Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AER258C5.431ON55755729450.0
Ecym_47645.431ON56656611771e-155
SAKL0G02464g5.431ON56356511191e-147
KLLA0E21143g5.431ON57257310391e-134
KLTH0F16126g5.431ON55454710351e-134
Kwal_55.214375.431ON55455310101e-130
Suva_8.1715.431ON5675769241e-117
NCAS0H020505.431ON5735809171e-116
YOR118W (RTC5)5.431ON5675519151e-116
TDEL0E019405.431ON5675758971e-113
Smik_15.2965.431ON5665678951e-113
ZYRO0F09966g5.431ON5545708901e-112
KNAG0B042305.431ON5775838411e-105
NDAI0C016105.431ON5845918301e-103
Skud_15.2815.431ON5675648181e-101
Kpol_1016.75.431ON5625668141e-101
TPHA0H017905.431ON5655697997e-99
CAGL0L11616g5.431ON5555647247e-88
TBLA0A065305.431ON4923065504e-63
TDEL0D043003.192ON21582760.64
TDEL0F00110singletonON23469751.0
Smik_2.3936.169ON52385732.6
TPHA0J006704.189ON66089715.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AER258C
         (557 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AER258C Chr5 complement(1111936..1113609) [1674 bp, 557 aa] {ON}...  1139   0.0  
Ecym_4764 Chr4 complement(1484832..1486532) [1701 bp, 566 aa] {O...   457   e-155
SAKL0G02464g Chr7 (204358..206049) [1692 bp, 563 aa] {ON} simila...   435   e-147
KLLA0E21143g Chr5 complement(1888085..1889803) [1719 bp, 572 aa]...   404   e-134
KLTH0F16126g Chr6 complement(1308133..1309797) [1665 bp, 554 aa]...   403   e-134
Kwal_55.21437 s55 complement(836842..838506) [1665 bp, 554 aa] {...   393   e-130
Suva_8.171 Chr8 (304635..306338) [1704 bp, 567 aa] {ON} YOR118W ...   360   e-117
NCAS0H02050 Chr8 (398606..400327) [1722 bp, 573 aa] {ON} Anc_5.4...   357   e-116
YOR118W Chr15 (546857..548560) [1704 bp, 567 aa] {ON}  RTC5Prote...   357   e-116
TDEL0E01940 Chr5 complement(365414..367117) [1704 bp, 567 aa] {O...   350   e-113
Smik_15.296 Chr15 (507990..509690) [1701 bp, 566 aa] {ON} YOR118...   349   e-113
ZYRO0F09966g Chr6 (809604..811268) [1665 bp, 554 aa] {ON} simila...   347   e-112
KNAG0B04230 Chr2 complement(803845..805578) [1734 bp, 577 aa] {O...   328   e-105
NDAI0C01610 Chr3 complement(343850..345604) [1755 bp, 584 aa] {O...   324   e-103
Skud_15.281 Chr15 (503290..504993) [1704 bp, 567 aa] {ON} YOR118...   319   e-101
Kpol_1016.7 s1016 complement(14315..16003) [1689 bp, 562 aa] {ON...   318   e-101
TPHA0H01790 Chr8 (412229..413926) [1698 bp, 565 aa] {ON} Anc_5.4...   312   7e-99
CAGL0L11616g Chr12 complement(1240790..1242457) [1668 bp, 555 aa...   283   7e-88
TBLA0A06530 Chr1 complement(1600111..1601589) [1479 bp, 492 aa] ...   216   4e-63
TDEL0D04300 Chr4 (786841..787488) [648 bp, 215 aa] {ON} Anc_3.19...    34   0.64 
TDEL0F00110 Chr6 complement(1368..2072) [705 bp, 234 aa] {ON}          33   1.0  
Smik_2.393 Chr2 (705234..706805) [1572 bp, 523 aa] {ON} YBR250W ...    33   2.6  
TPHA0J00670 Chr10 complement(148901..150883) [1983 bp, 660 aa] {...    32   5.1  

>AER258C Chr5 complement(1111936..1113609) [1674 bp, 557 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR118W
          Length = 557

 Score = 1139 bits (2945), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 547/557 (98%), Positives = 547/557 (98%)

Query: 1   MGQRASSHVTETTTSRWTFTDRDALIAFFNARALRQLSAVEQWAFHQNIGKNIEPTEELD 60
           MGQRASSHVTETTTSRWTFTDRDALIAFFNARALRQLSAVEQWAFHQNIGKNIEPTEELD
Sbjct: 1   MGQRASSHVTETTTSRWTFTDRDALIAFFNARALRQLSAVEQWAFHQNIGKNIEPTEELD 60

Query: 61  LQALATLYGVPADVPWFTEVFYTFVCRLTSFPLMNDCSPPTYMGLLKVCLLFNKKRAARY 120
           LQALATLYGVPADVPWFTEVFYTFVCRLTSFPLMNDCSPPTYMGLLKVCLLFNKKRAARY
Sbjct: 61  LQALATLYGVPADVPWFTEVFYTFVCRLTSFPLMNDCSPPTYMGLLKVCLLFNKKRAARY 120

Query: 121 TARKSYDXXXXXXXXXXPPRDACDENVDQFDGDKLIDTLDGTFIAELEVRPNKLVRYSPF 180
           TARKSYD          PPRDACDENVDQFDGDKLIDTLDGTFIAELEVRPNKLVRYSPF
Sbjct: 121 TARKSYDVASLVLALLAPPRDACDENVDQFDGDKLIDTLDGTFIAELEVRPNKLVRYSPF 180

Query: 181 IAQISQVCNGSNEPLSRSMFPAWNRNNQIPLALLRSLDSTIVSRSDARSRSITYQQFAGG 240
           IAQISQVCNGSNEPLSRSMFPAWNRNNQIPLALLRSLDSTIVSRSDARSRSITYQQFAGG
Sbjct: 181 IAQISQVCNGSNEPLSRSMFPAWNRNNQIPLALLRSLDSTIVSRSDARSRSITYQQFAGG 240

