Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AER259W5.430ON61941315530.0
Ecym_47905.430ON63040710951e-141
SAKL0G02442g5.430ON62340510851e-140
KAFR0E039105.430ON62541110181e-130
KLLA0E21165g5.430ON62742510161e-129
NCAS0F033505.430ON63942710121e-129
Suva_2.5385.430ON62941310021e-127
KLTH0F16148g5.430ON6464389981e-126
YDR365C (ESF1)5.430ON6284179921e-126
NDAI0B056405.430ON6694499911e-125
Smik_4.6325.430ON6274139781e-124
Kpol_1016.85.430ON6374249731e-123
TDEL0E019505.430ON6174119701e-123
Kwal_55.214445.430ON6444409711e-122
TPHA0H017805.430ON6224119641e-122
CAGL0L11638g5.430ON6084139541e-120
ZYRO0F09944g5.430ON6114129401e-118
KNAG0C049405.430ON6424269391e-118
Skud_4.6355.430ON6294149221e-115
TBLA0A065405.430ON6594359151e-114
YGR145W (ENP2)4.77ON70733723.8
Smik_6.2484.77ON70733724.0
TBLA0A088904.77ON69845724.5
Suva_7.4354.77ON70833715.6
CAGL0E03069g4.77ON75431707.6
Skud_7.4674.77ON708336910.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AER259W
         (619 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AER259W Chr5 (1113896..1115755) [1860 bp, 619 aa] {ON} Syntenic ...   602   0.0  
Ecym_4790 Chr4 complement(1534067..1535959) [1893 bp, 630 aa] {O...   426   e-141
SAKL0G02442g Chr7 complement(201924..203795) [1872 bp, 623 aa] {...   422   e-140
KAFR0E03910 Chr5 complement(773170..775047) [1878 bp, 625 aa] {O...   396   e-130
KLLA0E21165g Chr5 (1890314..1892197) [1884 bp, 627 aa] {ON} simi...   395   e-129
NCAS0F03350 Chr6 complement(677168..679087) [1920 bp, 639 aa] {O...   394   e-129
Suva_2.538 Chr2 complement(960917..962806) [1890 bp, 629 aa] {ON...   390   e-127
KLTH0F16148g Chr6 (1310041..1311981) [1941 bp, 646 aa] {ON} simi...   389   e-126
YDR365C Chr4 complement(1204497..1206383) [1887 bp, 628 aa] {ON}...   386   e-126
NDAI0B05640 Chr2 complement(1377917..1379926) [2010 bp, 669 aa] ...   386   e-125
Smik_4.632 Chr4 complement(1130422..1132305) [1884 bp, 627 aa] {...   381   e-124
Kpol_1016.8 s1016 (16620..18533) [1914 bp, 637 aa] {ON} (16620.....   379   e-123
TDEL0E01950 Chr5 (367743..369596) [1854 bp, 617 aa] {ON} Anc_5.4...   378   e-123
Kwal_55.21444 s55 (839767..841701) [1935 bp, 644 aa] {ON} YDR365...   378   e-122
TPHA0H01780 Chr8 complement(409713..411581) [1869 bp, 622 aa] {O...   375   e-122
CAGL0L11638g Chr12 (1243194..1245020) [1827 bp, 608 aa] {ON} sim...   372   e-120
ZYRO0F09944g Chr6 complement(807207..809042) [1836 bp, 611 aa] {...   366   e-118
KNAG0C04940 Chr3 (953539..955467) [1929 bp, 642 aa] {ON} Anc_5.4...   366   e-118
Skud_4.635 Chr4 complement(1133271..1135160) [1890 bp, 629 aa] {...   359   e-115
TBLA0A06540 Chr1 (1602559..1604538) [1980 bp, 659 aa] {ON} Anc_5...   357   e-114
YGR145W Chr7 (781767..783890) [2124 bp, 707 aa] {ON}  ENP2Essent...    32   3.8  
Smik_6.248 Chr6 (401099..403222) [2124 bp, 707 aa] {ON} YGR145W ...    32   4.0  
TBLA0A08890 Chr1 (2183143..2185239) [2097 bp, 698 aa] {ON} Anc_4...    32   4.5  
Suva_7.435 Chr7 (752189..754315) [2127 bp, 708 aa] {ON} YGR145W ...    32   5.6  
CAGL0E03069g Chr5 complement(286341..288485,288759..288878) [226...    32   7.6  
Skud_7.467 Chr7 (764555..766681) [2127 bp, 708 aa] {ON} YGR145W ...    31   10.0 

>AER259W Chr5 (1113896..1115755) [1860 bp, 619 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR365C (ESF1)
          Length = 619

 Score =  602 bits (1553), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/413 (75%), Positives = 311/413 (75%)

Query: 1   MAKNNEGTGKDSIDKRFARIESDPKFRAPKQKNLKIKLDDRFSKQDLEYKRKAKVDKYGR 60
           MAKNNEGTGKDSIDKRFARIESDPKFRAPKQKNLKIKLDDRFSKQDLEYKRKAKVDKYGR
Sbjct: 1   MAKNNEGTGKDSIDKRFARIESDPKFRAPKQKNLKIKLDDRFSKQDLEYKRKAKVDKYGR 60

Query: 61  RIGTAPGKEEKDFEKYFTXXXXXXXXXXXXXXXXXVAKLDRARGEVPADYVXXXXXXXXX 120
           RIGTAPGKEEKDFEKYFT                 VAKLDRARGEVPADYV         
Sbjct: 61  RIGTAPGKEEKDFEKYFTKESSESAAEESDKEDSSVAKLDRARGEVPADYVSSSDEESSS 120

Query: 121 XXXXXXXXXXXXXXXXXXXXXXXXXSGDPSKVLAVVNLDWDHVKCADLLVAFNSFVPEGG 180
                                    SGDPSKVLAVVNLDWDHVKCADLLVAFNSFVPEGG
Sbjct: 121 ESEADSDDATAESDEEVEIEEEKPESGDPSKVLAVVNLDWDHVKCADLLVAFNSFVPEGG 180

Query: 181 KIERVAIYPSEFGKERMQREEVEGPPREVFXXXXXXXXXXXXXXEIGLKDLYEQGDAEKD 240
           KIERVAIYPSEFGKERMQREEVEGPPREVF              EIGLKDLYEQGDAEKD
Sbjct: 181 KIERVAIYPSEFGKERMQREEVEGPPREVFKSKKDKKAKQDDDDEIGLKDLYEQGDAEKD 240

Query: 241 YDSKAXXXXXXXXXXXXXXXXXXXXXXTAEAIYQNCDGTEYESTANMFDLRYVPEGVTFD 300
           YDSKA                      TAEAIYQNCDGTEYESTANMFDLRYVPEGVTFD
Sbjct: 241 YDSKALRRYQLERLRYYYAVVYCNNVATAEAIYQNCDGTEYESTANMFDLRYVPEGVTFD 300

Query: 301 DEPREECASVPKDYKPVQFSTSALQHLQVKLTWDETPADRVEMAKRAFSQKEIEDMDFKA 360
           DEPREECASVPKDYKPVQFSTSALQHLQVKLTWDETPADRVEMAKRAFSQKEIEDMDFKA
Sbjct: 301 DEPREECASVPKDYKPVQFSTSALQHLQVKLTWDETPADRVEMAKRAFSQKEIEDMDFKA 360

Query: 361 YLXXXXXXXXXXXXXXXKNKLRSLVSSVKVADKPLFADESDEEEADVQITFTP 413
           YL               KNKLRSLVSSVKVADKPLFADESDEEEADVQITFTP
Sbjct: 361 YLASDSEESEADDNSEAKNKLRSLVSSVKVADKPLFADESDEEEADVQITFTP 413

 Score =  167 bits (423), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 98/123 (79%), Positives = 98/123 (79%)

Query: 480 NDKRAXXXXXXXXXXXNSQSINSSAHFNMNDILRSEKERGKKSKYQKKDKIVEDDFKPDL 539
           NDKRA           NSQSINSSAHFNMNDILRSEKERGKKSKYQKKDKIVEDDFKPDL
Sbjct: 480 NDKRAELELLMMEDDENSQSINSSAHFNMNDILRSEKERGKKSKYQKKDKIVEDDFKPDL 539

Query: 540 NDPRFKEVFEDRDFAIDPSQPEFKETAAMKQILQEXXXXXXXXXXXXXXTDEQSDSAMDS 599
           NDPRFKEVFEDRDFAIDPSQPEFKETAAMKQILQE              TDEQSDSAMDS
Sbjct: 540 NDPRFKEVFEDRDFAIDPSQPEFKETAAMKQILQERRKRSSKSASKKRKTDEQSDSAMDS 599

Query: 600 AGD 602
           AGD
Sbjct: 600 AGD 602

>Ecym_4790 Chr4 complement(1534067..1535959) [1893 bp, 630 aa] {ON}
           similar to Ashbya gossypii AER259W + AER260C
          Length = 630

 Score =  426 bits (1095), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 225/407 (55%), Positives = 259/407 (63%), Gaps = 7/407 (1%)

Query: 14  DKRFARIESDPKFRAPKQKNLKIKLDDRFSKQDLEYKRKAKVDKYGRRIGTAPGKEEKDF 73
           D RFA I +DPKFR PK   LKI LDDRFSK+DLE+KRKAKVDKYGRRIG+   KE KDF
Sbjct: 14  DSRFAGIHNDPKFRKPKVNKLKITLDDRFSKKDLEFKRKAKVDKYGRRIGSYDEKEAKDF 73

Query: 74  EKYFTXXXXXXXXXXX----XXXXXXVAKLDRARGEVPADYVXXXXXXXXXXXXXXXXXX 129
           ++YF+                     V+ LDRARGEVP DY                   
Sbjct: 74  DRYFSKNESVEKIQSDDEEGETEDIAVSALDRARGEVPLDYESSSDENSSSESEEESEDS 133

Query: 130 XXXXXXXXXXXXXXXXSGDPSKVLAVVNLDWDHVKCADLLVAFNSFVPEGGKIERVAIYP 189
                           +GDP+KV AVVNLDWDHV+  DLL  FNSFVP GG I++VAIYP
Sbjct: 134 ALDPDSELEIEESKPETGDPTKVFAVVNLDWDHVRSVDLLATFNSFVPNGGSIKKVAIYP 193

Query: 190 SEFGKERMQREEVEGPPREVFXXXXXXXXXXX--XXXEIGLKDLYEQGDAEKDYDSKAXX 247
           SEFGKERM+REEVEGPPRE+F                +I + DLYE  DAEKDYDSKA  
Sbjct: 194 SEFGKERMKREEVEGPPRELFKRKQSKKEKDSDDENSDIDINDLYEVDDAEKDYDSKALR 253

Query: 248 XXXXXXXXXXXXXXXXXXXXTAEAIYQNCDGTEYESTANMFDLRYVPEGVTFDDEPREEC 307
                               TA+AIYQNCDGTE+ESTANMFDLRYVP+ + F+D+PR++C
Sbjct: 254 RYQLDRLRYYYAVVYCSDVLTAKAIYQNCDGTEFESTANMFDLRYVPDNMKFEDDPRDQC 313

