I +  ++      KQ    PI + N  IK 
Sbjct: 216 FFFLLYKIDWFIISYLKPFLLKLSVEIHDSIHKNDDLLRLISSKQADEIPIVISNEKIKY 275

Query: 356 LPRKDKTRKRLKKPQPLDSLSFFAGGLSRQNSSIGGTADLVKQESMSL----GADTHYGS 411
           LP            + ++S   +   +  Q+       DL  + + ++     +  +   
Sbjct: 276 LPEDTLQIHSDDIYKFIESGDLYRNAIRYQSMERKPIYDLEDETTNAIIPQKRSLANTSQ 335

Query: 412 PNDVQSLPATQSPKKRRRPKVEPLGNLMTSQLQKAFDDPTIS----------SAKVSP-T 460
           P D  SL +T+  K+ RR KVEPL +L       +F    IS           +KV+   
Sbjct: 336 PTDT-SLESTK-KKRVRRHKVEPLNSL-------SFFAGGISPVPGTNNEYNQSKVNGHL 386

Query: 461 EQEIIP--VRESQAKKTPDPIGAFNGTSQKGSIESNSRKRQPSPGYPYEPLPAGVGNGDI 518
           + EI P     ++ +K P      + T  + ++  ++ +    P      +  G+ + D 
Sbjct: 387 DSEISPDSASTTREQKIPGQSHTISTTRMEHALTDDNSE----PTIVQRSIAEGISHRDQ 442

Query: 519 LNKQWKSLDEQ---PPSKKPRMQETDLYSEVMSGSSEEYREE--LTRSKL---------N 564
           L    + +++Q   P  KK  + E  +Y+   +G+   Y  E  LT+S L         N
Sbjct: 443 LIGNDEVVEDQHHLPDRKKRDIHENTMYNNSYNGNKSLYGVENSLTQSNLLQSMGYEKSN 502

Query: 565 SLDEESIK-------SRKRTSSEKP------VNSCKRRQAPAVPEQNIVDAIKQI---KE 608
           +  E S K       + K   +++P      +NS +        ++  +D +K +   KE
Sbjct: 503 NKTELSKKNAGGIMSTEKNLDAQRPNLKSQTLNSLEDNDPKRTLQKRDIDIVKLVQTTKE 562

Query: 609 REVNRIRTTIVELGPEELTEDAIRQLKSLAIVQPV-DMLRQQHTVDTVGSSPLTFA-RKN 666
            EV R+ +TIV++   ELTE+AI +L  L +V+PV D++R +  +    ++   +  RKN
Sbjct: 563 SEVKRLSSTIVKIEDSELTEEAINKLNDLVLVEPVADLIRTKSDISANNTTQQQWKNRKN 622

Query: 667 YKNFKKVWPKYMNRKNSPET-----RNATAISNRKYL-----PLELYET 705
           +K F K+ PKY + ++S E+     R +  I  R++L     P++ Y +
Sbjct: 623 FKKFVKICPKYKSEQSSIESMSRHIRGSGEILTREFLQTKNVPVDYYNS 671

>Suva_2.541 Chr2 complement(965557..968166) [2610 bp, 869 aa] {ON}
           YDR369C (REAL)
          Length = 869

 Score = 70.9 bits (172), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 104/364 (28%), Positives = 165/364 (45%), Gaps = 56/364 (15%)

Query: 370 QPLDSLSFFAGGLSRQNSSI-GGTADLVKQESMSLGADTHYGSP--NDVQSLPAT--QSP 424
           QPLDSL+FFAGGLS   SS   G AD  K+   +L + T   SP   ++   P++  Q+ 
Sbjct: 364 QPLDSLNFFAGGLSADPSSKHKGFAD-AKEPIFNLNSKTTVSSPIIEEIDRKPSSSVQNT 422

Query: 425 KKRRRPKVEPLGNLMTSQLQKAFDDPTISSAKVSPTEQEIIPVRESQAKKTPDPIGAFNG 484
           ++  R   +  G + T  +      P I  + V   E+E  PV ES     P P      
Sbjct: 423 QRISRDTWKENGYIGTGAV--VVGSPEIGGS-VRHDEEE--PVNESLQ---PSPT----- 469