Query: 241 LRSVFPNVFDALGLFLERLFYVKRDTTNKLLYTPTKETSTIVTNLLLTQLSTLYPRINLF 300
           LRSVFPNVFDALGLFLERLFYVKRDTTNKLLYTPTKETSTIVTNLLLTQLSTLYPRINLF
Sbjct: 241 LRSVFPNVFDALGLFLERLFYVKRDTTNKLLYTPTKETSTIVTNLLLTQLSTLYPRINLF 300

Query: 301 TSMQRLFVAGDAGFSMSVFQAKVFKWMAPTILFVSGTRIQDDEIVCTKNKRYKAFLQDYP 360
           TSMQRLFVAGDAGFSMSVFQAKVFKWMAPTILFVSGTRIQDDEIVCTKNKRYKAFLQDYP
Sbjct: 301 TSMQRLFVAGDAGFSMSVFQAKVFKWMAPTILFVSGTRIQDDEIVCTKNKRYKAFLQDYP 360

Query: 361 ALKDAEQQLALCDRKKRNLIYAIFVRDPWKITNKDLFGDMDTTIIQLAPRQKIFKAQEAP 420
           ALKDAEQQLALCDRKKRNLIYAIFVRDPWKITNKDLFGDMDTTIIQLAPRQKIFKAQEAP
Sbjct: 361 ALKDAEQQLALCDRKKRNLIYAIFVRDPWKITNKDLFGDMDTTIIQLAPRQKIFKAQEAP 420

Query: 421 NIYFNAVGGGIGFGSSQPSVKPAGKRYFPGNVSFTVDPSMEFAVFRNVGDGGMFSHGSAV 480
           NIYFNAVGGGIGFGSSQPSVKPAGKRYFPGNVSFTVDPSMEFAVFRNVGDGGMFSHGSAV
Sbjct: 421 NIYFNAVGGGIGFGSSQPSVKPAGKRYFPGNVSFTVDPSMEFAVFRNVGDGGMFSHGSAV 480

Query: 481 PAPAEQPLSYEHRLMIKDLEVWGYGGEEELQKQIQRWQWEEAEATKRKYIKTNGGNEDRA 540
           PAPAEQPLSYEHRLMIKDLEVWGYGGEEELQKQIQRWQWEEAEATKRKYIKTNGGNEDRA
Sbjct: 481 PAPAEQPLSYEHRLMIKDLEVWGYGGEEELQKQIQRWQWEEAEATKRKYIKTNGGNEDRA 540

Query: 541 LLEMAGIVGHYQSGGSV 557
           LLEMAGIVGHYQSGGSV
Sbjct: 541 LLEMAGIVGHYQSGGSV 557

>Ecym_4764 Chr4 complement(1484832..1486532) [1701 bp, 566 aa] {ON}
           similar to Ashbya gossypii AER258C
          Length = 566

 Score =  457 bits (1177), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 227/566 (40%), Positives = 346/566 (61%), Gaps = 9/566 (1%)

Query: 1   MGQRASSHVTETTTSRWTFTDRDALIAFFNARALRQLSAVEQWAFHQNIGKNIEPTEELD 60
           MGQ ASS   E+   R  F D   ++ FF+ +A+RQL  +E  AF  NIG + +  + L 
Sbjct: 1   MGQNASSRSAESVEGRLIFRDEKEILEFFDNQAVRQLHGLELVAFQNNIGLDADLKDYLS 60

Query: 61  LQALATLYGVPADVPWFTEVFYTFVCRLTSFPLMNDCSP---PTYMGLLKVCLLFNKKRA 117
            + L  L  +P     F +VFY  +   + FPLM   +    PT++GL+K CLLF+ K+ 
Sbjct: 61  CEFLVQLCKLPRHKYGFVKVFYQMIGNASKFPLMGGGAGEDVPTFVGLVKACLLFDYKKL 120

Query: 118 ARYTARKSYDXXXXX--XXXXXPPRDACDENVDQ----FDGDKLIDTLDGTFIAELEVRP 171
            +Y   K+YD            P      + + +    +D  K++++ +   +  +EV  
Sbjct: 121 LKYAQCKTYDQVSLIFILLALEPHAKVSKKELGRPPSSYDARKIMESFNDINLETIEVSA 180

Query: 172 NKLVRYSPFIAQISQVCNGSNEPLSRSMFPAWNRNNQIPLALLRSLDSTIVSRSDARSRS 231
           + L+++  F+  I++ C   N  ++ S++  W       L +LR+++  IVS SDA    
Sbjct: 181 DDLLQFMTFLLVITKYCIFENVEVNPSIYENWKDYESQALNILRTMNPCIVSYSDAAKNV 240

Query: 232 ITYQQFAGGLRSVFPNVFDALGLFLERLFYVKRDTTNKLLYTPTKETSTIVTNLLLTQLS 291
           +T  QF   + +V PN+   LG+F++ + Y      +    T    +ST++T+ LL QL 
Sbjct: 241 VTLAQFKDCITAVCPNLLTPLGVFMKHVLYKSEHLVSDSGATINDRSSTVMTDPLLAQLC 300

Query: 292 TLYPRINLFTSMQRLFVAGDAGFSMSVFQAKVFKWMAPTILFVSGTRIQDDEIVCTKNKR 351
           TL+P+  ++ ++++LF+A  +GFS+  FQAKV  WMAP+IL VSG +I DD  +  KN+R
Sbjct: 301 TLWPKHIIYQNLKKLFIAKQSGFSIRSFQAKVVNWMAPSILLVSGMKIMDDSKLLAKNQR 360

Query: 352 YKAFLQDYPALKDAEQQLALCDRKKRNLIYAIFVRDPWKITNKDLFGDMDTTIIQLAPRQ 411
           YK+FLQ+YP LKD +Q+       KR + +A+FV + WK+TNK+ FG++ T I+QL+PRQ
Sbjct: 361 YKSFLQEYPKLKDEDQKADSIVGGKRKVTFAVFVHEAWKVTNKEQFGNLKTLILQLSPRQ 420