Query: 308 ASVPKDYKPVQFSTSALQHLQVKLTWDETPADRVEMAKRAFSQKEIEDMDFKAYLXXXXX 367
            SVPKDYKP QFSTSALQH QVKLTWDETPADRVE++KRAF+QKEIE+MDFKAYL     
Sbjct: 314 VSVPKDYKPTQFSTSALQHSQVKLTWDETPADRVEISKRAFNQKEIEEMDFKAYLASDSD 373

Query: 368 XXXXXXXXXXKNKLRSLVS-SVKVADKPLFADESDEEEADVQITFTP 413
                     KN LRSLV+ S++VA K +F     EEEADV+ITFTP
Sbjct: 374 SSEGETNEKTKNALRSLVNDSIQVAHKSVFDKHGSEEEADVEITFTP 420

 Score =  122 bits (307), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 71/76 (93%)

Query: 499 SINSSAHFNMNDILRSEKERGKKSKYQKKDKIVEDDFKPDLNDPRFKEVFEDRDFAIDPS 558
           ++N++AHFNMN+I++S+KE+ KKS+YQ K+ IV+D+FKPDLNDPRFKEVFED DFAIDPS
Sbjct: 508 TLNNNAHFNMNEIIKSQKEKTKKSRYQNKNVIVDDNFKPDLNDPRFKEVFEDHDFAIDPS 567

Query: 559 QPEFKETAAMKQILQE 574
           QPEFK+T AMK+IL+E
Sbjct: 568 QPEFKKTPAMKEILEE 583

>SAKL0G02442g Chr7 complement(201924..203795) [1872 bp, 623 aa] {ON}
           similar to uniprot|Q06344 YDR365C Saccharomyces
           cerevisiae ESF1 Nucleolar protein involved in pre-rRNA
           processing
          Length = 623

 Score =  422 bits (1085), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 226/405 (55%), Positives = 262/405 (64%), Gaps = 6/405 (1%)

Query: 14  DKRFARIESDPKFRAPKQKNLKIKLDDRFSKQDLEYKRKAKVDKYGRRIGTAPGKEEKDF 73
           D RF+ I SDPKF+  K KNLKIKLDDRFSK+DLE K+KAKVDKYGRR+     KE KDF
Sbjct: 13  DPRFSGIHSDPKFKDAKPKNLKIKLDDRFSKKDLEIKKKAKVDKYGRRLKDVDNKETKDF 72

Query: 74  EKYFTXXXXXXXXXXXXXXXXXVAKLDRARGEVPADYVXXXXXXXXXXXXXXXXXXXXXX 133
           E+YF                  V  LDRARGEVP+DY+                      
Sbjct: 73  ERYFEKEEESSSPSDEEGESTKVTSLDRARGEVPSDYLSSSEEESSSESEEESENSELES 132

Query: 134 XXXXXXXXXXXX-SGDPSKVLAVVNLDWDHVKCADLLVAFNSFVPEGGKIERVAIYPSEF 192
                        +GD +++LAVVNLDWDHVK  DL+V F+SFVP+GGKI ++AIYPSEF
Sbjct: 133 EESDLEIEESKPPTGDATRMLAVVNLDWDHVKSTDLMVTFSSFVPKGGKILKIAIYPSEF 192

Query: 193 GKERMQREEVEGPPREVFXXXXXXXXXXXXX-XEIGLKDLYEQGDAEKDYDSKAXXXXXX 251
           GKERMQREEVEGPPRE+F               ++ +KDLYE+GDAEKDYDSKA      
Sbjct: 193 GKERMQREEVEGPPRELFQGKKKKSQRKDGDDSDVDIKDLYEEGDAEKDYDSKALRRYQL 252

Query: 252 XXXXXXXXXXXXXXXXTAEAIYQNCDGTEYESTANMFDLRYVPEGVTFDDEPREECASVP 311
                           TAEAIYQNCDGTEYESTANMFDLRYVPEG+ F DEP++EC  VP
Sbjct: 253 DRLRYYYAVVFCNNVETAEAIYQNCDGTEYESTANMFDLRYVPEGMDFSDEPKDECEDVP 312

Query: 312 KDYKPVQFSTSALQHLQVKLTWDETPADRVEMAKRAFSQKEIEDMDFKAYLXXXXXXXXX 371
           K+YKP QFST ALQH  VKLTWDETPA+RVEM+KRAF+QKEIEDMDFKAYL         
Sbjct: 313 KNYKPAQFSTDALQHSNVKLTWDETPAERVEMSKRAFTQKEIEDMDFKAYLASDSEGSEE 372

Query: 372 XXXXXXKNKLRSLVS-SVKVADKPLFADESDEEEADV--QITFTP 413
                 +NKL+SLVS S+++ DK LF D+SD E  DV  +ITFTP
Sbjct: 373 EINEDSRNKLKSLVSESIRIGDKSLF-DKSDNEGGDVDMEITFTP 416

 Score =  125 bits (315), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 68/75 (90%)

Query: 500 INSSAHFNMNDILRSEKERGKKSKYQKKDKIVEDDFKPDLNDPRFKEVFEDRDFAIDPSQ 559
           +N  AHFNM +ILRSEKE+GK++KYQ ++KIVED+FKPDLNDPRF+EVFED DFAIDPSQ
Sbjct: 505 LNKKAHFNMTEILRSEKEKGKRTKYQNREKIVEDEFKPDLNDPRFREVFEDHDFAIDPSQ 564

Query: 560 PEFKETAAMKQILQE 574
           PEFK T AMK+IL+E
Sbjct: 565 PEFKGTTAMKEILKE 579

>KAFR0E03910 Chr5 complement(773170..775047) [1878 bp, 625 aa] {ON}
           Anc_5.430 YDR365C
          Length = 625

 Score =  396 bits (1018), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 218/411 (53%), Positives = 254/411 (61%), Gaps = 10/411 (2%)

Query: 9   GKDSIDKRFARIESDPKFRAPKQKNLKIKLDDRFSKQDLEYKRKAKVDKYGRRIGTAPGK 68
           GK S D RF+RI +DPKF+  K K+LKI+LD RFSK+DLE + KAKVDKYGR+      K
Sbjct: 5   GKKSDDPRFSRIYNDPKFKNAKTKHLKIRLDSRFSKRDLEIRNKAKVDKYGRKTKDEGSK 64

Query: 69  EE-KDFEKYFTXXXXXXXXXXXXXXXXXVAKLDRARGEVPADYVXXXXXXXXXXXXXXXX 127
           +E  DFEKYF                    K+DRARGEVP+DYV                
Sbjct: 65  KELDDFEKYFEKEDEEEKKDTEETEEK--PKVDRARGEVPSDYVSSSDEYTSSESEDSEE 122

Query: 128 XXXXXXXXXXXXXXXXX-XSGDPSKVLAVVNLDWDHVKCADLLVAFNSFVPEGGKIERVA 186
                              +GD SK LAVVNLDWDHVK ADL+V F+SFVP+GGKI R+ 
Sbjct: 123 EELDSDVESEVEIENTKPETGDASKTLAVVNLDWDHVKSADLMVTFSSFVPKGGKISRIC 182

Query: 187 IYPSEFGKERMQREEVEGPPREVFXXXXXXXXXXX----XXXEIGLKDLYEQGDAEKDYD 242
           IYPSEFGKER+QREEVEGPP+E+F                  ++ +KDLYE+GDAEKD D
Sbjct: 183 IYPSEFGKERLQREEVEGPPKELFQKKNKKKASHKEDFDSDSDVDIKDLYEEGDAEKDVD 242

Query: 243 SKAXXXXXXXXXXXXXXXXXXXXXXTAEAIYQNCDGTEYESTANMFDLRYVPEGVTFDDE 302
           SKA                      TA AIY+NCDGTEYESTANMFDLRYVP+G+TFDDE
Sbjct: 243 SKALRQYQLERLRYYYAVVYCNNIDTARAIYENCDGTEYESTANMFDLRYVPDGMTFDDE 302

Query: 303 PREECASVPKDYKPVQFSTSALQHLQVKLTWDETPADRVEMAKRAFSQKEIEDMDFKAYL 362
           PR+EC S+PK+YKP+QFST ALQH  VKLTWDETPADRVE+AKRAFSQKEIEDMDFKAYL
Sbjct: 303 PRDECNSLPKNYKPMQFSTDALQHSNVKLTWDETPADRVEVAKRAFSQKEIEDMDFKAYL 362

Query: 363 XXXXXXXXXXXXXXXKNKLRSLVSSVKVADKPLFADESDEEEADVQITFTP 413
                          KNKL++LV   +  D         E E D++ITFTP
Sbjct: 363 ASDSDESEEEVNENSKNKLKALVG--ESLDFGTNGASDGESEVDMEITFTP 411

 Score =  119 bits (297), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 62/77 (80%), Positives = 71/77 (92%)

Query: 498 QSINSSAHFNMNDILRSEKERGKKSKYQKKDKIVEDDFKPDLNDPRFKEVFEDRDFAIDP 557
           QS+N  AHFN+N+I+RSEKE+GKK KYQ+K+KIVEDDFKPDL+DPRFKEVFED DFAIDP
Sbjct: 499 QSLNKKAHFNLNEIIRSEKEKGKKGKYQRKEKIVEDDFKPDLSDPRFKEVFEDHDFAIDP 558

Query: 558 SQPEFKETAAMKQILQE 574
           SQPEFK+T AMKQIL E
Sbjct: 559 SQPEFKQTNAMKQILNE 575

>KLLA0E21165g Chr5 (1890314..1892197) [1884 bp, 627 aa] {ON} similar
           to uniprot|Q06344 YDR365C Saccharomyces cerevisiae ESF1
           Nucleolar protein involved in pre-rRNA processing
          Length = 627

 Score =  395 bits (1016), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 221/425 (52%), Positives = 266/425 (62%), Gaps = 19/425 (4%)

Query: 4   NNEGTGKDSI--DKRFARIESDPKFRAPKQKNLKIKLDDRFSKQDLEYKRKAKVDKYGRR 61
           N++G  K+ I  D RF+ I +DPKFR+ K KN KIKLDDRFSKQDLE +RKAKVDKYGR+
Sbjct: 2   NSKGEKKEKITEDPRFSGIHNDPKFRSTKSKNFKIKLDDRFSKQDLEVRRKAKVDKYGRK 61

Query: 62  IGTAPGKEEKDFEKYFTXXX----------XXXXXXXXXXXXXXVAKLDRARGEVPADYV 111
           I  A  K+ KDF++YFT                              +DRARGE PADYV
Sbjct: 62  IVDA-NKDVKDFDRYFTKEKPEDKEDESNSSESSDDQEAEAAVHAKSVDRARGEPPADYV 120

Query: 112 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSGDPSKVLAVVNLDWDHVKCADLLVA 171
                                             SG+ +  LAVVNLDWDHVK ADL V 
Sbjct: 121 SSSDEESSSESEEESGDSDIESEEIELEESKPA-SGNATNTLAVVNLDWDHVKSADLFVT 179