Query: 485 TSQKGSIESNSRKRQPSPGYPYEPLPAGVGNGDILNKQWKSLDEQPPSKKPRMQETDLYS 544
            ++  S        Q    YP    P     G  + + +K  D+   ++     E    +
Sbjct: 470 VTRPDS--------QNISAYPVTTTPEKHMEGRKIVESYKISDDSTQNENQTQNENQTQN 521

Query: 545 EVMSGSSEEYR-EELTRSKLNSLDEESIKSRKRTSSEKPVNSCKRRQAPAVPEQNIVDAI 603
           E  + +  + + + L  ++  S+  +   S ++     P+     ++    P  + V+AI
Sbjct: 522 ENQTQNEMKIKLQTLKDNRKFSVLSQKTPSHQQAGHNSPLRELSLKEQSNTP-HSFVEAI 580

Query: 604 KQIKEREVNRIRTTIVELGPEELTEDAIRQLKSLAIVQPVD-MLRQQHTVDTVGSSPLTF 662
           +Q K REV R+++TIVEL  +EL+E+AI QL +LAIV+P + +LR      +VGS+    
Sbjct: 581 QQTKNREVKRVKSTIVELEDDELSEEAINQLNNLAIVEPSNELLRDPR---SVGSNRTRS 637

Query: 663 A---------------RKNYKNFKKVWPKYM--------NRKNSPETRNATAISNRKYLP 699
           +               RKN+K F KVWP           N +NS   R+A  +  R Y+P
Sbjct: 638 SARRSEKGAIRQEWPKRKNFKTFAKVWPNSKTPKEGDKGNNQNSDFIRSAAFLITRNYVP 697

Query: 700 LELY 703
           L+ Y
Sbjct: 698 LKKY 701

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 57/229 (24%), Positives = 106/229 (46%), Gaps = 41/229 (17%)

Query: 1   MWVFKCNYQKSGQLGALQNISCALCPEREFIVGRASKSTLVIE-EKGVSRTHLRLEV-ID 58
           MWV +  YQ   + G++ +ISC L   + + +GR+SK+ LVI+ +K +SR H+  +  I+
Sbjct: 1   MWVIR--YQNILEDGSINSISCCLQASKSYSIGRSSKNELVIKNDKSISRQHVTFKWEIN 58

Query: 59  DHV----NILLLGSQLKVGGED-----ASKGSVLPFGPSQSPVILEVGSHSVQCILEWAQ 109
           D +    N L L +Q K+   +       + S +      +   +E+G+  ++   EW  
Sbjct: 59  DSLNPKGNKLSLVNQGKLTSINKKFMKVGETSTISVTKVSNHTEIELGTTPIRIKFEWID 118

Query: 110 WEFKVPNTLLQEDPALLEVIKGLGIRVVTSFSKATTHHIIR--PHEDDQDYEKYLFALVK 167
             + +P+ L Q       ++   GI   TS    +   +I   P  +D D  + L+ALV 
Sbjct: 119 EIWNIPSNLAQ----FQTILSQFGIATKTSIDDDSASILISDFPSNND-DGMRELYALVH 173

Query: 168 GIP------------------ILHLEFLKQFTALLRQP---VTDFDPQL 195
            IP                  +++L+F + +  ++ +P   V D+DP +
Sbjct: 174 TIPLKKSQLLVDLCNSLLSSSVMNLKFDETWNNMVNKPLFKVFDYDPSV 222

>KNAG0C04900 Chr3 (946975..949284) [2310 bp, 769 aa] {ON} Anc_5.435
           YDR369C
          Length = 769

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 41/118 (34%), Positives = 69/118 (58%), Gaps = 7/118 (5%)

Query: 589 RQAPAVPEQN--IVDAIKQIKEREVNRIRTTIVELGPEELTEDAIRQLKSLAIVQP-VDM 645
           R  PA P  +  +V+ I+ +K+ E  R++ T+  + P ELT++AI    ++AIV+P V++
Sbjct: 535 RPRPAKPRNSSSLVETIQSVKDNETRRLQCTLTPVDPSELTDEAIADFSNMAIVEPTVNI 594