Query: 412 KIFKAQEAPNIYFNAVGGGIGFGSSQPSVKPAGKRYFPGNVSFTVDPSMEFAVFRNVGDG 471
           ++F+A +  NIYFN VGGGIG G+SQP +K +GK+YFPGNVS T+DPS EF VFRNVG G
Sbjct: 421 EVFQASKNGNIYFNTVGGGIGIGNSQPVIKSSGKKYFPGNVSLTIDPSFEFGVFRNVGHG 480

Query: 472 GMFSHGSAVPAPAEQPLSYEHRLMIKDLEVWGYGGEEELQKQIQRWQWEEAEATKRKYIK 531
           G  S G       +   S E R +I+D+EVWG GG++E + Q+++W+WEEAE+ +R+YI 
Sbjct: 481 GSISPGKLFLERPDVEQSLECRFIIQDVEVWGCGGDKEFEAQLKQWEWEEAESERRQYIN 540

Query: 532 TNGGNEDRALLEMAGIVGHYQSGGSV 557
            +   ED+ALLEM G+VGH+QSGGS+
Sbjct: 541 LSSIGEDKALLEMVGLVGHHQSGGSL 566

>SAKL0G02464g Chr7 (204358..206049) [1692 bp, 563 aa] {ON} similar
           to uniprot|Q12108 YOR118W Saccharomyces cerevisiae
           Hypothetical ORF
          Length = 563

 Score =  435 bits (1119), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 221/565 (39%), Positives = 345/565 (61%), Gaps = 10/565 (1%)

Query: 1   MGQRASSHVTETTTSRWTFTDRDALIAFFNARALRQLSAVEQWAFHQNIGKNIEPTEELD 60
           MGQ ASS  T TT +   F  +  L+ +F ARA +Q +  E  AF  N+ K  +  +++ 
Sbjct: 1   MGQTASSG-TGTTGNVLQFESQHDLLGYFAARATKQFTTPELVAFKSNL-KGKDQNDKVS 58

Query: 61  LQALATLYGVPADVPWFTEVFYTFVCRLTSFPLMNDC-SPPTYMGLLKVCLLFNKKRAAR 119
           ++ +  L  +P       ++ +  +  L++FPL+ +     T  GLLK C+L +  R  +
Sbjct: 59  VEEMLQLLKIPLGNELLADLLHNCIKTLSNFPLIRESYDDITVAGLLKSCILLSHDRCIK 118

Query: 120 YTARKSYDXXXXXXXXXXPPRDACD-----ENVDQFDGDKLIDTLDGTFIAELEVRPNKL 174
           Y   K+YD            +   +     +    +D   +I   +   I +L V  + +
Sbjct: 119 YVGFKNYDQLKLIYIALALRKTVKELPSSPDPAKPWDAKSIIRNYNSVDIDDLYVPADSM 178

Query: 175 VRYSPFIAQISQVCNGSNEPLSRSMFPAWNRNNQIPLALLRSLDSTIVSRSDARSRSITY 234
           ++       +S+ C  +N  +  S+F  W+      + LLR+++  IV+  D     I++
Sbjct: 179 LQLLTLSLVLSRHCTVNNAKIRESVFQHWDDYKANAMNLLRTMNPDIVNTQDTVQCVISF 238

Query: 235 QQFAGGLRSVFPNVFDALGLFLERLFYVKRDTTNKLLYTPTKETSTIVTNLLLTQLSTLY 294
           +QF+  + +VFP V   L + +E + Y+ RD T++L  T    TS +VT  LL QLST+ 
Sbjct: 239 EQFSNAIAAVFPQVLKPLEILVEHMLYLDRDLTDELNSTSMPSTSKLVTEPLLAQLSTML 298

Query: 295 PRINLFTSMQRLFVAGDAGFSMSVFQAKVFKWMAPTILFVSGTRIQDD-EIVCTKNKRYK 353
           P+  +++ +++L+V  ++GFSM  FQ+K FKWMAP+IL + G RI DD E   TKN RYK
Sbjct: 299 PKELVYSKLRKLYVGRESGFSMRSFQSKAFKWMAPSILLIGGMRITDDQEYATTKNPRYK 358

Query: 354 AFLQDYPALKDAEQQLA-LCDRKKRNLIYAIFVRDPWKITNKDLFGDMDTTIIQLAPRQK 412
            FL++YP LKD +Q +   C   +R L++A++V +PWK+TNK+LFGD+ TT++QL+P+Q+
Sbjct: 359 KFLEEYPRLKDKDQHIIDPCSLNRRKLLFAVYVNEPWKVTNKELFGDLKTTVVQLSPKQE 418

Query: 413 IFKAQEAPNIYFNAVGGGIGFGSSQPSVKPAGKRYFPGNVSFTVDPSMEFAVFRNVGDGG 472
           +FKA    N+YFN +GGGIG G +QP +KP GK+YFPGNVS T+D S+EFA FR+VG GG
Sbjct: 419 LFKAVRTGNVYFNTLGGGIGVGCAQPVIKPNGKKYFPGNVSLTIDSSLEFASFRHVGYGG 478

Query: 473 MFSHGSAVPAPAEQPLSYEHRLMIKDLEVWGYGGEEELQKQIQRWQWEEAEATKRKYIKT 532
             S G+ +    E+  ++E++ +++D+EVWG GGE+ELQ+QI++W+WEEAEA +R+ I  
Sbjct: 479 AISPGTLMTKLEEEKTTFEYKFIVQDVEVWGCGGEKELQEQIKQWEWEEAEAKRRQRINL 538