Query: 172 FNSFVPEGGKIERVAIYPSEFGKERMQREEVEGPPREVFXXXXXXXXXXXXXXEIGLKDL 231
           F SFVP+GG+I+++AIYPSEFGKERMQREE+EGPP+E+F              EI ++ +
Sbjct: 180 FKSFVPKGGEIQKIAIYPSEFGKERMQREEIEGPPKELFQSKKSKKNDKDDD-EINVESI 238

Query: 232 YEQGDAEKDYDSKAXXXXXXXXXXXXXXXXXXXXXXTAEAIYQNCDGTEYESTANMFDLR 291
           YE+GDAE DYDSKA                      TAE+IYQNCDGTEYESTAN+FDLR
Sbjct: 239 YEEGDAE-DYDSKALRRYQLERLRYYYAVVYCSDIRTAESIYQNCDGTEYESTANVFDLR 297

Query: 292 YVPEGVTFDDEPREECASVPKDYKPVQFSTSALQHLQVKLTWDETPADRVEMAKRAFSQK 351
           YVP+G+  DD+PR+EC S+PK+YKP QFST ALQH +VKLTWDETPADRVE++KRAF+QK
Sbjct: 298 YVPDGMEMDDDPRDECTSLPKNYKPAQFSTDALQHSKVKLTWDETPADRVEISKRAFTQK 357

Query: 352 EIEDMDFKAYLXXXXXXXXXXXXXXXKNKLRSLV-SSVKVADKPLFADESDEE--EADVQ 408
           EIE+MDFKAYL               KNKL++LV  SVKV  K LF  + DE+  EAD++
Sbjct: 358 EIEEMDFKAYLASDSEESEVEHDDQVKNKLKALVMDSVKVGQKSLFDQKEDEDDNEADME 417

Query: 409 ITFTP 413
           ITFTP
Sbjct: 418 ITFTP 422

 Score =  105 bits (262), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 70/76 (92%)

Query: 499 SINSSAHFNMNDILRSEKERGKKSKYQKKDKIVEDDFKPDLNDPRFKEVFEDRDFAIDPS 558
           +IN+ AHFNMN+IL+SEKE+ KK+KYQ K+KIV+D+F PD+NDPRFKEVFED DFAIDP+
Sbjct: 506 TINNKAHFNMNEILKSEKEKSKKAKYQNKEKIVDDEFTPDVNDPRFKEVFEDHDFAIDPT 565

Query: 559 QPEFKETAAMKQILQE 574
           QPEFK+T AM++IL+E
Sbjct: 566 QPEFKKTPAMEKILKE 581

>NCAS0F03350 Chr6 complement(677168..679087) [1920 bp, 639 aa] {ON}
           Anc_5.430 YDR365C
          Length = 639

 Score =  394 bits (1012), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 212/427 (49%), Positives = 264/427 (61%), Gaps = 17/427 (3%)

Query: 1   MAKNNEGTGKDSIDKRFARIESDPKFRAPKQKNLKIKLDDRFSKQDLEYKRKAKVDKYGR 60
           M+++N   G D  D RF+ I +DPKFR  K KNLKIKLD+RFSK+DLE +RKAKVDKYGR
Sbjct: 1   MSEDNSTKGTD--DSRFSGIYNDPKFRKTKNKNLKIKLDERFSKKDLEIRRKAKVDKYGR 58

Query: 61  RI---GTAPGKEEKDFEKYFTXXXXXXXXXXXXXXXXXVAKLDRARGEVPADYVXXXXXX 117
           +I        KE KDF+KYF                  V  +DRARGEVPADYV      
Sbjct: 59  KIHEDNDMNNKELKDFDKYFEKEGESADEKKEEEEIETVT-VDRARGEVPADYVSSSDEY 117

Query: 118 XXXXXXXXXXXXXXXXXXXXXXXXXXX-XSGDPSKVLAVVNLDWDHVKCADLLVAFNSFV 176
                                        +GD +K LAVVNLDWDHV+ +DL++ F+ F+
Sbjct: 118 TSSESEDSGESDLESEGESEIEVDEATPETGDATKTLAVVNLDWDHVRSSDLMITFSGFL 177

Query: 177 PEGGKIERVAIYPSEFGKERMQREEVEGPPREVFXXXXXXXXXXXXXXEIG-----LKDL 231
           P+GGKIE++ + PSEFGKERMQREE EGPPRE+F              +       +KDL
Sbjct: 178 PKGGKIEKIVVLPSEFGKERMQREETEGPPRELFQKKKKKGKRASVESDSDDSDVDIKDL 237

Query: 232 YEQGDAEKDYDSKAXXXXXXXXXXXXXXXXXXXXXXTAEAIYQNCDGTEYESTANMFDLR 291
           YE+GDA+KD D++A                       A AIY+NCDGTEYESTANMFDLR
Sbjct: 238 YEEGDADKDVDTRALRQYQLERLRYYYAVVYCNSVEAARAIYENCDGTEYESTANMFDLR 297

Query: 292 YVPEGVTFDDEPREECASVPKDYKPVQFSTSALQHLQVKLTWDETPADRVEMAKRAFSQK 351
           YVP+G+ FDDEPR++C+S+PK+YKP QFST ALQH  VKLTWDETPA+RVE+AKRAF+QK
Sbjct: 298 YVPDGMDFDDEPRDQCSSLPKNYKPHQFSTDALQHSNVKLTWDETPAERVEVAKRAFTQK 357

Query: 352 EIEDMDFKAYLXXXXXXXXXXXXXXXKNKLRSLVS-SVKVADKPLFAD----ESDEEEAD 406
           EIEDMDFKAYL               KNKL+SLV  S+++ ++P+F      E ++EE D
Sbjct: 358 EIEDMDFKAYLASDSDGSEDEVNQDAKNKLKSLVGDSLRIGNQPIFGSKDTLEGEDEEVD 417

Query: 407 VQITFTP 413
           ++ITF P
Sbjct: 418 MEITFDP 424

 Score =  109 bits (273), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 59/75 (78%), Positives = 66/75 (88%)

Query: 500 INSSAHFNMNDILRSEKERGKKSKYQKKDKIVEDDFKPDLNDPRFKEVFEDRDFAIDPSQ 559
           IN  AHFNM +ILRSEKE+ KK KYQ K +IVED+FKPDLNDPRFKEVFED DFAIDPS+
Sbjct: 514 INKKAHFNMKEILRSEKEKSKKGKYQDKRRIVEDNFKPDLNDPRFKEVFEDHDFAIDPSR 573

Query: 560 PEFKETAAMKQILQE 574
           PEFKET AMK+IL+E
Sbjct: 574 PEFKETPAMKEILKE 588

>Suva_2.538 Chr2 complement(960917..962806) [1890 bp, 629 aa] {ON}
           YDR365C (REAL)
          Length = 629

 Score =  390 bits (1002), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 208/413 (50%), Positives = 256/413 (61%), Gaps = 13/413 (3%)

Query: 10  KDSIDKRFARIESDPKFRAPKQKNLKIKLDDRFSKQDLEYKRKAKVDKYGRRIGTAPG-K 68
           K+S+D RFA I +DPKF+  + ++ KIKLD RFSK+DLE + K+KVDKYGR+I  A   K
Sbjct: 8   KESVDARFAGIYNDPKFKNTRTRDHKIKLDSRFSKKDLEVQHKSKVDKYGRKIKDAHNTK 67

Query: 69  EEKDFEKYFTXXXXXXXXXXXXXXXXXVAKLDRARGEVPADYVXXXXX-XXXXXXXXXXX 127
           E +DF+KYF                   A +DRARGEVP DYV                 
Sbjct: 68  ELEDFDKYFEKEAENEEDTEADVK----ATVDRARGEVPNDYVSSGDEFTSSDSESSGES 123

Query: 128 XXXXXXXXXXXXXXXXXXSGDPSKVLAVVNLDWDHVKCADLLVAFNSFVPEGGKIERVAI 187
                             SGD SK LAVVNLDWDHVK  DL++ F+ FVP+GGKIER+++
Sbjct: 124 EIESEEESEVEAEDAKPESGDASKTLAVVNLDWDHVKSEDLMITFSGFVPKGGKIERISV 183

Query: 188 YPSEFGKERMQREEVEGPPREVFXXXXXXXXXXXXXXEI-------GLKDLYEQGDAEKD 240
           YPSEFGKERMQREE+EGPP+E+F              +        G+KDLYE+GDA+KD
Sbjct: 184 YPSEFGKERMQREEIEGPPKELFQRKKQVKASKKENADDSDSDIDIGIKDLYEEGDADKD 243

Query: 241 YDSKAXXXXXXXXXXXXXXXXXXXXXXTAEAIYQNCDGTEYESTANMFDLRYVPEGVTFD 300
            DS+A                      TA AIY+NCDGTEYESTANMFDLRYVP+G+TFD
Sbjct: 244 VDSRALRQYQLDRLRYYYAIVDCSDISTARAIYENCDGTEYESTANMFDLRYVPDGMTFD 303

Query: 301 DEPREECASVPKDYKPVQFSTSALQHLQVKLTWDETPADRVEMAKRAFSQKEIEDMDFKA 360
           D  R+ C+++PK+Y+P QFST ALQH  VKLTWDETPADRVE+AKRAF+QKEI+DMDFKA
Sbjct: 304 DTARDACSTLPKNYRPHQFSTDALQHSNVKLTWDETPADRVEVAKRAFTQKEIDDMDFKA 363

Query: 361 YLXXXXXXXXXXXXXXXKNKLRSLVSSVKVADKPLFADESDEEEADVQITFTP 413
           YL               K+KL+SLV  +    K   A++ DEEE D++ITFTP
Sbjct: 364 YLASDSDESDEEVNEDAKSKLKSLVGGLGFNSKKENANDGDEEEVDMEITFTP 416

 Score =  124 bits (312), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 68/76 (89%)

Query: 499 SINSSAHFNMNDILRSEKERGKKSKYQKKDKIVEDDFKPDLNDPRFKEVFEDRDFAIDPS 558
           SINS AHFNMN+ILRSEKE+ KKS+YQKK++IVED+F PDL DPRFKEVFED DFAIDP+
Sbjct: 506 SINSKAHFNMNEILRSEKEKHKKSRYQKKERIVEDNFTPDLEDPRFKEVFEDHDFAIDPT 565

Query: 559 QPEFKETAAMKQILQE 574
           QPE+K T AM +IL+E
Sbjct: 566 QPEYKGTQAMNKILKE 581

>KLTH0F16148g Chr6 (1310041..1311981) [1941 bp, 646 aa] {ON} similar
           to uniprot|Q06344 YDR365C Saccharomyces cerevisiae ESF1
           Nucleolar protein involved in pre-rRNA processing
          Length = 646

 Score =  389 bits (998), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 214/438 (48%), Positives = 260/438 (59%), Gaps = 26/438 (5%)