Query: 646 LRQQHTVDTVGSSPLTFARKNYKNFKKVWPKYMNRKNSPETRNATAISNRKYLPLELY 703
           +R++  +  V  S +   R N+K F KVWPK   RK +   RN   +  R Y+P++ Y
Sbjct: 595 VRKKPAM--VTESSIRSDRPNFKKFMKVWPKA--RKGNDSLRNNAYLITRDYVPMKAY 648

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 100/460 (21%), Positives = 182/460 (39%), Gaps = 81/460 (17%)

Query: 1   MWVFKCNYQKSGQLGALQNISCALCPEREFIVGRASKS-TLVIE-EKGVSRTHLRLEVID 58
           MW+ + +Y+ S   G +  +SC L   R + +GR+SK+  LVI+ +K +SR H+  + + 
Sbjct: 1   MWILRYSYE-SEDHGTVY-VSCCLQRSRNYSIGRSSKTNALVIKNDKSISRQHISFQWVS 58

Query: 59  -DHVNILLLGSQLKVGGEDASKGSVLPFGPSQSP-VILEVGSHSVQCILEWAQWEFKVPN 116
            D+V+I+  G    +               S S    ++VGS  V   L W   +  +  
Sbjct: 59  HDYVDIVNDGKLTYINDAFLKPKETTRISISASKETNIKVGSAPVIVNLVWE--DVFIDM 116

Query: 117 TLLQEDPALLEVI--------KGLGIRVVTSFSKATTHHIIRPHEDDQDYEKYLFALVKG 168
           T + +    L++I         G+ I             I  PH+        L AL++G
Sbjct: 117 TPISDTGQSLKLIGIYPAGSTHGVNIEDAMKTLCIKIKEIKWPHQ--------LIALIRG 168

Query: 169 IPILH----LEFLKQFTALLRQPVTDFDPQL-RSIQEQHY-----------AFRGFTKKA 212
              L+    ++ + Q      + ++ FD    R++    Y           +FR FT   
Sbjct: 169 ANRLYKADLVDLMAQQLVDSNENISSFDEIWNRTVDSGQYKEYPNFKVDRNSFRDFT--- 225

Query: 213 ADLNGLHFIVNRKHDFEMLKYTLEIGGGT-VHFCHDINDLSACLKTIPINGALALKYDHG 271
                + +  N   D   ++  +E  GGT + F ++ +          ++  L L+    
Sbjct: 226 -----IIYFDNNDSDISGVRSCVEFCGGTLLSFVNNESFEKYASTNETLHNVLLLR---- 276

Query: 272 ISAEVKKVDDTRYCEVLHSHGIQLFTVHELTKAILYDKLAQLLSKRPPTMMKLVEPVPST 331
             +E  +V    Y E+L+   I + +     KA+  + ++ L+  R   + +  +     
Sbjct: 277 --SERFQVSHPVY-EILNK--IDICSTGSFFKAVTENNVSTLV-HRELFLRRYTDITQKE 330

Query: 332 ISQTQEMKQESLSPISLGNTTIKDLPRKDKTRKRLKKPQPLDSLSFFAGG----LSRQNS 387
           + + +E  +++  P+              K R   +K QPL+ L FFAGG     ++Q+S
Sbjct: 331 MRRPKEPVEDTAVPLK-------------KRRLNRRKVQPLNPLEFFAGGDTATTTKQSS 377

Query: 388 SIGGTADLVKQES-----MSLGADTHYGSPNDVQSLPATQ 422
             G  A     E+     M    D    S N+ Q   ATQ
Sbjct: 378 DDGLAATKAVDETEVSDKMHGSGDVLSNSTNNNQDTVATQ 417

>Smik_4.635 Chr4 complement(1135040..1137631) [2592 bp, 863 aa] {ON}
           YDR369C (REAL)
          Length = 863

 Score = 67.8 bits (164), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 79/145 (54%), Gaps = 22/145 (15%)

Query: 580 EKPVNSCKRRQAPAVPEQNIVDAIKQIKEREVNRIRTTIVELGPEELTEDAIRQLKSLAI 639
           E PV     R+  + P  + V AI+Q K+REV R+++TIVEL  +EL+E+AI QL+ LAI
Sbjct: 537 ESPVKEVSFREKSSAP-HSFVQAIQQTKKREVKRVKSTIVELEDDELSEEAINQLERLAI 595