Query: 533 NGGNEDRALLEMAGIVGHYQSGGSV 557
               EDRALLEMAG+VG +QSGGS+
Sbjct: 539 QSIGEDRALLEMAGLVGQHQSGGSM 563

>KLLA0E21143g Chr5 complement(1888085..1889803) [1719 bp, 572 aa]
           {ON} similar to uniprot|Q12108 YOR118W Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 572

 Score =  404 bits (1039), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 231/573 (40%), Positives = 339/573 (59%), Gaps = 17/573 (2%)

Query: 1   MGQRASSHVTETTTSRWTFTDRDALIAFFNARALRQLSAVEQWAFHQNIGKNIEPTEELD 60
           MGQ ++S   E   +  +    ++L+ FFN R L+QL+  E  +F  NI +  E  + ++
Sbjct: 1   MGQ-STSKEHENARTNESKLKGESLMDFFNDRCLKQLTTAELISFKNNIPEGKELNDYVE 59

Query: 61  LQALATLYGVPADVPWFTEVFYTFVCRLTSFPLMNDC-SPPTYMGLLKVCLLFNKKRAAR 119
           +  ++ +Y +P D      VF      L +FPL+ D     T+  LLK  LL  K+RA +
Sbjct: 60  VSDISRMYYIPKDSAVMLSVFMNMFHTLANFPLLQDSYEKVTFKTLLKATLLLVKERAIK 119

Query: 120 YTARKSYDXXXXXXXXXXPPRDACDENV-------DQFDGDKLIDTLDGTFIAELEVRPN 172
           YT  K Y+            ++   E +       D  D   +I + +GT   EL+V  N
Sbjct: 120 YTDWKKYNDLKMLFITLSLEKNIKAEPLMDSSALSDCKDWKGVIRSYNGTDFDELKVNAN 179

Query: 173 KLVRYSPFIAQISQVCNGSNEPLSRSMFPAWNRN-NQIPLALLRSLDSTIVSRSDARSRS 231
            L+ +   I  +S+ C  +N  +   +      +     L ++R+++  I+S SD    S
Sbjct: 180 NLLHFLALILALSRCCILNNCKIDNDVLAKSLEDFKHQALNIVRTMNPEIISMSDCLDSS 239

Query: 232 ITYQQFAGGLRSVFPNVFDALGLFLERLFYVKRDTTNKLLYTPTKETSTIVTNLLLTQLS 291
           ITY QF+  +  V PN+ + L + +E + Y+ RD  +  +  P    + IV    L+QL+
Sbjct: 240 ITYTQFSMAVNDVAPNLLNPLKMLMEHVLYMDRDLVDADVLQPISNPTKIVNESELSQLA 299

Query: 292 TLYPRINLFTSMQRLFVAGDAGFSMSVFQAKVFKWMAPTILFVSGTRIQDDE-----IVC 346
           T  P+  +F+  Q+L+V  ++GFSM  FQ+KVFKWMAPTILFV G RI+D++        
Sbjct: 300 TFLPKEIVFSRFQKLYVGRESGFSMRSFQSKVFKWMAPTILFVEGMRIRDEDDEDGDAYA 359

Query: 347 TKNKRYKAFLQDYPALKDAEQQLALCDRKKRNLIYAIFVRDPWKITNKDLFGDMDTTIIQ 406
            KN RY+ FLQ+Y  LK  +Q L    +KKR L++A+ +RDPWK++NKDLFGD  T IIQ
Sbjct: 360 VKNPRYRNFLQEYGKLKSEDQHLDTLSKKKRKLLFAVCIRDPWKVSNKDLFGDSSTKIIQ 419

Query: 407 LAPRQKIFKAQ--EAPNIYFNAVGGGIGFGSSQPSVKPAGKRYFPGNVSFTVDPSMEFAV 464
           L PRQ+IF A   +  N+YFN VGGGIG GSSQP +K  GK+YFPGNVS T+D S+EF +
Sbjct: 420 LHPRQEIFDADPFKTGNVYFNTVGGGIGIGSSQPIIKANGKKYFPGNVSLTIDSSLEFGI 479

Query: 465 FRNVGDGGMFSHGSAVPAPAEQPLSYEHRLMIKDLEVWGYGGEEELQKQIQRWQWEEAEA 524
           FR++G GG F  G  +    E+  S+E+R +I+D+EVWG GGE+EL++Q+++WQWEEAEA
Sbjct: 480 FRHLGAGGSFKPGRLISGRGEERNSFEYRFIIQDVEVWGCGGEKELEEQVKQWQWEEAEA 539

Query: 525 TKRKYIKTNGGNEDRALLEMAGIVGHYQSGGSV 557
            +R+ I      EDRALLEMAG+VG +QSGGS+
Sbjct: 540 KRRQKINLQSMGEDRALLEMAGLVGQHQSGGSI 572

>KLTH0F16126g Chr6 complement(1308133..1309797) [1665 bp, 554 aa]
           {ON} similar to uniprot|Q12108 YOR118W Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 554

 Score =  403 bits (1035), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 213/547 (38%), Positives = 321/547 (58%), Gaps = 18/547 (3%)

Query: 19  FTDRDALIAFFNARALRQLSAVEQWAFHQNI-GKNIEPTEELDLQALATLYGVPADVPWF 77
           F   + L+++++ +AL+ +S  E  ++  NI GK ++    L+ + L  +  +       
Sbjct: 18  FESENDLLSWYDKKALKLVSTPELVSYKGNIDGKPLDAA--LNRKELMRVLRLQNANEAV 75

Query: 78  TEVFYTFVCRLTSFPLMNDC-SPPTYMGLLKVCLLFNKKRAARYTARKSYDXX-----XX 131
             + +  V  L +FPL+ DC    TYMG+LK C+L NK R   Y   K Y+         
Sbjct: 76  EGLLFNCVQTLANFPLIKDCYENVTYMGVLKSCVLLNKNRCLEYVQDKRYNHTKLVYISL 135