Query: 1   MAKNNEGTGKDSIDKRFARIESDPKFRAPKQKNLKIKLDDRFSKQDLEYKRKAKVDKYGR 60
           M+K NE     S D RFA +E+DPKFR  + K  KIKLDDRFSK+DLE+KRKA+VDKYGR
Sbjct: 1   MSKENETRQGGSSDPRFAGVENDPKFRETRAKKFKIKLDDRFSKKDLEFKRKARVDKYGR 60

Query: 61  RIGTAPGKEEKDFEKYFTXXXXXX-------------------XXXXXXXXXXXVAKLDR 101
           R+     K+++DF+KY+                                        LDR
Sbjct: 61  RLKGQESKDKRDFDKYYEKEKSGKTAPDSELVGKPSEEDSEGGSSDEEGAASAKTVSLDR 120

Query: 102 ARGEVPADYVXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XXXXXXSGDPSKVLAVVNLDW 160
           ARGEV +DYV                                   SGD SK LAVVNLDW
Sbjct: 121 ARGEVHSDYVSSSDEESSSESEEDSADSDLESEESEVQIEEGEVKSGDSSKTLAVVNLDW 180

Query: 161 DHVKCADLLVAFNSFVPEGGKIERVAIYPSEFGKERMQREEVEGPPREVFXXXXXXXXXX 220
           DHVK  DL+V F+SFVP+GGKI RVAIYPSEFGKER+ +EE EGPPRE+F          
Sbjct: 181 DHVKSTDLMVTFSSFVPKGGKINRVAIYPSEFGKERLAKEETEGPPREIFKSKEKGKKSH 240

Query: 221 X--XXXEIGLKDLYEQGDAEKDYDSKAXXXXXXXXXXXXXXXXXXXXXXTAEAIYQNCDG 278
                 E+ +KDLYE+GDA+ D+D+K+                      TAE+IY+NCDG
Sbjct: 241 GDDSDEELTVKDLYEEGDAD-DFDAKSLRRYQLERLRYYYAVVYCNNKQTAESIYKNCDG 299

Query: 279 TEYESTANMFDLRYVPEGVTFDDEPREECASVPKDYKPVQFSTSALQHLQVKLTWDETPA 338
           TEYESTANMFDLRYVP+G+ FDDE R+EC SVPK+Y+P +FST ALQH +VK TWDETPA
Sbjct: 300 TEYESTANMFDLRYVPDGMDFDDEARDECDSVPKNYRPSEFSTDALQHSKVKFTWDETPA 359

Query: 339 DRVEMAKRAFSQKEIEDMDFKAYLXXXXXXXXXXXXXXXKNKLRSLVS-SVKVADKPLFA 397
           DR  MAKRAF+Q+EIEDMDFKAYL               KNKL+SLV+ SV+V +K +F 
Sbjct: 360 DRTAMAKRAFTQREIEDMDFKAYLASDSEDSEPENNQELKNKLKSLVNQSVQVGEKSIFD 419

Query: 398 DESDEEEADV--QITFTP 413
            +  + E+DV  QITF P
Sbjct: 420 QDPKDGESDVDMQITFAP 437

 Score =  130 bits (327), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 69/75 (92%)

Query: 500 INSSAHFNMNDILRSEKERGKKSKYQKKDKIVEDDFKPDLNDPRFKEVFEDRDFAIDPSQ 559
           +N  AHFNMN+I+RSEKE+GKK+K+Q K++IVED+FKPDLNDPRF EVFED DFAIDPSQ
Sbjct: 526 LNKKAHFNMNEIVRSEKEKGKKAKFQDKNRIVEDEFKPDLNDPRFSEVFEDHDFAIDPSQ 585

Query: 560 PEFKETAAMKQILQE 574
           PEFK TAAMKQILQE
Sbjct: 586 PEFKGTAAMKQILQE 600

>YDR365C Chr4 complement(1204497..1206383) [1887 bp, 628 aa] {ON}
           ESF1Nucleolar protein involved in pre-rRNA processing;
           depletion causes severely decreased 18S rRNA levels
          Length = 628

 Score =  386 bits (992), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 214/417 (51%), Positives = 254/417 (60%), Gaps = 14/417 (3%)

Query: 6   EGTGKDSIDKRFARIESDPKFRAPKQKNLKIKLDDRFSKQDLEYKRKAKVDKYGRRIGTA 65
           E   K+ +D RFA I SDPKF+  K K+ KIKLD RFSK+DLE + K+KVDKYGR+I  A
Sbjct: 4   ENPKKEGVDARFAGIYSDPKFKNTKTKDHKIKLDSRFSKKDLEVQHKSKVDKYGRKIKNA 63

Query: 66  PGKEE-KDFEKYFTXXXXXXXXXXXXXXXXXVAKLDRARGEVPADYVXXXXX-XXXXXXX 123
               E +DF+KYF                     +DRARGEVP DYV             
Sbjct: 64  QNNRELEDFDKYFEKEAENDEDSEVNAKTV----VDRARGEVPDDYVSSSDEFTSSDSES 119

Query: 124 XXXXXXXXXXXXXXXXXXXXXXSGDPSKVLAVVNLDWDHVKCADLLVAFNSFVPEGGKIE 183
                                 SGD SK LAVVNLDWDHVK  DL++ F+SFVP+GGKIE
Sbjct: 120 SGESEVESEEENEVEIENAKPESGDISKNLAVVNLDWDHVKSEDLMITFSSFVPKGGKIE 179

Query: 184 RVAIYPSEFGKERMQREEVEGPPREVFXXXXXXXXXXXXX-------XEIGLKDLYEQGD 236
           RVAIYPSEFGKERMQREEVEGPP+E+F                     +IG+KDLYE+GD
Sbjct: 180 RVAIYPSEFGKERMQREEVEGPPKELFQKKNKNKTSKKKKTDDSDSDMDIGIKDLYEEGD 239

Query: 237 AEKDYDSKAXXXXXXXXXXXXXXXXXXXXXXTAEAIYQNCDGTEYESTANMFDLRYVPEG 296
           A+KD DS+A                      T++AIY NCDGTEYESTANMFDLRYVP+G
Sbjct: 240 ADKDVDSRALRQYQLDRLRYYYAIVYCSDTTTSKAIYDNCDGTEYESTANMFDLRYVPDG 299

Query: 297 VTFDDEPREECASVPKDYKPVQFSTSALQHLQVKLTWDETPADRVEMAKRAFSQKEIEDM 356
           +TFDD+ R+EC+ +PK+Y+P QFST ALQH  VKLTWDETPADRVE+AKRAF+QKEI+DM
Sbjct: 300 MTFDDDVRDECSILPKNYRPHQFSTDALQHSSVKLTWDETPADRVEVAKRAFTQKEIDDM 359

Query: 357 DFKAYLXXXXXXXXXXXXXXXKNKLRSLVSSVKVADKPLFADESDEEEADVQITFTP 413
           DFKAYL               KNKL+SLV       K    ++ D EE D++ITFTP
Sbjct: 360 DFKAYLASDSDESDGQVDEEAKNKLKSLVGDFGFNSKKETPNDED-EEVDMEITFTP 415

 Score =  120 bits (302), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 56/76 (73%), Positives = 66/76 (86%)

Query: 499 SINSSAHFNMNDILRSEKERGKKSKYQKKDKIVEDDFKPDLNDPRFKEVFEDRDFAIDPS 558
           +IN+ AHFNMN+ILRSEKE+ KK +YQKK++IVED F PDL DPRFKEVFED DFAIDP+
Sbjct: 505 TINNKAHFNMNEILRSEKEKHKKGRYQKKERIVEDTFTPDLEDPRFKEVFEDHDFAIDPT 564

Query: 559 QPEFKETAAMKQILQE 574
           QPEFK T AM +IL+E
Sbjct: 565 QPEFKGTQAMSKILKE 580

>NDAI0B05640 Chr2 complement(1377917..1379926) [2010 bp, 669 aa]
           {ON} Anc_5.430 YDR365C
          Length = 669

 Score =  386 bits (991), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 212/449 (47%), Positives = 261/449 (58%), Gaps = 37/449 (8%)

Query: 1   MAKNNEGTGKDSIDKRFARIESDPKFRAPKQKNLKIKLDDRFSKQDLEYKRKAKVDKYGR 60
           MA +N    K+S D RFA+I +DPKFR  K K+LKIKLDDRFSK+DLE +RK+KVDKYGR
Sbjct: 1   MAPSN-SENKESTDPRFAKIYNDPKFRKTKNKDLKIKLDDRFSKKDLEIRRKSKVDKYGR 59

Query: 61  RIGTAPG--KEEKDFEKYFTXXXXXXXXXXXXXXXXXV-------------------AKL 99
           ++  + G  KE  DF+KYF                                        +
Sbjct: 60  KLADSKGNEKEMNDFDKYFEKDDEKKESEEIATEKSVSVEEKEDEEEERKETELEDDTNI 119

Query: 100 DRARGEVPADYVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XSGDPSKVLAVVNL 158
           DRARG+VPADYV                                   SG+PSK LAVVNL
Sbjct: 120 DRARGDVPADYVSSSDEYTSSESEASDEEELDSDVESGEEVTTQEPESGEPSKTLAVVNL 179

Query: 159 DWDHVKCADLLVAFNSFVPEGGKIERVAIYPSEFGKERMQREEVEGPPREVFXXXXXX-- 216
           DWDHVK +DL++ F+SF+PEGG+IE +AIYPSEFGKERMQRE+VEGPP+E+F        
Sbjct: 180 DWDHVKSSDLMITFSSFLPEGGRIENIAIYPSEFGKERMQREDVEGPPKELFQKRKKKTS 239

Query: 217 -------XXXXXXXXEIGLKDLYEQGDAEKDYDSKAXXXXXXXXXXXXXXXXXXXXXXTA 269
                          ++ +KDLYE+GDA+KD D+KA                      TA
Sbjct: 240 KSKKISDEANDSDVSDVDIKDLYEEGDADKDVDTKALRQYQLERLRYYYAVVYCNNIETA 299

Query: 270 EAIYQNCDGTEYESTANMFDLRYVPEGVTFDDEPREECASVPKDYKPVQFSTSALQHLQV 329
            AIYQNCDGTEYESTANMFDLRYVP+G+ F DEPR++C S+PK+YKP QFST ALQH  V
Sbjct: 300 TAIYQNCDGTEYESTANMFDLRYVPDGMDFTDEPRDQCDSLPKNYKPHQFSTDALQHSNV 359

Query: 330 KLTWDETPADRVEMAKRAFSQKEIEDMDFKAYLXXXXXXXXXXXXXXXKNKLRSLVSSVK 389
           KLTWDETP +R E+AKRAF+QKEI+DMDFKAYL               KNKL++LV    
Sbjct: 360 KLTWDETPVERQEVAKRAFTQKEIDDMDFKAYLASDSDGSEDELNEDAKNKLKALVGGGG 419

Query: 390 VADKPLFADES-----DEEEADVQITFTP 413
              + +F  +      DE+E D++ITF P
Sbjct: 420 FGSREIFGGKGAKAGEDEDEVDMEITFNP 448

 Score =  134 bits (337), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 62/76 (81%), Positives = 71/76 (93%)