Query: 640 VQP-VDMLRQ--QHTVDTVGSSPLTFA----------RKNYKNFKKVWPKYMNRKNSPET 686
           V+   D+LR+   + ++TV SS               RKN+K F K WPK+  +K   + 
Sbjct: 596 VEANNDLLRKLPDYRLNTVSSSTEKGGNGVIRQEWQRRKNFKTFVKAWPKFKAQKEGSKN 655

Query: 687 --------RNATAISNRKYLPLELY 703
                   R A  +  R Y+PL+ Y
Sbjct: 656 DTQKSDFIRGAAFLITRNYVPLKKY 680

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 62/214 (28%), Positives = 101/214 (47%), Gaps = 23/214 (10%)

Query: 1   MWVFKCNYQKSGQLGALQNISCALCPEREFIVGRASKSTLVIE-EKGVSRTHLRLEV--- 56
           MWV +  YQ   + G +  ISC L   + + +GR+SK+ L+I+ +K +SR H+ L+    
Sbjct: 1   MWVVR--YQNILEDGTISVISCCLQASKSYSIGRSSKNPLIIKHDKSISRQHITLKWQSN 58

Query: 57  --IDDHVNILLLGSQLK---VGGEDASKGSVL---PFGPSQSPVILEVGSHSVQCILEWA 108
              D + N L L +Q K   +  +    G        G S S  I E+G+  ++  +EW 
Sbjct: 59  SGSDSNHNSLCLINQGKLTSINNKFMKVGETFIIEALGVSNSTFI-ELGATPIRIEVEWK 117

Query: 109 QWEFKVPNTLLQEDPALLEVIKGLGIRVVTSFSKATTHHIIRPH-EDDQDYEKYLFALVK 167
              + +P+ L Q   AL +     GI   TS ++  T+ +I  +   D +  + L AL +
Sbjct: 118 NQVWNIPSHLAQFRTALSQ----FGISTETSINEVPTNIMISDYPSSDDNVIRELCALAE 173

Query: 168 GIPILHLEFL-KQFTALLRQPVTD--FDPQLRSI 198
            IP+   + L K    LL   +TD  FD +   I
Sbjct: 174 NIPLKKSQLLVKLCNTLLSASITDLTFDERWNDI 207

 Score = 32.3 bits (72), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 24/42 (57%)

Query: 371 PLDSLSFFAGGLSRQNSSIGGTADLVKQESMSLGADTHYGSP 412
           PLDSL+FFAGGL+ + SS       VK+    L + +   SP
Sbjct: 365 PLDSLNFFAGGLNVKASSESKDITDVKESRCGLDSKSVISSP 406

>Kpol_1016.5 s1016 (10036..12474) [2439 bp, 812 aa] {ON}
           (10036..12474) [2439 nt, 813 aa]
          Length = 812

 Score = 65.1 bits (157), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 99/405 (24%), Positives = 181/405 (44%), Gaps = 41/405 (10%)

Query: 1   MWVFKCNYQKSGQLGALQNISCALCPEREFIVGRASKSTLVI-EEKGVSRTHLRLEVIDD 59
           MWV +  YQ S   G+++ ISC +  E  + +GR+SK+ L +  +K +SR  + ++   D
Sbjct: 1   MWVLR--YQYSLDDGSVEKISCCIRNEETYYLGRSSKNQLSVRNDKSISRQQISIQWDRD 58

Query: 60  HVNILL--LGSQLKVGGEDASKGSVLPFGPSQSPVILEVGSHSVQCILEWAQWEFKVPNT 117
              I++  LG    V     S G  L F      V +++G+  +   L    WE K  N 
Sbjct: 59  KDCIMVKNLGKVTMVEERYLSDGETLSFQSKNDLVTMKIGTTPIVVNL---SWEVKRCN- 114