Query: 132 XXXXXXPPRDACDENVDQFDGDKLIDTLDGTFIAELEVRPNKLVRYSPFIAQISQVCNGS 191
                     +   + D  D  K+I T +     EL V    ++ +   +  +S+     
Sbjct: 136 ALNKAVKEMSSLPNSNDSLDAPKVIATFNNVAEEELVVPAETMLEFLTLMLTMSKATVIK 195

Query: 192 NEPLSRSMFPAWNRNNQIPLALLRSLDSTIVSRSDARSRSITYQQFAGGLRSVFPNVFDA 251
           N  L  ++   W+      L++LR++++ I++  DA    I+Y QF   + SV PN+   
Sbjct: 196 NSRLDVNISEKWDSFKTCALSILRTMNTDILTSQDALKNVISYTQFQNVISSVCPNLLVP 255

Query: 252 LGLFLERLFYVKRDTTNKLLYTPTKETSTIVTNLLLTQLSTLYPRINLFTSMQRLFVAGD 311
           L   +E + ++ RD  +     P    S +VT  LL QL+T++PR  +F+ +Q+L+V  D
Sbjct: 256 LECLMEHVLFLNRDLVDLEASKPLIPQSKLVTEPLLAQLATVWPRELVFSRLQKLYVGRD 315

Query: 312 AGFSMSVFQAKVFKWMAPTILFVSGTRIQDDE-IVCTKNKRYKAFLQDYPALKDAEQQLA 370
           +GFSM  FQAK FKWMAP+IL V G+RI DD+     KN+RYK FL +YP LKD +Q + 
Sbjct: 316 SGFSMRSFQAKAFKWMAPSILLVQGSRIPDDQDYAKNKNQRYKKFLDEYPRLKDEDQHIL 375

Query: 371 LCDRKKRNLIYAIFVRDPWKITNKDLFGDMDTTIIQLAPRQKIFKAQEAPNIYFNAVGGG 430
                KR L++AI + +PWK+TN +LFGD+ TTI+QL+P Q+++KA +  N+YFN +GGG
Sbjct: 376 PALSGKRKLLFAILINEPWKVTNSELFGDIKTTIVQLSPIQEVYKASKPGNVYFNTLGGG 435

Query: 431 IGFGSSQPSVKPAGKRYFPGNVSFTVDPSMEFAVFRNVGDGGMFSHGSAVPAPAEQPLSY 490
           IG GS QP +K +G ++ PGNVS T+DP++EFA FRNVG GG         AP+  P S 
Sbjct: 436 IGIGSPQPIIKSSGVKFVPGNVSLTIDPNLEFAAFRNVGFGGSI-------APSNTPTS- 487

Query: 491 EHRLMIKDLEVWGYGGEEELQKQIQRWQWEEAEATKRKYIKTNGGNEDRALLEMAGIVGH 550
           EH+ +I+D+E WG GGE+EL++Q++ W+WEEAEA +R+ I     N+DRALLE+AG+VG 
Sbjct: 488 EHKFLIQDIETWGCGGEKELEEQMKNWEWEEAEAQRRQRINLKSVNDDRALLELAGLVGQ 547

Query: 551 YQSGGSV 557
            QSGGSV
Sbjct: 548 NQSGGSV 554

>Kwal_55.21437 s55 complement(836842..838506) [1665 bp, 554 aa] {ON}
           YOR118W - Hypothetical ORF [contig 130] FULL
          Length = 554

 Score =  393 bits (1010), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 212/553 (38%), Positives = 319/553 (57%), Gaps = 30/553 (5%)

Query: 19  FTDRDALIAFFNARALRQLSAVEQWAFHQNI-GKNIEPTEELD-LQALATLYGVPADVPW 76
           F     +I +F+ +A++ L++ E  +F  NI GK++      D L  +  L GV   V  
Sbjct: 18  FNSEKDVIIWFDKKAIKSLTSPELVSFKANINGKDLSDVVTSDELLKVLRLDGVNETV-- 75

Query: 77  FTEVFYTFVCRLTSFPLMNDC-SPPTYMGLLKVCLLFNKKRAARYTARKSYDXXXXXXXX 135
            + + +  V  L++FP + DC    TY GLLK C+L NK R   Y   K YD        
Sbjct: 76  -SSLIFNCVQTLSNFPFIRDCYENITYSGLLKSCVLLNKARCLSYVKNKRYDHTKLVYIS 134

Query: 136 XXPPRDACDENVDQ----------FDGDKLIDTLDGTFIAELEVRPNKLVRYSPFIAQIS 185
                 A ++ V +           D  ++I T +   + EL V    ++ +   + ++S
Sbjct: 135 L-----ALNKTVKEVSSSSNSQESLDAPRIIATFNSVCVEELTVPSEVMLEFITLMLKMS 189

Query: 186 QVCNGSNEPLSRSMFPAWNRNNQIPLALLRSLDSTIVSRSDARSRSITYQQFAGGLRSVF 245
           +     N  L  ++   W       L++LR++++ I +++D     IT+ QF   + +V 
Sbjct: 190 KSTIIKNSKLDPNVSEGWESFRPFALSILRTMNTNIATQNDLLKYGITFSQFQSTISTVC 249

Query: 246 PNVFDALGLFLERLFYVKRDTTNKLLYTPTKETSTIVTNLLLTQLSTLYPRINLFTSMQR 305
           PN+       +E + ++ RD  +     P    S +V+  LL QL+T++PR  +F+ +Q+
Sbjct: 250 PNLLLPFESLMEHVLFLGRDLVDIDASQPPLLESKLVSEPLLAQLATVWPRELVFSRLQK 309

Query: 306 LFVAGDAGFSMSVFQAKVFKWMAPTILFVSGTRI-QDDEIVCTKNKRYKAFLQDYPALKD 364
           L+V  D+GFSM  FQAK FKWMAP+IL + G RI  D+E   +KN RYK FL++YP LK+
Sbjct: 310 LYVGRDSGFSMRSFQAKAFKWMAPSILLIHGVRIPNDEEYAKSKNHRYKNFLEEYPRLKE 369