Query: 499 SINSSAHFNMNDILRSEKERGKKSKYQKKDKIVEDDFKPDLNDPRFKEVFEDRDFAIDPS 558
           +IN+ AHFNMN+ILRSEKE+GK+ KYQ KDKIVED+FKPDLNDPRFKEVFED DFAIDPS
Sbjct: 540 TINNKAHFNMNEILRSEKEKGKRGKYQNKDKIVEDEFKPDLNDPRFKEVFEDHDFAIDPS 599

Query: 559 QPEFKETAAMKQILQE 574
           +PEFKET AMK+IL+E
Sbjct: 600 RPEFKETKAMKEILKE 615

>Smik_4.632 Chr4 complement(1130422..1132305) [1884 bp, 627 aa] {ON}
           YDR365C (REAL)
          Length = 627

 Score =  381 bits (978), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 208/413 (50%), Positives = 249/413 (60%), Gaps = 14/413 (3%)

Query: 10  KDSIDKRFARIESDPKFRAPKQKNLKIKLDDRFSKQDLEYKRKAKVDKYGRRI-GTAPGK 68
           K+  D RFA I SDPKF+  + K+ KIKLD RFSK+DLE + K+KVDKYGR+I  T   K
Sbjct: 8   KEGADTRFAGIYSDPKFKNTRTKDHKIKLDSRFSKKDLEVQHKSKVDKYGRKIKNTQNNK 67

Query: 69  EEKDFEKYFTXXXXXXXXXXXXXXXXXVAKLDRARGEVPADYVXXXXX-XXXXXXXXXXX 127
           E +DF+KYF                     +DRARGE+  DYV                 
Sbjct: 68  ELEDFDKYFQKEAENDEDTEASVKTV----VDRARGEISGDYVSSSDEFTSSDSESSEQS 123

Query: 128 XXXXXXXXXXXXXXXXXXSGDPSKVLAVVNLDWDHVKCADLLVAFNSFVPEGGKIERVAI 187
                              GD SK LAVVNLDWDHVK  DL++ F+SFVP+GGK+ERVAI
Sbjct: 124 EVESEVESEVEIEDPKPECGDVSKTLAVVNLDWDHVKSEDLMITFSSFVPKGGKLERVAI 183

Query: 188 YPSEFGKERMQREEVEGPPREVFXXXXXXXXXXXXXXE-------IGLKDLYEQGDAEKD 240
           YPSEFGKERMQREEVEGPP+E+F              +       IG+ DLYE+GDA+KD
Sbjct: 184 YPSEFGKERMQREEVEGPPKELFQKKNKNKVSRKKKSDESDSDIDIGINDLYEEGDADKD 243

Query: 241 YDSKAXXXXXXXXXXXXXXXXXXXXXXTAEAIYQNCDGTEYESTANMFDLRYVPEGVTFD 300
            DS+A                      T++AIY NCDGTEYESTANMFDLRYVP+G+TFD
Sbjct: 244 VDSRALRQYQLDRLRYYYAIVYCSDITTSKAIYDNCDGTEYESTANMFDLRYVPDGMTFD 303

Query: 301 DEPREECASVPKDYKPVQFSTSALQHLQVKLTWDETPADRVEMAKRAFSQKEIEDMDFKA 360
           D  R+EC  +PK+Y+P QFST ALQH  VKLTWDETPADR+E+AKRAF+QKEI+DMDFKA
Sbjct: 304 DAVRDECTLLPKNYRPHQFSTDALQHSNVKLTWDETPADRLEVAKRAFTQKEIDDMDFKA 363

Query: 361 YLXXXXXXXXXXXXXXXKNKLRSLVSSVKVADKPLFADESDEEEADVQITFTP 413
           YL               KNKL+SLV  +    K     +SD EE D++ITFTP
Sbjct: 364 YLASDSDESDEQIDEDAKNKLKSLVGGINFNSKKENVKDSD-EEVDMEITFTP 415

 Score =  124 bits (312), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 56/76 (73%), Positives = 68/76 (89%)

Query: 499 SINSSAHFNMNDILRSEKERGKKSKYQKKDKIVEDDFKPDLNDPRFKEVFEDRDFAIDPS 558
           +IN+ AHFNMN+ILRSEKE+ KKS+YQ K++IVED+F PDLNDPRFKEVFED DFAIDP+
Sbjct: 504 TINNKAHFNMNEILRSEKEKNKKSRYQNKERIVEDNFTPDLNDPRFKEVFEDHDFAIDPT 563

Query: 559 QPEFKETAAMKQILQE 574
           QPE+K T AM +IL+E
Sbjct: 564 QPEYKSTQAMNKILKE 579

>Kpol_1016.8 s1016 (16620..18533) [1914 bp, 637 aa] {ON}
           (16620..18533) [1914 nt, 638 aa]
          Length = 637

 Score =  379 bits (973), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 210/424 (49%), Positives = 258/424 (60%), Gaps = 17/424 (4%)

Query: 6   EGTGKDSIDKRFARIESDPKFRAPKQKNLKIKLDDRFSKQDLEYKRKAKVDKYGRRI-GT 64
           E + K S D RF+ I SDPKF+  K+KN+KIKLDDRF K DL+ K K+KVDKYGR++   
Sbjct: 4   EDSMKQSSDPRFSGIYSDPKFKNSKRKNIKIKLDDRFDKSDLQIKHKSKVDKYGRKLKDV 63

Query: 65  APGKEEKDFEKYFTXXXXXXXXXXXXXXXXXVAKLDRARGEVPADYVXXXXXXXXXXXXX 124
              KE +DF+KYF                  V  LDRARGEVP+DY              
Sbjct: 64  KDNKELEDFDKYFEKEDEEDKEEEIGTEAK-VKVLDRARGEVPSDYESSSEEFTSSDSES 122

Query: 125 XXXXXXXXXXXXXXXXXXXX-XSGDPSKVLAVVNLDWDHVKCADLLVAFNSFVPEGGKIE 183
                                 SGD SK LAVVNLDWD+VK  DL++ F+SF+P+GGKIE
Sbjct: 123 SGESEVDSDEESEDEVETSKPESGDSSKTLAVVNLDWDYVKSQDLMITFSSFLPKGGKIE 182

Query: 184 RVAIYPSEFGKERMQREEVEGPPREVFXXXXXXXXXXXXXXE----------IGLKDLYE 233
           ++ IYPSEFGKERM REEVEGPPRE+F              +          + +++LYE
Sbjct: 183 KICIYPSEFGKERMAREEVEGPPRELFNKKKNKKSSKKSSKDDDEDDESDSDVDIRELYE 242

Query: 234 QGDAEKDYDSKAXXXXXXXXXXXXXXXXXXXXXXTAEAIYQNCDGTEYESTANMFDLRYV 293
           +GDAEKD DSKA                      +AE+IY+NCDGTEYES+AN+FDLRYV
Sbjct: 243 EGDAEKDVDSKALRQYQLERLRYYYAVVYCNNIASAESIYENCDGTEYESSANIFDLRYV 302

Query: 294 PEGVTFDDEPREECASVPKDYKPVQFSTSALQHLQVKLTWDETPADRVEMAKRAFSQKEI 353
           P+G  FDDEPR+EC  +PK+YK  QF+T ALQH  VKLTWDETPADRVE+AKRAF+QKEI
Sbjct: 303 PDGTEFDDEPRDECLQLPKNYKVRQFTTDALQHSNVKLTWDETPADRVEIAKRAFTQKEI 362

Query: 354 EDMDFKAYLXXXXXXXXXXXXXXXKNKLRSLVS-SVKVADKPLFADESD---EEEADVQI 409
           E+MDFKAYL               KNKL+SLVS S  + DK +F D+ D   E++ D++I
Sbjct: 363 EEMDFKAYLASDSDESEEEPNDDVKNKLKSLVSQSTTIGDKSIFDDKGDNNEEDDVDMEI 422

Query: 410 TFTP 413
           TFTP
Sbjct: 423 TFTP 426

 Score =  112 bits (279), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 60/79 (75%), Positives = 72/79 (91%)

Query: 496 NSQSINSSAHFNMNDILRSEKERGKKSKYQKKDKIVEDDFKPDLNDPRFKEVFEDRDFAI 555
           ++ ++N  AHFNMN+I+RSEKE+GKKSKYQ K+KIVEDDFKPDLNDPRFKE+FED DFAI
Sbjct: 514 STSTLNKKAHFNMNEIVRSEKEKGKKSKYQDKNKIVEDDFKPDLNDPRFKEIFEDHDFAI 573

Query: 556 DPSQPEFKETAAMKQILQE 574
           DP+Q EFKET AMK+IL+E
Sbjct: 574 DPTQSEFKETTAMKEILKE 592

>TDEL0E01950 Chr5 (367743..369596) [1854 bp, 617 aa] {ON} Anc_5.430
           YDR365C
          Length = 617

 Score =  378 bits (970), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 204/411 (49%), Positives = 252/411 (61%), Gaps = 11/411 (2%)

Query: 10  KDSIDKRFARIESDPKFRAPKQKNLKIKLDDRFSKQDLEYKRKAKVDKYGRRI-GTAPGK 68
           K S D RF++I  DPKF   K K  K+KLDDRFSK+DLE KRK KVDKYGRR+      K
Sbjct: 4   KRSKDPRFSKIYDDPKFNNVKTKGFKVKLDDRFSKKDLEIKRKTKVDKYGRRMRDVEDSK 63

Query: 69  EEKDFEKYFTXXXXXXXXXXXXXXXXXVAKLDRARGEVPADYVXXXXXXXXXXXXXXXXX 128
           E KDF+KYF                  +  +DRARGEVP+DYV                 
Sbjct: 64  ESKDFDKYF----EQSDEEKKKDKDTEILTVDRARGEVPSDYVSSSDEFTSSDSEVSDNE 119

Query: 129 XXXXXXXXXXXXXXXXXSGDPSKVLAVVNLDWDHVKCADLLVAFNSFVPEGGKIERVAIY 188
                            SGD SK LAVVNLDWD+V+ +DL++ F+SF+P GG+IE++AIY
Sbjct: 120 VESESESEVELEKTEPSSGDSSKTLAVVNLDWDNVRSSDLMITFSSFLPAGGRIEKIAIY 179

Query: 189 PSEFGKERMQREEVEGPPREVFXXXXXXX---XXXXXXXEIGLKDLYEQGDAEKDYDSKA 245
           PSEFGKERMQREEVEGPP+E+F                 +I +KDLYE+GDA+K+ D+KA
Sbjct: 180 PSEFGKERMQREEVEGPPKELFQKKKKKSKKGQQEDSDSDIDVKDLYEEGDADKNVDNKA 239

Query: 246 XXXXXXXXXXXXXXXXXXXXXXTAEAIYQNCDGTEYESTANMFDLRYVPEGVTFDDEPRE 305
                                  AE+IY NCDGTEYESTAN+FD+RYVP+G+ FD +P++
Sbjct: 240 LRQYQLDRLRYYYAVVYCNNVAAAESIYNNCDGTEYESTANIFDIRYVPDGMDFDGKPKD 299