Query: 118 LLQEDPALLEVIKGLGIRVVTSFSKATTHHIIRPHEDDQDYEKYL--FALVKGIPILHLE 175
            ++ D  ++ +++  G +  T  +  +   II+ ++     +KYL  ++++    +++ +
Sbjct: 115 YMKTDMDMVHLLQSYGFQPTTIENSHSLDMIIQ-NDVTTISDKYLKCYSMIHDTILINSK 173

Query: 176 FLKQF---TALLRQPVTDFDPQLRSIQE--QHYAFRGFTKKAADLNGLH-FIVN-RKHDF 228
            L+       ++ +    +  +L S +   Q++     TK A  L G+H F+++   ++ 
Sbjct: 174 TLRDILTNNIIMTKKFDSYWVKLNSHESNIQNHTI-NVTKLAKSLKGMHMFLLDPESYNC 232

Query: 229 EML-KYTLEIGGGTVHFCHDINDLSACLKTIPINGALALKYDHGISAEVKKVDDTRYCEV 287
           E   K+  EIG     F  +INDL   L+T    G   L           K+++    E 
Sbjct: 233 EYFEKFLEEIGCIPRKFL-NINDLETYLETQFKGGEFLL-------LSSAKLENQSRLER 284

Query: 288 LHSHGIQLFTVHELTKAILYDKLAQLLSKRPPTMMKLVEPVPSTISQTQEMKQESLSPIS 347
             S  ++ F    L          Q +++       ++EPV   +   Q  +     PIS
Sbjct: 285 FISIPLESFLDKLLFLD---LDFGQSINRSKEESKNVIEPVLKEVGVEQTTEA---VPIS 338

Query: 348 LGNTTIKDLPRKDKTRKRLKKPQPLDSLSFFAGGLSRQNSSIGGT 392
             N  I + P+  K R    + +PLDSL+FFAGG+    +SIG +
Sbjct: 339 -KNVEIYE-PQPKKRRLNRSRVKPLDSLNFFAGGV----TSIGAS 377

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 81/332 (24%), Positives = 146/332 (43%), Gaps = 66/332 (19%)

Query: 525 SLDEQPPS-KKPRMQETDLYSEVMSG---SSEEYREELTRSKL----NSLDEESIKSRKR 576
           ++D  P   KKP+++E     +++S    S+ +    L  +++    N+   E  K R++
Sbjct: 445 AIDRSPEKIKKPKLEENISIQQLLSNKVKSTSDTSSVLIETQIAKESNTKAIEYGKVRQK 504

Query: 577 TSSEKPVNSCKRRQAPAVPEQNIVDAIKQIKEREVNRIRTTIVELGPEELTEDAIRQLKS 636
           T ++    S +R + P+V   ++V AI+ IKERE  R++T+IVE+   ELTE+AI +   
Sbjct: 505 TLTDYKHTSDERIERPSV---DLVHAIQDIKERETLRVKTSIVEIKENELTEEAINKFSD 561

Query: 637 LAIVQPVDMLRQQHTVD-----TVGSSPLTFA-RKNYKNFKKVWPKYMNRKNSPE----- 685
           L +V     L +  ++D         + + ++ +KN+K F K+ PKY   + + +     
Sbjct: 562 LTVVDINTRLFKDKSLDINKPANSNQNNMDWSGKKNFKKFVKMVPKYKRSQGNGQHADSC 621

Query: 686 ---TRNATAISNRKYLPLELYETDLQSRTLFEDGAPPRQKDNISRSTSTSGLSNDLASNR 742
               RN+  +  R ++P++ Y                 + DN S S   +  SN +  N+
Sbjct: 622 STFIRNSAMLITRNFVPMKQYS----------------KLDNNSNSNEMTDFSN-IEVNK 664

Query: 743 GKDHPAPGSLFSNHALLGNDNAGPEPIFNFSSRSREDTNSPTASPAPNLTHDNTLFVVDD 802
               P       N     +D++  EP F F+  S                    LFV+D+
Sbjct: 665 ---KPVE----KNREAYSSDDSVDEPSFTFTRNS----------------SSKQLFVMDE 701

Query: 803 E-NEDGDGMADTSIAQRVSRERHATTKPAEPD 833
             NED   M +    Q +S+   A +    P+
Sbjct: 702 SINEDSLNMINDKGLQEMSQNSIANSNFEVPN 733