Query: 365 AEQQLALCDRKKRNLIYAIFVRDPWKITNKDLFGDMDTTIIQLAPRQKIFKAQEAPNIYF 424
            +Q L      K+ L++A++V  PWK+TN +LFGD+ TTIIQL+P Q+++KA    NIYF
Sbjct: 370 EDQVLLPPFSGKKKLLFAVYVNVPWKVTNSELFGDLKTTIIQLSPIQEVYKASRPGNIYF 429

Query: 425 NAVGGGIGFGSSQPSVKPAGKRYFPGNVSFTVDPSMEFAVFRNVGDGGMFSHGSAVPAPA 484
           N +GGGIG GS QP VKP  ++Y PGNVS T+DP++EFAVFR+ G GG     S +    
Sbjct: 430 NTLGGGIGVGSPQPIVKPTSRKYLPGNVSLTIDPNLEFAVFRSAGFGGSIKPSSTI---- 485

Query: 485 EQPLSYEHRLMIKDLEVWGYGGEEELQKQIQRWQWEEAEATKRKYIKTNGGNEDRALLEM 544
                 EH+ +I+D+E WG GGE+EL++Q++ W+WEEAEA +R+ I     N+DRALLEM
Sbjct: 486 ----VNEHKFLIQDIEAWGCGGEKELEEQMKNWEWEEAEAQRRQRINLKSINDDRALLEM 541

Query: 545 AGIVGHYQSGGSV 557
           AG+VG  QSGGS+
Sbjct: 542 AGLVGQNQSGGSI 554

>Suva_8.171 Chr8 (304635..306338) [1704 bp, 567 aa] {ON} YOR118W
           (REAL)
          Length = 567

 Score =  360 bits (924), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 216/576 (37%), Positives = 322/576 (55%), Gaps = 28/576 (4%)

Query: 1   MGQRAS--SHVTETTTSRWTFTDRDALIAFFNARALRQLSAVEQWAFHQNIGKNIEPTEE 58
           MGQ +S  S   E +++   FT+   ++A+FN +A +Q++  E  +   N+   IE    
Sbjct: 1   MGQSSSTPSSNEEKSSNLRKFTNNGDVLAYFNHKAQQQVTVPELVSLKGNL--QIEDMNT 58

Query: 59  -LDLQALATLYGVPADVPWFTEVFYTFVCRLTSFPLMNDC-SPPTYMGLLKVCLLFNKKR 116
            +  ++L ++   P      + +    +  L++FPLMN    P T  GLLK  LL NK R
Sbjct: 59  PISHKSLCSVLHFPQKHTLLSGIVTNMLRVLSNFPLMNSSYEPITGYGLLKCILLLNKGR 118

Query: 117 AARYTARKSYDXXXXXXXXXXPPRD-------------ACDENVDQFDGDKLIDTLDGTF 163
             +Y   KSYD            +                + N+ Q     +I   D   
Sbjct: 119 CGKYLKFKSYDQLKLLFISLSLQKTDKEELSEENENNVKKERNIKQ-----IIANFDDVD 173

Query: 164 IAELEVRPNKLVRYSPFIAQISQVCNGSNEPLSRS-MFPAWNRNNQIPLALLRSLDSTIV 222
              L V  + ++++  ++  +S  C  SN  +  S ++  W+      + LLR+++  +V
Sbjct: 174 SEVLYVPADFMLQFLSWLLILSVECPTSNSKMGNSKIYDQWDSFKISAMNLLRTMNPDVV 233

Query: 223 SRSDARSRSITYQQFAGGLRSVFPNVFDALGLFLERLFYVKRDTTNKLLYTPTKETSTIV 282
           S ++  S  IT+ QF+  +R+V PN+   L   +E  FY++ D  N      +   S I+
Sbjct: 234 SNTE--SHLITFDQFSTSIRTVMPNLLKPLENLMEHFFYLENDLVNYDTSLSSVRDSRIM 291

Query: 283 TNLLLTQLSTLYPRINLFTSMQRLFVAGDAGFSMSVFQAKVFKWMAPTILFVSGTRIQD- 341
           T  LLTQLST+ PR      +Q L++   +GFSM   QAKVFKWMAP+IL VSGTRI + 
Sbjct: 292 TPALLTQLSTVLPRELFIQKLQSLYIGRKSGFSMRSLQAKVFKWMAPSILIVSGTRITNS 351

Query: 342 DEIVCTKNKRYKAFLQDYPALKDAEQQLALCDRKKRNLIYAIFVRDPWKITNKDLFGDMD 401
           DE    KN RY+ FL+++P LKD++Q++      K+   +A+++ DPWK+TNKD FGDM+
Sbjct: 352 DEYAAQKNPRYRHFLEEFPKLKDSDQKMDASYTNKKKTTFAVYIDDPWKVTNKDYFGDMN 411

Query: 402 TTIIQLAPRQKIFKAQEAPNIYFNAVGGGIGFGSSQPSVKPAGKRYFPGNVSFTVDPSME 461
           T IIQ++PRQ I+K      IYFN +GGGIG G  QP +KPA KR+ PGNVS T D ++E
Sbjct: 412 TRIIQISPRQDIYKVNRKGTIYFNTIGGGIGIGDKQPLIKPASKRFIPGNVSLTFDSTLE 471

Query: 462 FAVFRNVGDGGMFSHGSAVPAPAEQPLSYEHRLMIKDLEVWGYGGEEELQKQIQRWQWEE 521
           FAVFR+ G GG    GS      E+   +E   +I+D+EVWG GGE+EL++Q+++  WEE
Sbjct: 472 FAVFRHTGYGGSLEPGSLSVERKEEDSFFELHFLIQDVEVWGCGGEKELEEQMKQMAWEE 531