Query: 306 ECASVPKDYKPVQFSTSALQHLQVKLTWDETPADRVEMAKRAFSQKEIEDMDFKAYLXXX 365
            C  +PK+YKP+QFST ALQH  VKLTWDETPADR+++AKRAF+QKEIEDMDFKAYL   
Sbjct: 300 SCTELPKNYKPLQFSTDALQHSNVKLTWDETPADRLDVAKRAFTQKEIEDMDFKAYLASD 359

Query: 366 XXXXXXXXXXXXKNKLRSLVSSVKVAD-KPLFADESD--EEEADVQITFTP 413
                       K+KL+SLV+     D     ADE D  +EE D++ITFTP
Sbjct: 360 SDDSEDEVDAQSKSKLKSLVTGSSAFDFTRKNADEVDGNDEEVDMEITFTP 410

 Score = 78.6 bits (192), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 63/75 (84%)

Query: 498 QSINSSAHFNMNDILRSEKERGKKSKYQKKDKIVEDDFKPDLNDPRFKEVFEDRDFAIDP 557
           +SIN  AHFNM +IL+SEKE+ KK+KYQ K+KIV DDFKPDL DPRFKE+FE  DFAIDP
Sbjct: 496 KSINKKAHFNMKEILKSEKEKKKKNKYQDKNKIVVDDFKPDLEDPRFKEMFEGHDFAIDP 555

Query: 558 SQPEFKETAAMKQIL 572
           +Q EF+ T AMK++L
Sbjct: 556 TQSEFRGTKAMKEML 570

>Kwal_55.21444 s55 (839767..841701) [1935 bp, 644 aa] {ON} YDR365C -
           Protein required for cell viability [contig 130] FULL
          Length = 644

 Score =  378 bits (971), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 214/440 (48%), Positives = 258/440 (58%), Gaps = 28/440 (6%)

Query: 1   MAKNNEGTGKDSIDKRFARIESDPKFRAPKQKNLKIKLDDRFSKQDLEYKRKAKVDKYGR 60
           M++      ++S D RFA + SDPKFR  K K  KIKLDDRFSK+DL++KRKA+VDKYGR
Sbjct: 1   MSQEKHAGKEESSDPRFANVHSDPKFRETKAKKFKIKLDDRFSKKDLQFKRKARVDKYGR 60

Query: 61  RIGTAPGKEEKDF-------------------EKYFTXXXXXXXXXXXXXXXXXV--AKL 99
            +     K++KDF                   E+                    V    L
Sbjct: 61  SLKGQENKDKKDFDKYYEKDDKKKEDKVKPDDEEKSDSEAESANEAKDIGDSAAVKPVSL 120

Query: 100 DRARGEVPADYVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XSGDPSKVLAVVNL 158
           DRARGEVP+DYV                                   SGD SK LAVVNL
Sbjct: 121 DRARGEVPSDYVSSSEDESSSESEAGSEDSDIESEESEVEIEDTKPQSGDSSKTLAVVNL 180

Query: 159 DWDHVKCADLLVAFNSFVPEGGKIERVAIYPSEFGKERMQREEVEGPPREVFXXXXXXXX 218
           DWDHVK  DL++ F+SFVP GGKI ++A+YPSEFGKER++REE+EGPPRE+F        
Sbjct: 181 DWDHVKSTDLMITFSSFVPSGGKIIKIAVYPSEFGKERLKREEMEGPPREIFKSKNSKKK 240

Query: 219 XXXXXXEIGLKD--LYEQGDAEKDYDSKAXXXXXXXXXXXXXXXXXXXXXXTAEAIYQNC 276
                 +  +    LYE+GDAE DYD+K+                      TAEAIY+NC
Sbjct: 241 SHDDDSDSDVDVRDLYEEGDAE-DYDAKSLRRYQLDRLRYFYAVVYCNNVATAEAIYKNC 299

Query: 277 DGTEYESTANMFDLRYVPEGVTFDDEPREECASVPKDYKPVQFSTSALQHLQVKLTWDET 336
           DGTE+ESTANMFDLRYVP+G+TFDDE R+EC S+PK+Y+P QFST ALQH +VKLTWDET
Sbjct: 300 DGTEFESTANMFDLRYVPDGMTFDDEARDECTSIPKNYQPSQFSTDALQHSKVKLTWDET 359

Query: 337 PADRVEMAKRAFSQKEIEDMDFKAYLXXXXXXXXXXXXXXXKNKLRSLVS-SVKVADKPL 395
           PADRV M+KRAF+QKEIEDMDFKAYL               K KL+SLVS SVKV DK +
Sbjct: 360 PADRVAMSKRAFTQKEIEDMDFKAYLASDSEESEPENNQDLKTKLKSLVSQSVKVGDKSI 419

Query: 396 F--ADESDEEEADVQITFTP 413
           F  A E  E + D+QITF P
Sbjct: 420 FDQAPEEGESDVDMQITFAP 439

 Score =  138 bits (348), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 65/79 (82%), Positives = 72/79 (91%)

Query: 496 NSQSINSSAHFNMNDILRSEKERGKKSKYQKKDKIVEDDFKPDLNDPRFKEVFEDRDFAI 555
           +S  +N  AHFNMN+I+RSEKE+GKKS+YQ KDKIVED+FKPDLNDPRF EVFEDRDFAI
Sbjct: 523 SSSKLNKKAHFNMNEIVRSEKEKGKKSRYQNKDKIVEDEFKPDLNDPRFAEVFEDRDFAI 582

Query: 556 DPSQPEFKETAAMKQILQE 574
           DPSQPEFK TAAMKQILQE
Sbjct: 583 DPSQPEFKGTAAMKQILQE 601

>TPHA0H01780 Chr8 complement(409713..411581) [1869 bp, 622 aa] {ON}
           Anc_5.430 YDR365C
          Length = 622

 Score =  375 bits (964), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 201/411 (48%), Positives = 254/411 (61%), Gaps = 15/411 (3%)

Query: 12  SIDKRFARIESDPKFRAPKQKNLKIKLDDRFSKQDLEYKRKAKVDKYGRRIGTAPGKEEK 71
           + D+RF+ + +DPKF+  ++KNLKIKLD RFSK DLE  RKA+VDKYGR+I     +E K
Sbjct: 8   NTDERFSGVFNDPKFKNARKKNLKIKLDSRFSKSDLEVNRKARVDKYGRKISNLNNQEAK 67

Query: 72  DFEKYFTXXXXXXXXXXXXXXXXXVAKLDRARGEVPADYVXXXXXXXXXXXXXXXXXXXX 131
           DF+KYF                     +DRARGEVP+DY                     
Sbjct: 68  DFDKYFEKEEDGKGEEIAVKPL-----IDRARGEVPSDYQSSLDDYTSSESEDSEDEDLE 122

Query: 132 XXXXXXXXXXXXX-XSGDPSKVLAVVNLDWDHVKCADLLVAFNSFVPEGGKIERVAIYPS 190
                          SGD SK +AVVNLDWDHVK  DLLV F+SFVP+GGKIER+AI+PS
Sbjct: 123 SEGESEAEIEETKPESGDSSKTIAVVNLDWDHVKATDLLVTFSSFVPKGGKIERIAIFPS 182

Query: 191 EFGKERMQREEVEGPPREVFXXXXXXXXXXXXX-----XEIGLKDLYEQGDAEKDYDSKA 245
           EFGK+RM+REE+EGPP+E+F                   ++ + DLYE+GD +K+ DSK+
Sbjct: 183 EFGKQRMEREELEGPPKELFQKKKKKNSKKSNAEFNDDSDVDINDLYEEGDVDKEVDSKS 242

Query: 246 XXXXXXXXXXXXXXXXXXXXXXTAEAIYQNCDGTEYESTANMFDLRYVPEGVTFDDEPRE 305
                                 TAEAIY NCDGTEYESTAN+FDLRYVP+G+ F+D+P +
Sbjct: 243 LRQYQLDRLRYYYAVVFCNNISTAEAIYNNCDGTEYESTANVFDLRYVPDGMDFEDQPYD 302

Query: 306 ECASVPKDYKPVQFSTSALQHLQVKLTWDETPADRVEMAKRAFSQKEIEDMDFKAYLXXX 365
           EC  +PK+Y P+ F+T ALQH  VKLTWDETPADRVE+AKRAF+QKEI++MDFKAYL   
Sbjct: 303 ECTELPKNYTPLNFTTDALQHSNVKLTWDETPADRVEIAKRAFTQKEIDEMDFKAYL-AS 361

Query: 366 XXXXXXXXXXXXKNKLRSLVS-SVKVADKPLFADESDEE--EADVQITFTP 413
                       KNKL+SLV  S+K+ DK +  ++SD E  E D++ITFTP
Sbjct: 362 DSEESEGENEEVKNKLKSLVGLSMKIGDKSIMDNKSDNEDGEVDMEITFTP 412

 Score =  103 bits (258), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 56/78 (71%), Positives = 68/78 (87%)

Query: 497 SQSINSSAHFNMNDILRSEKERGKKSKYQKKDKIVEDDFKPDLNDPRFKEVFEDRDFAID 556
           + +IN  AHFNM +ILRSEKE+ KKSK+Q K+KIVED+FK DLNDPRF E+FED DFAID
Sbjct: 501 TSTINKKAHFNMKEILRSEKEKTKKSKFQNKEKIVEDNFKADLNDPRFNEMFEDHDFAID 560

Query: 557 PSQPEFKETAAMKQILQE 574
           P+Q E+KETAAMK+IL+E
Sbjct: 561 PTQSEYKETAAMKEILKE 578

>CAGL0L11638g Chr12 (1243194..1245020) [1827 bp, 608 aa] {ON}
           similar to uniprot|Q06344 Saccharomyces cerevisiae
           YDR365c
          Length = 608

 Score =  372 bits (954), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 202/413 (48%), Positives = 251/413 (60%), Gaps = 15/413 (3%)

Query: 12  SIDKRFARIESDPKFRAPKQKNLKIKLDDRFSKQDLEYKRKAKVDKYGRRIGTAPGKEEK 71
           S D RF+RI +DPKF+    K LKIKLDDRF K+DLE  R+AKVDKYGR+I     K+ +
Sbjct: 6   SNDPRFSRIYNDPKFKKSNSKQLKIKLDDRFGKKDLEVARRAKVDKYGRKIKEGSSKDIE 65

Query: 72  DFEKYFTXXXXXXXXXXXXXXXXXVAK--LDRARGEVPADYVXXX---XXXXXXXXXXXX 126
           DF+KYF                   +K  +DRARGEVP+DYV                  
Sbjct: 66  DFDKYFEKDEKSAEEESADEGDVAKSKKIVDRARGEVPSDYVSSEDEFTSSDSDTSGDSD 125

Query: 127 XXXXXXXXXXXXXXXXXXXSGDPSKVLAVVNLDWDHVKCADLLVAFNSFVPEGGKIERVA 186
                              +GD +K LA VNLDWDHV+  D++V F+SF+P+GGKIE++ 
Sbjct: 126 YDSEIESGDEAQEEQTKVETGDATKTLAAVNLDWDHVRSVDMMVTFSSFLPKGGKIEKIC 185