>TPHA0J02590 Chr10 complement(574619..576946) [2328 bp, 775 aa] {ON}
           Anc_5.435 YDR369C
          Length = 775

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 159/733 (21%), Positives = 293/733 (39%), Gaps = 147/733 (20%)

Query: 15  GALQNISCALCPEREFIVGRASKSTLVIE-EKGVSRTHLRL--EVIDDHVNILL----LG 67
           G +  +SC L  + E+ +GR+SK+   I+ +K +SR H+ L  +   D  N+++     G
Sbjct: 13  GPVNVVSCCLLCDVEYAIGRSSKNKFAIKNDKSISRQHVSLLWKYSSDDKNVIIQIKNFG 72

Query: 68  SQLKVGGEDASKGSVLPF---------GPSQSPVILEVGSHSVQC--ILEWAQWEFK-VP 115
               +  +  S+   L F             SP+ LE+ +  V C  I +    + K + 
Sbjct: 73  KVTMIKDKYLSQDETLQFTLIDKKLEVNIGTSPITLEIFNQEVVCNSIEDIQNSDSKLIL 132

Query: 116 NTL--LQEDPALLEVIKGLGIRVVTSFSKATTHHIIRPHEDDQDYEKYLFALVKGIPILH 173
           N L  LQ+DP  L   K  G  ++   +  T            D    LF+ V GIPI+ 
Sbjct: 133 NNLNILQDDPLTL---KREGPTIIIKENSYT------------DILLELFSNVFGIPIVT 177

Query: 174 LEFLKQFTALLRQPVTDFDPQLRSIQEQHYAFRGFTKKAA--DLNGLHFIVNRKHDFEML 231
           +E L+           DF     S  ++ Y+ +    KA   DL+  ++I       + +
Sbjct: 178 IEELRGIAN-----ANDF----YSYWDKIYSRKKNKGKACMLDLSTCYYISEVDKYVDYV 228

Query: 232 KYTLEIGGGTVHFCHDINDLSACLKTIPINGALALKYDHGISAEVKKVDDTRYCEVLHSH 291
           K  +      +    D +DL   ++     G ++  +   +S ++ + ++  +       
Sbjct: 229 KVAIRSLNAEIKILKDKDDLVKDIRKNISKGNISKFF--VLSNDITQGEEAPF------- 279

Query: 292 GIQLFTVHELTKAILYDKLAQLLSKRPPTMMKLVEPVPSTISQTQEMKQESLSPISLGNT 351
            I + ++ +L +A+  + +  ++             +    S   E+ +E  SP      
Sbjct: 280 NISVTSIAKLLEAVKTNNMKDIV-------------MHDYSSFKIEIPREVKSPKDDNII 326

Query: 352 TIKDLPRKDKTRKRLKKPQPLDSLSFFAGGLSRQNSSIGGTADLVKQESMSLGADTHYGS 411
             ++ P   + R    K +PLD+LSFFAGG+S    SI                      
Sbjct: 327 EKQEPPAPKRRRMNRSKVKPLDTLSFFAGGMSHDTHSINTKP------------------ 368

Query: 412 PNDVQSLPATQSPKKRRRPKVEPLGNLMTSQLQKAFDDPTISSAKVSPTEQEIIPVRESQ 471
            NDVQS   T+  K     K+E + ++ ++Q Q  +D  T      + ++     +++S 
Sbjct: 369 SNDVQSHQETE--KDVNNSKIESIQDVESNQDQTKYDKSTELQKSKAVSKNADDKLQDST 426

Query: 472 AKKTPDPIGAFNGTSQKGSIESNSRKRQPSPGYPYEPLPAGVGNGDILNKQWKSLDEQPP 531
           A+K   PI  FN T++  S          SP    + +     N D              
Sbjct: 427 AEK---PIN-FNPTTKTPSF---------SPSINDKAIENSNANLD-------------- 459

Query: 532 SKKPRMQETDLYSEVMSGSSEEYREELTRSKLNSLDEESIKSRKRTSSEKPVNSCKRRQ- 590
              P M++T +  +    +S + +  L  +KL  + E+  ++    +++ PV   +RR+ 
Sbjct: 460 ---PTMEKTRVNKK---PASLDTKNNLLDNKL--IAEQINEALSAKTNDAPV--VRRRRT 509