Query: 522 AEATKRKYIKTNGGNEDRALLEMAGIVGHYQSGGSV 557
           AE+ +R+ I      EDRALLEMAG+VG  + GGS+
Sbjct: 532 AESKRRQQINLRSLGEDRALLEMAGLVGQNRGGGSM 567

>NCAS0H02050 Chr8 (398606..400327) [1722 bp, 573 aa] {ON} Anc_5.431
           YOR118W
          Length = 573

 Score =  357 bits (917), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 205/580 (35%), Positives = 318/580 (54%), Gaps = 30/580 (5%)

Query: 1   MGQRASSHVTETTTSR--------WTFTDRDALIAFFNARALRQLSAVEQWAFHQNIGKN 52
           MGQ  SS+  E +  +         TF   + L   F  R L   + +E  AF + IG  
Sbjct: 1   MGQTPSSNQNEPSHLKEEGKQYKGITFNSEEELRESFKRRILCHFTPLELVAFKKKIGHE 60

Query: 53  IEPTEE----LDLQALATLYGVPADVPWFTEVFYTFVCRLTSFPLMND-CSPPTYMGLLK 107
              +E     +    L  L  +P +     ++ Y  +  L++FPL+ +  +  T +GLL 
Sbjct: 61  QTDSEAGVEYISKNELTNLLHLPRENVLLVDLTYKLIAILSNFPLLREPQTEVTEIGLLM 120

Query: 108 VCLLFNKKRAARYTARKSYDXXXXXXXXXXPPRDACDENV------DQFDGDKLIDTLDG 161
             +L +K+R  R+    +YD             D  D+ +       + + ++L+ T D 
Sbjct: 121 CIILLSKERCHRFIGSNTYDQLGLIFIAMS--LDYADKLLPYARTPKKLNVEELLRTFDN 178

Query: 162 TFIAELEVRPNKLVRYSPFIAQISQVCNGSNEPLS--RSMFPAWNRNNQIPLALLRSLDS 219
             I ELE+    L+++  +   +   C  SN  L      +  W+   +    ++RS+D 
Sbjct: 179 IPIDELEIPAPVLLQFLSWGLLLLIKCPTSNCQLKPINEFYQNWSSYEKAAKNIIRSMDQ 238

Query: 220 TIV-SRSDARSRSITYQQFAGGLRSVFPNVFDALGLFLERLFYVKRDTTNKLLYTPTKET 278
           +I+ + +D R   I Y QF+   ++V PN    L   +  L Y+  D  +    T     
Sbjct: 239 SIIRNLTDVR---INYTQFSDVFKAVLPNFTTPLESLMGHLLYMDSDLIDH--ETMPMNN 293

Query: 279 STIVTNLLLTQLSTLYPRINLFTSMQRLFVAGDAGFSMSVFQAKVFKWMAPTILFVSGTR 338
           S +++  LL QL+T+ P+    + +Q+L+V  ++GFSM   Q+K F W AP+IL VSG  
Sbjct: 294 SKLMSEPLLAQLATVLPKELFLSKLQKLYVGRESGFSMRSLQSKCFNWEAPSILLVSGML 353

Query: 339 IQDD-EIVCTKNKRYKAFLQDYPALKDAEQQLALCDRKKRNLIYAIFVRDPWKITNKDLF 397
           I DD +    KN RY  FL+ YP LK+ +Q L  C  +++   +A+++ DPW++TNK+ F
Sbjct: 354 ISDDLQYAKEKNPRYGKFLEQYPKLKEEQQHLDACHSQRKKATFAVYIDDPWRVTNKEFF 413

Query: 398 GDMDTTIIQLAPRQKIFKAQEAPNIYFNAVGGGIGFGSSQPSVKPAGKRYFPGNVSFTVD 457
           G M++ IIQLAPRQ +F A +   IYFN VGGGIGFG+ QP +  A K+Y PGNVS T+D
Sbjct: 414 GSMNSMIIQLAPRQDVFHASKPNMIYFNTVGGGIGFGNKQPLISNAHKKYIPGNVSLTID 473

Query: 458 PSMEFAVFRNVGDGGMFSHGSAVPAPAEQPLSYEHRLMIKDLEVWGYGGEEELQKQIQRW 517
            ++EFAVFR++G GG F   + +    ++  S+E + +I+D+EVWG GGE+ELQ+QI++ 
Sbjct: 474 STLEFAVFRHIGYGGAFKPSALLTKRGKEDESFEIKFIIQDVEVWGCGGEKELQEQIKKL 533

Query: 518 QWEEAEATKRKYIKTNGGNEDRALLEMAGIVGHYQSGGSV 557
           +WEEAEA +R++I      EDRALLEMAG+VG  QSGGS+
Sbjct: 534 EWEEAEAKRRQHINLKSLGEDRALLEMAGLVGQSQSGGSM 573

>YOR118W Chr15 (546857..548560) [1704 bp, 567 aa] {ON}  RTC5Protein
           of unknown function; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm; null
           mutation suppresses cdc13-1 temperature sensitivity
          Length = 567

 Score =  357 bits (915), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 206/551 (37%), Positives = 310/551 (56%), Gaps = 16/551 (2%)

Query: 19  FTDRDALIAFFNARALRQLSAVEQWAFHQNIGKNIEPTEE-LDLQALATLYGVPADVPWF 77
           FT+   ++A+FN +A +Q++  E  +F  N+   IE     +  +AL      P +    
Sbjct: 21  FTNSKDILAYFNNKAQQQVTIPELVSFKGNL--QIEDLNTPISHKALCNSLYFPQNHAMI 78

Query: 78  TEVFYTFVCRLTSFPLMNDC-SPPTYMGLLKVCLLFNKKRAARYTARKSYDXXXXXXXXX 136
             +    +  L++FPLM     P T  GLLK  LL N+ R A++   KSYD         
Sbjct: 79  VGIVTNMLRVLSNFPLMKSSYEPITGYGLLKCILLLNRARCAKFLKTKSYDQLKLLFISL 138