Query: 187 IYPSEFGKERMQREEVEGPPREVFXXXXXXXXXXXXXXE----IGLKDLYEQGDAEKDYD 242
           IYPSEFGKERM+REEVEGPPRE+F              E    + +KDLYE+G+A+   D
Sbjct: 186 IYPSEFGKERMKREEVEGPPRELFQKNKKKKKKNSSEDEEESDVDIKDLYEEGNADDQVD 245

Query: 243 SKAXXXXXXXXXXXXXXXXXXXXXXTAEAIYQNCDGTEYESTANMFDLRYVPEGVTFDDE 302
            +A                      +A+AIY+NCDGTEYESTAN+ DLRYVP+G+ FDDE
Sbjct: 246 KRALRQYQLDRLRYYYAVIYCNNVESAKAIYENCDGTEYESTANIIDLRYVPDGMDFDDE 305

Query: 303 PREECASVPKDYKPVQFSTSALQHLQVKLTWDETPADRVEMAKRAFSQKEIEDMDFKAYL 362
           P+++C  +PK+YKP QFST ALQH  VKLTWDETP DRVE+AKRAF+QKEIEDMDFKAYL
Sbjct: 306 PKDQCEELPKNYKPHQFSTDALQHSNVKLTWDETPVDRVEVAKRAFTQKEIEDMDFKAYL 365

Query: 363 XXXXXXXXXXXXXXXKNKLRSLVS-SVKVADKPLFADESDEEEA-DVQITFTP 413
                          KNKL+SLV  S+K+  K    D SDE+E  D++ITFTP
Sbjct: 366 ASDSDESEEEVNEEAKNKLKSLVGESLKIDGK----DGSDEDEGMDMEITFTP 414

 Score =  103 bits (257), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 60/79 (75%), Positives = 70/79 (88%)

Query: 496 NSQSINSSAHFNMNDILRSEKERGKKSKYQKKDKIVEDDFKPDLNDPRFKEVFEDRDFAI 555
           ++  INS AHFNMN+ILRSEKE+ KK K+QKK +IVEDDFKP+L+D RFKEVFED DFAI
Sbjct: 495 SNSGINSKAHFNMNEILRSEKEKSKKGKFQKKQRIVEDDFKPNLDDDRFKEVFEDHDFAI 554

Query: 556 DPSQPEFKETAAMKQILQE 574
           DPSQPEFKET AMK+IL+E
Sbjct: 555 DPSQPEFKETKAMKEILKE 573

>ZYRO0F09944g Chr6 complement(807207..809042) [1836 bp, 611 aa] {ON}
           similar to uniprot|Q06344 YDR365C Saccharomyces
           cerevisiae ESF1 Nucleolar protein involved in pre-rRNA
           processing
          Length = 611

 Score =  366 bits (940), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 204/412 (49%), Positives = 251/412 (60%), Gaps = 20/412 (4%)

Query: 10  KDSIDKRFARIESDPKFRAPKQKNLKIKLDDRFSKQDLEYKRKAKVDKYGRRIGTAPGKE 69
           K S D RFA I++DPKFR  K+K LK+KLDDRFSK+DL+ +RKAKVDKYGRRI T   K+
Sbjct: 8   KGSSDPRFAGIQNDPKFRNFKKKGLKVKLDDRFSKKDLDVRRKAKVDKYGRRI-TGESKD 66

Query: 70  EKDFEKYFTXXXXXXXXXXXXXXXXXVAK------LDRARGEVPADYVXXXXXXXXXXXX 123
            KDF+KYF                    +      +DRARGE+P  Y             
Sbjct: 67  LKDFDKYFEKEGKEGKEDESSSSSEDEEEETESKVVDRARGELPEAYTSSESEDSESDLS 126

Query: 124 XXXXXXXXXXXXXXXXXXXXXXSGDPSKVLAVVNLDWDHVKCADLLVAFNSFVPEGGKIE 183
                                 SGDPSK LAVVNLDWDHV+ ADL++ F+SF+P GGKIE
Sbjct: 127 EEESEADVAEAVEEAKPE----SGDPSKTLAVVNLDWDHVRAADLMITFSSFLPSGGKIE 182

Query: 184 RVAIYPSEFGKERMQREEVEGPPREVFXXXXXXXXXXXXXXEIGLKDLYEQGDAEKDYDS 243
           ++ IYPSEFGKERMQREE EGPPRE+F              ++ ++DLYE+GDA+K+ D+
Sbjct: 183 KICIYPSEFGKERMQREEKEGPPREIFNKKKKHHDEDSDS-DVDIRDLYEEGDADKEVDN 241

Query: 244 KAXXXXXXXXXXXXXXXXXXXXXXTAEAIYQNCDGTEYESTANMFDLRYVPEGVTFDDEP 303
            A                      T E+IY NCDGTEYESTAN+FDLRYVPEG+ FDDEP
Sbjct: 242 AALRQYQLERLRYYYAIVYCNNVETGESIYSNCDGTEYESTANIFDLRYVPEGMEFDDEP 301

Query: 304 REECASVPKDYKPVQFSTSALQHLQVKLTWDETPADRVEMAKRAFSQKEIEDMDFKAYLX 363
           ++EC  +PK+YKP++FST ALQH  VKLTWDETP DR+E++KRAFSQKE+EDMDF+AYL 
Sbjct: 302 KDECKELPKNYKPLEFSTDALQHSNVKLTWDETPTDRLEVSKRAFSQKELEDMDFQAYLA 361

Query: 364 XXXXXX--XXXXXXXXKNKLRSLVSSVKVADKPLFADESDEEEADVQITFTP 413
                           KNKL+SLV       + L   +  EEE D++ITFTP
Sbjct: 362 SGTDESDGEENNNEEAKNKLKSLVG------QSLAYGKQQEEEPDMEITFTP 407

 Score = 97.1 bits (240), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 56/77 (72%), Positives = 68/77 (88%)

Query: 498 QSINSSAHFNMNDILRSEKERGKKSKYQKKDKIVEDDFKPDLNDPRFKEVFEDRDFAIDP 557
           +S+N  AHFNMN+IL+SEKE+ KK KYQ K KI+ED+FKPDLNDPRF EVFE++DFAIDP
Sbjct: 492 KSLNKKAHFNMNEILKSEKEKKKKGKYQDKGKIMEDEFKPDLNDPRFNEVFENQDFAIDP 551

Query: 558 SQPEFKETAAMKQILQE 574
           SQPE+K T AMK+IL+E
Sbjct: 552 SQPEYKSTKAMKEILEE 568

>KNAG0C04940 Chr3 (953539..955467) [1929 bp, 642 aa] {ON} Anc_5.430
           YDR365C
          Length = 642

 Score =  366 bits (939), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 214/426 (50%), Positives = 252/426 (59%), Gaps = 24/426 (5%)

Query: 12  SIDKRFARIESDPKFRAPKQKNLKIKLDDRFSKQDLEYKRKAKVDKYGRRI--GTAPGKE 69
           S D RF+ + +DPKFR+ K+K LK+KLD RFSK+DLE K+KAKVDKYGR+I  G A  KE
Sbjct: 6   SSDPRFSGVYNDPKFRSTKEKKLKVKLDSRFSKKDLEVKKKAKVDKYGRKIKNGDANKKE 65

Query: 70  EKDFEKYFTXXXXXXXXXXXXXXXXXV-AKLDRARGEVPADYVXXXXXXXXXXXXXXXXX 128
            +DF+KYF                  V   +DRARGEVP DYV                 
Sbjct: 66  LEDFDKYFEKEDEAKESEDAEAPEAPVKVVVDRARGEVPDDYVSSADEFTSSDSESSGSS 125

Query: 129 XXXXXXXXX------XXXXXXXXSGDPSKVLAVVNLDWDHVKCADLLVAFNSFVPEGGKI 182
                                  SGDPSK LAVVNLDWDHVK  DL++ F  F+P+GGKI
Sbjct: 126 ESESESEQSDVEDEIEANSGKPESGDPSKTLAVVNLDWDHVKSVDLMITFTGFIPKGGKI 185

Query: 183 ERVAIYPSEFGKERMQREEVEGPPREVFXXXXXXXXXXXXX--XEIGLKD---------- 230
           ER+ IYPSEFGKER+ REE EGPP+E+F                E G  D          
Sbjct: 186 ERICIYPSEFGKERLNREEKEGPPKELFHKKKSKKNSAAKSKGAESGKSDDDVSDVDIKD 245

Query: 231 LYEQGDAEKDYDSKAXXXXXXXXXXXXXXXXXXXXXXTAEAIYQNCDGTEYESTANMFDL 290
           LYE+GDAEKD DSKA                      TA+AIY NCD TEYESTANMFDL
Sbjct: 246 LYEEGDAEKDIDSKALRQYQLERLRYFYAVVYCNNVETAKAIYDNCDATEYESTANMFDL 305

Query: 291 RYVPEGVTFDDEPREECASVPKDYKPVQFSTSALQHLQVKLTWDETPADRVEMAKRAFSQ 350
           RYVPEG+TFDD+PR+EC ++PK+YKP+ F+T ALQH  VKLTWDETPADRVE+AKRAFSQ
Sbjct: 306 RYVPEGMTFDDDPRDECEALPKNYKPLNFATDALQHSNVKLTWDETPADRVEIAKRAFSQ 365

Query: 351 KEIEDMDFKAYLXXXXXXXXXXXXXXXKNKLRSLVSSVKVADKP---LFADESDEEEADV 407
           KEI+DMDFKAYL               KN+L++LV     A +P      DE DEE  D+
Sbjct: 366 KEIDDMDFKAYLASDSEDSDAKVDETMKNRLKALVGGTLKASRPKGGAEEDEDDEEGMDM 425

Query: 408 QITFTP 413
           +ITFTP
Sbjct: 426 EITFTP 431

 Score =  102 bits (255), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 68/76 (89%)

Query: 499 SINSSAHFNMNDILRSEKERGKKSKYQKKDKIVEDDFKPDLNDPRFKEVFEDRDFAIDPS 558
           ++N   HFNMN+I+RSEKE+ KKSK+Q K++IVED+FKPDL+D RFKEVFED DFAIDPS
Sbjct: 523 TLNKKMHFNMNEIMRSEKEKKKKSKFQDKNRIVEDEFKPDLSDDRFKEVFEDHDFAIDPS 582

Query: 559 QPEFKETAAMKQILQE 574
           +PEFKET AM++ILQE
Sbjct: 583 RPEFKETPAMQKILQE 598

>Skud_4.635 Chr4 complement(1133271..1135160) [1890 bp, 629 aa] {ON}
           YDR365C (REAL)
          Length = 629

 Score =  359 bits (922), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 210/414 (50%), Positives = 255/414 (61%), Gaps = 14/414 (3%)