Query: 591 ------APAVPEQNIVDAIKQIKEREVNRIRTTIVELGPEELTEDAIRQLKSLAIVQPVD 644
                        ++V  I+ +K R V+R+ + IV +   EL E+ + +   + +V   D
Sbjct: 510 LLDYGNTDKSSSTDLVRTIQNVKSRGVDRVNSKIVTVDENELNEEELNKFFDVVVVDVND 569

Query: 645 MLRQQH-----TVD--TVGSSPLTFARKNYKNFKKVWPKYMNRKN-------SPETRNAT 690
            L ++H      +D   +  +     RK+YK FKK  PK+ ++ N       S    N  
Sbjct: 570 KLMKKHPNAQKVIDNANIDHNSNFKNRKDYKLFKKSIPKWQSKLNKQHHSMTSDNGENLV 629

Query: 691 AISNRKYLPLELY 703
              NR  +PL  Y
Sbjct: 630 VSKNRNKIPLRKY 642

>Kwal_56.23702 s56 complement(668862..670112) [1251 bp, 416 aa] {ON}
           YDR125C (ECM18) - (putative) involved in cell wall
           biogenesis [contig 174] FULL
          Length = 416

 Score = 38.5 bits (88), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 54/125 (43%), Gaps = 10/125 (8%)

Query: 114 VPNTLLQEDPALLEVIKGLGIRVVTSFSKATTHHIIRPHEDDQDYEKYLFALVKGIPILH 173
           +P  + ++   LL  +  LG ++  ++  A    +        DY+KY+F L+ G   L+
Sbjct: 269 IPRLVFEQQTQLLRNLGPLGAKLSWNYINAAYSRV-----PSLDYKKYVFELLYGKNGLN 323

Query: 174 LEFLKQFTALLRQPVTDFDPQLRSIQEQHYAFRGFTKKAADLNGLHFIVNRKHDFEMLKY 233
                 F  L    V   DP L SIQ     F G + K   + G H  +NR+   EM+  
Sbjct: 324 QTSKDLFIGLFNNRVLARDPLLDSIQ-----FFGKSAKLMCIYGDHDWMNRRAGMEMVNE 378

Query: 234 TLEIG 238
             ++G
Sbjct: 379 ANQLG 383

>CAGL0G06622g Chr7 complement(631859..634060) [2202 bp, 733 aa] {ON}
           similar to uniprot|P50944 Saccharomyces cerevisiae
           YNL101w
          Length = 733

 Score = 33.9 bits (76), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 46/94 (48%), Gaps = 10/94 (10%)

Query: 494 NSRKRQPSPGYPYEPLPAGVGNGDILNKQWKSLDEQPPSKKPRMQETDLYSEVMSGSSEE 553
           +S  R  +P   Y+P  +  G GDI    +K   +  P+   RMQ TD   +VMS +S +
Sbjct: 141 DSELRTGTPDLSYDPNLSTAG-GDITRDIYKVATKAMPTPVKRMQSTD---DVMSVASSQ 196

Query: 554 YREELTRSKLN---SLDEESIKSRKRTSSEKPVN 584
            R+  T S LN       E I ++KR   EK +N
Sbjct: 197 RRQS-TASSLNVPGGFRREFIVTKKR--KEKLLN 227

>NCAS0I01270 Chr9 (229975..230754) [780 bp, 259 aa] {ON} Anc_3.332
           YBR088C
          Length = 259

 Score = 32.3 bits (72), Expect = 4.6,   Method: Composition-based stats.
 Identities = 32/104 (30%), Positives = 48/104 (46%), Gaps = 14/104 (13%)

Query: 38  STLVIEEKGVSRTHLRLEVIDDHVNILLLGSQLK-VGGEDASKGSVL--PF----GPSQS 90
           +TL++     S+T   L  + D +NIL+    +K V   D   GSV+  PF     P +S
Sbjct: 135 TTLMMPSAEFSKTVRDLSQLSDSLNILVTKETIKFVATGDVGSGSVILKPFINMENPDES 194

Query: 91  -------PVILEVGSHSVQCILEWAQWEFKVPNTLLQEDPALLE 127
                  PV L  GS  +Q I++ +    K+   L  E PAL +
Sbjct: 195 IKLDMDQPVDLTFGSKYLQDIVKGSALSNKIGIRLSSEAPALFQ 238

>KNAG0I00960 Chr9 (181042..183225) [2184 bp, 727 aa] {ON} Anc_8.307
          Length = 727

 Score = 32.0 bits (71), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 20/32 (62%)

Query: 724 NISRSTSTSGLSNDLASNRGKDHPAPGSLFSN 755
           N  R  S SG+S+ +AS   K H + GSLFSN
Sbjct: 538 NSQRKLSMSGVSSSMASQNRKRHSSVGSLFSN 569

>AGL033C Chr7 complement(648872..649669) [798 bp, 265 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL027W
           (ISA1)
          Length = 265

 Score = 31.6 bits (70), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 50/99 (50%), Gaps = 8/99 (8%)

Query: 687 RNATAISNRKYLPLELYETDLQSRTLFEDGAPPRQKDNISRSTSTSGLSNDLASNRGKDH 746
           +  T I N++   L+L+    +S+T +E  A PR     S+   +SG S+D +  +G +H
Sbjct: 31  KRTTTIDNKR--QLQLHSQQTKSKT-YEKPAVPRGWSFDSQPVGSSGASHDSSEAKGDEH 87

Query: 747 P----APGSLFSNHALLGNDNAGPEPIFNFSSRSREDTN 781
           P    A  SL  + A  G+ +AG +   + + RS   TN
Sbjct: 88  PRTKWASYSLSRSDAPQGH-HAGSDAAAHVTKRSDSATN 125

>TBLA0E00350 Chr5 (61567..63984) [2418 bp, 805 aa] {ON} Anc_3.546
           YFR039C
          Length = 805

 Score = 32.0 bits (71), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 48/102 (47%), Gaps = 9/102 (8%)

Query: 529 QPPSKKPRMQETDLYSEVMSGSSEEYREELTRSKLNSL---DEESIKSRKRTSSEKPVNS 585
           Q   K+   Q+++L  ++   S E   E L + +L S+    EE+I    R SSE+    
Sbjct: 655 QSEKKQSEFQQSELQEQLSLNSKE--SERLEKERLESIAKKQEEAISEENRISSERQELE 712

Query: 586 CKRRQAPAVPEQNIVDAIKQ----IKEREVNRIRTTIVELGP 623
              R+     +Q I D+I+Q    I+   V+ I +TI +  P
Sbjct: 713 RYEREVQERKQQEIEDSIRQEESKIQNEMVDEIESTITQEEP 754

>TPHA0G00200 Chr7 (17940..27644) [9705 bp, 3234 aa] {ON} 
          Length = 3234

 Score = 32.0 bits (71), Expect = 9.8,   Method: Composition-based stats.
 Identities = 29/117 (24%), Positives = 51/117 (43%), Gaps = 7/117 (5%)

Query: 704  ETDLQSRTLFEDGAPPRQKDNISRS-TSTSGLSNDLASNRGKDHPAPGSLFSNHALLGND 762
            ET   + T +    P    DN+S++ T++  +SN+   +    +P+ GS   +   + +D
Sbjct: 3093 ETVSGTVTTYTTYCPESSDDNVSKTETASRTVSNNGVESDSNGNPSIGS---SAGPVNSD 3149

Query: 763  NAG---PEPIFNFSSRSREDTNSPTASPAPNLTHDNTLFVVDDENEDGDGMADTSIA 816
            +A    P P    ++ S    +S T S +PN   DNT  V    N         S++
Sbjct: 3150 SASVSIPAPTTVANADSNNSADSNTVSQSPNSESDNTSSVSPATNSGSSSQPTASVS 3206

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.131    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 94,915,803
Number of extensions: 4452538
Number of successful extensions: 14138
Number of sequences better than 10.0: 200
Number of HSP's gapped: 14852
Number of HSP's successfully gapped: 223
Length of query: 869
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 751
Effective length of database: 39,950,811
Effective search space: 30003059061
Effective search space used: 30003059061
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 70 (31.6 bits)