Query: 10  KDSIDKRFARIESDPKFRAPKQKNLKIKLDDRFSKQDLEYKRKAKVDKYGRRIGTA-PGK 68
           K+SID RFA I SDPKF+  + ++ KIKLD RFSK+DLE + K+KVDKYGR+I  A   K
Sbjct: 8   KESIDARFAGISSDPKFKNTRTRDHKIKLDSRFSKKDLEVQHKSKVDKYGRKIKDARNNK 67

Query: 69  EEKDFEKYFTXXXXXXXXXXXXXXXXXVAKLDRARGEVPADYVXXXXX-XXXXXXXXXXX 127
           E +DF+KYF                     +DRARGEVP+DYV                 
Sbjct: 68  ELEDFDKYFEKEAEHDEDSEVAAKIV----VDRARGEVPSDYVSSSDEFTSSDSESSGES 123

Query: 128 XXXXXXXXXXXXXXXXXXSGDPSKVLAVVNLDWDHVKCADLLVAFNSFVPEGGKIERVAI 187
                             SGD SK LAVVNLDWDHVK  DL++ F+SFVP GGKIER+AI
Sbjct: 124 EVESEVEGEVETEDVAAESGDVSKTLAVVNLDWDHVKSEDLMITFSSFVPRGGKIERIAI 183

Query: 188 YPSEFGKERMQREEVEGPPREVFXXXXXXXXXXXXXX-------EIGLKDLYEQGDAEKD 240
           +PSEFG+ERM+REEVEGPP+E+F                     +IG+ DLYE+GDA+KD
Sbjct: 184 FPSEFGRERMEREEVEGPPKELFQKKNKNKHAKEKNSVGTDSDGDIGINDLYEEGDADKD 243

Query: 241 YDSKAXXXXXXXXXXXXXXXXXXXXXXTAEAIYQNCDGTEYESTANMFDLRYVPEGVTFD 300
            DS+A                      +A+AIY NCDGTEYESTANMFDLRYVP+G+TFD
Sbjct: 244 VDSRALRQYQLDRLRYYYAVVCCSDTTSAKAIYDNCDGTEYESTANMFDLRYVPDGMTFD 303

Query: 301 DEPREECASVPKDYKPVQFSTSALQHLQVKLTWDETPADRVEMAKRAFSQKEIEDMDFKA 360
           D  R+EC S+PK+Y+P QFST ALQH  VKLTWDETPADR+E+AKRAF+QKEI+DMDFKA
Sbjct: 304 DAARDECTSLPKNYRPHQFSTDALQHSNVKLTWDETPADRLEVAKRAFTQKEIDDMDFKA 363

Query: 361 YLXXXXXXXXXXXXXXXKNKLRSLVSSVKVADKPLFADESDEE-EADVQITFTP 413
           YL               KNKL+SLV  +    K   A++  EE E D++ITFTP
Sbjct: 364 YLASDSDESDEQVDEDAKNKLKSLVGGLDFNMKKKGANDGKEEGEVDMEITFTP 417

 Score =  115 bits (287), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 53/76 (69%), Positives = 64/76 (84%)

Query: 499 SINSSAHFNMNDILRSEKERGKKSKYQKKDKIVEDDFKPDLNDPRFKEVFEDRDFAIDPS 558
           S+NS AHF+M +ILRSEKE+ K+ +YQKK++IVED F PDL DPRFKEVFED DFAIDP+
Sbjct: 506 SMNSKAHFSMKEILRSEKEKHKRGRYQKKERIVEDTFAPDLEDPRFKEVFEDHDFAIDPT 565

Query: 559 QPEFKETAAMKQILQE 574
           QPE+K T AM  IL+E
Sbjct: 566 QPEYKNTQAMSTILKE 581

>TBLA0A06540 Chr1 (1602559..1604538) [1980 bp, 659 aa] {ON}
           Anc_5.430 YDR365C
          Length = 659

 Score =  357 bits (915), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 199/435 (45%), Positives = 257/435 (59%), Gaps = 35/435 (8%)

Query: 14  DKRFARIESDPKFRAPKQKNLKIKLDDRFSKQDLEYKRKAKVDKYGRRIGTAPGKEEKDF 73
           D RFA + +DPKFR  K+ +LK+KLD+RFSK+DL+   K+KVD+YGR+I     K++KDF
Sbjct: 9   DARFAGVFTDPKFRRSKKDSLKVKLDNRFSKKDLQVNYKSKVDRYGRKIIDRNEKDKKDF 68

Query: 74  EKYFTXXXXXXXXXXXXXXX----------------------XXVAKLDRARGEVPADYV 111
           +KY+T                                       +A+LDRARG+VP+DYV
Sbjct: 69  DKYYTKDEDEENKDEEQDKSDQEEESEEEDVDEKADDDEDVLAELARLDRARGDVPSDYV 128

Query: 112 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XSGDPSKVLAVVNLDWDHVKCADLLV 170
                                              +GDPSK +AVVNLDWDHVK  DL++
Sbjct: 129 SSSDDYSSSESESSGESEVDSDEESDAEIESAKPETGDPSKTVAVVNLDWDHVKSTDLMI 188

Query: 171 AFNSFVPEGGKIERVAIYPSEFGKERMQREEVEGPPREVFXXXXXXXXXXXXX------X 224
            F+ F+P+GGKI ++AIYPSEFGKERMQREE+EGPP+E+F                    
Sbjct: 189 TFSGFIPKGGKINKIAIYPSEFGKERMQREEIEGPPKELFKKKNKKGKKSTAEDNEDDVS 248

Query: 225 EIGLKDLYEQGDAEKDYDSKAXXXXXXXXXXXXXXXXXXXXXXTAEAIYQNCDGTEYEST 284
           ++ + DLYE+GDA+K+ DSK+                      TAE+IY+NCDGTEYEST
Sbjct: 249 DVDINDLYEEGDADKNIDSKSLRQYQLERLRYYYAVVYCNNIGTAESIYKNCDGTEYEST 308

Query: 285 ANMFDLRYVPEGVTFDDEPREECASVPKDYKPVQFSTSALQHLQVKLTWDETPADRVEMA 344
           AN+FD+RYVP+ +TFDD PR+EC  +PK+YKP+QFST ALQH  VKLTWDETPADRVE++
Sbjct: 309 ANVFDIRYVPDEMTFDDTPRDECDQLPKNYKPLQFSTDALQHSNVKLTWDETPADRVEIS 368

Query: 345 KRAFSQKEIEDMDFKAYLXXXXXXXXXXXXXXXKNKLRSLV-----SSVKVADKPLFADE 399
           KRAFSQKEI++MDFKAYL               KNKL+SLV      +V   D     D 
Sbjct: 369 KRAFSQKEIDEMDFKAYLASDSDESESELNNDSKNKLKSLVGGGAFGNVFGKDTEYDLDG 428

Query: 400 SDEEEA-DVQITFTP 413
           SD+E+  D++ITFTP
Sbjct: 429 SDDEDGVDMEITFTP 443

 Score =  102 bits (254), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 68/75 (90%)

Query: 500 INSSAHFNMNDILRSEKERGKKSKYQKKDKIVEDDFKPDLNDPRFKEVFEDRDFAIDPSQ 559
           +N+ AHFNMN+ILRSEKE+GKKSKYQ K+KIV+D+FKP+LND RF E+FED  FAIDP+Q
Sbjct: 539 VNNKAHFNMNEILRSEKEKGKKSKYQDKNKIVQDEFKPNLNDSRFDEIFEDHAFAIDPTQ 598

Query: 560 PEFKETAAMKQILQE 574
           PEFK+T+AMK+IL E
Sbjct: 599 PEFKQTSAMKEILNE 613

>YGR145W Chr7 (781767..783890) [2124 bp, 707 aa] {ON}  ENP2Essential
           nucleolar protein, required for biogenesis of the small
           ribosomal subunit; contains WD repeats, interacts with
           Mpp10p and Bfr2p, and has homology to Spb1p
          Length = 707

 Score = 32.3 bits (72), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 21/33 (63%)

Query: 539 LNDPRFKEVFEDRDFAIDPSQPEFKETAAMKQI 571
           L D RFKE+FED +F +D    +FK+   +K I
Sbjct: 477 LTDDRFKEMFEDEEFQVDEDDYDFKQLNPVKSI 509

>Smik_6.248 Chr6 (401099..403222) [2124 bp, 707 aa] {ON} YGR145W
           (REAL)
          Length = 707

 Score = 32.3 bits (72), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 21/33 (63%)

Query: 539 LNDPRFKEVFEDRDFAIDPSQPEFKETAAMKQI 571
           L D RFKE+FED +F +D    +FK+   +K I
Sbjct: 477 LTDDRFKEMFEDEEFQVDEDDYDFKQLNPVKSI 509

>TBLA0A08890 Chr1 (2183143..2185239) [2097 bp, 698 aa] {ON} Anc_4.77
           YGR145W
          Length = 698

 Score = 32.3 bits (72), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 28/45 (62%), Gaps = 4/45 (8%)

Query: 525 QKKDKIVEDDFKPDLNDPRFKEVFEDRDFAIDPSQPEFKETAAMK 569
           ++ DK+VE+     L D RFKE+FED DF I+    ++K+   +K
Sbjct: 467 KRGDKVVENV----LQDDRFKEMFEDEDFQINEDDYDYKQLNPVK 507

>Suva_7.435 Chr7 (752189..754315) [2127 bp, 708 aa] {ON} YGR145W
           (REAL)
          Length = 708

 Score = 32.0 bits (71), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 20/33 (60%)

Query: 539 LNDPRFKEVFEDRDFAIDPSQPEFKETAAMKQI 571
           L D RFKE+FED  F +D    +FK+   +K I
Sbjct: 477 LTDDRFKEMFEDEQFQVDEDDYDFKQLNPVKSI 509

>CAGL0E03069g Chr5 complement(286341..288485,288759..288878) [2265
           bp, 754 aa] {ON} highly similar to uniprot|P48234
           Saccharomyces cerevisiae YGR145w ENP2
          Length = 754

 Score = 31.6 bits (70), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 21/31 (67%)

Query: 539 LNDPRFKEVFEDRDFAIDPSQPEFKETAAMK 569
           L D RFKE+FED DF +D +  ++K+   +K
Sbjct: 538 LTDDRFKEMFEDEDFKVDENDYDYKQLNPVK 568

>Skud_7.467 Chr7 (764555..766681) [2127 bp, 708 aa] {ON} YGR145W
           (REAL)
          Length = 708

 Score = 31.2 bits (69), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 22/33 (66%)

Query: 539 LNDPRFKEVFEDRDFAIDPSQPEFKETAAMKQI 571
           L D RFKE+FE+ +F +D +  +FK+   +K +
Sbjct: 477 LTDDRFKEMFENEEFQVDETDYDFKQLNPVKSL 509

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.131    0.367 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 45,759,605
Number of extensions: 1709662
Number of successful extensions: 4422
Number of sequences better than 10.0: 47
Number of HSP's gapped: 4442
Number of HSP's successfully gapped: 84
Length of query: 619
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 503
Effective length of database: 40,180,143
Effective search space: 20210611929
Effective search space used: 20210611929
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 69 (31.2 bits)