Query: 137 XPPRDACDENVDQFDGD--------KLIDTLDGTFIAELEVRPNKLVRYSPFIAQISQVC 188
              +   +E  ++ + D        ++I   D      L +  + ++++  ++  ++  C
Sbjct: 139 SLQKTDKEELSEESENDGNKELTIKQIITGFDDVDTEMLCIPADFMLQFLTWLLILTVDC 198

Query: 189 NGSNEPLSRS-MFPAWNRNNQIPLALLRSLDSTIVSRSDARSRSITYQQFAGGLRSVFPN 247
             +N  L  +     W       L LLR+++  +V   D  S SIT+QQF+  +R+V PN
Sbjct: 199 PTTNSKLDNTETHDQWGNFKVSALNLLRTMNPDVVG--DIESHSITFQQFSTAIRTVMPN 256

Query: 248 VFDALGLFLERLFYVKRDTTNKLLYTPTKETSTIVTNLLLTQLSTLYPRINLFTSMQRLF 307
           +   L   +E  FY++ D  +      + + S ++T  LL QLST  P+      +Q L+
Sbjct: 257 LLKPLENLMEHFFYLQHDLVDHDTNLSSIQDSKVMTPALLAQLSTGLPKELFIHKLQSLY 316

Query: 308 VAGDAGFSMSVFQAKVFKWMAPTILFVSGTRIQD-DEIVCTKNKRYKAFLQDYPALKDAE 366
           +   +GFSM   QAKVFKWMAP+IL VSG RI + +E    KN RY+ FL+++P LK+++
Sbjct: 317 IGRKSGFSMRSLQAKVFKWMAPSILVVSGMRITNSEEYAAEKNPRYRHFLEEFPKLKESD 376

Query: 367 QQLALCDRKKRNLIYAIFVRDPWKITNKDLFGDMDTTIIQLAPRQKIFKAQEAPNIYFNA 426
           Q +      KR   +A+++ DPWK+TNKD FGD++T II+++PRQ I+K  +   IYFN 
Sbjct: 377 QMMDASHLNKRKTTFAVYIDDPWKVTNKDYFGDLNTRIIEISPRQDIYKVNQKGTIYFNT 436

Query: 427 VGGGIGFGSSQPSVKPAGKRYFPGNVSFTVDPSMEFAVFRNVGDGGMFSHGSAVPAPAEQ 486
           +GGGIG G  QP +KPA KRY PGNVS T D ++EFAVFRN G GG    G       E+
Sbjct: 437 IGGGIGIGDKQPLIKPASKRYIPGNVSLTFDSTLEFAVFRNTGYGGSLDPGLLSMERKEE 496

Query: 487 PLSYEHRLMIKDLEVWGYGGEEELQKQIQRWQWEEAEATKRKYIKTNGGNEDRALLEMAG 546
              YE   +I+D+EVWG GGE+EL++QI++ +WEEAE+ +R+ I      EDRALLEMAG
Sbjct: 497 NSPYELHFLIQDVEVWGCGGEKELEEQIKQLEWEEAESKRRQQINLRSLGEDRALLEMAG 556

Query: 547 IVGHYQSGGSV 557
           +VG +Q GGS+
Sbjct: 557 LVGQHQGGGSM 567

>TDEL0E01940 Chr5 complement(365414..367117) [1704 bp, 567 aa] {ON}
           Anc_5.431 YOR118W
          Length = 567

 Score =  350 bits (897), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 213/575 (37%), Positives = 311/575 (54%), Gaps = 26/575 (4%)

Query: 1   MGQRASSHV--TETTTSRWTFTDRDALIAFFNARALRQLSAVEQWAFHQNI-GKNIEPTE 57
           MGQ AS      E    +  FT    L+ FF+ RA+   +A E  AF   + GK ++  +
Sbjct: 1   MGQNASVQQDHAEIGHEKRQFTSNSELMEFFDKRAVHMFTATELAAFKSKLEGKTLK--D 58

Query: 58  ELDLQALATLYGVPADVPWFTEVFYTFVCRLTSFPLMNDC-SPPTYMGLLKVCLLFNKKR 116
            +  + L     +P +     E  Y FV  L++FPLM D     T +GLLK  LL N  +
Sbjct: 59  PVRSEELTRWLRIPCENVLLCEAVYEFVRVLSNFPLMKDSFDDVTGVGLLKSVLLTNPSK 118

Query: 117 AARYTARKSYDXX-----XXXXXXXXPPRDACDENVDQFDGD---KLIDTLDGTFIAELE 168
             +Y   K+YD                   +C  +    DG     L+ T +   + +L 
Sbjct: 119 CHKYVGVKNYDHMKLLFIALSMRKSVKEEPSCSSSTSLEDGGGSINLLRTYNNIVVDDLA 178

Query: 169 VRPNKLVRYSPFIAQISQVCNGSNEPLSRSM-FPAWNRNNQIPLALLRSLDSTIVSRSDA 227
           +    LV+   ++  ++  C  SN      + +  W         LLR++++ IV+  + 
Sbjct: 179 IPATSLVQLLAWLLILTSYCPTSNCQFPEDVVYAEWGSFKLAATNLLRTMNNNIVT--NL 236

Query: 228 RSRSITYQQFAGGLRSVFPNVFDALGLFLERLFYVKRDTTNKLLYTPTKE-----TSTIV 282
            S S+ ++QF+  + +V PN+F AL   +E L Y   D    L+  P+       TS   
Sbjct: 237 ESYSVKFEQFSKAISTVMPNIFRALQNVMEHLLYQDSD----LVSFPSNSAGPILTSKPT 292

Query: 283 TNLLLTQLSTLYPRINLFTSMQRLFVAGDAGFSMSVFQAKVFKWMAPTILFVSGTRIQDD 342
           T  +L QL T       F   Q L+V  ++GFSM   QAKVFKWMAPT++ +SG  + DD
Sbjct: 293 TQAVLAQLITALSNEMTFAKFQNLYVGRESGFSMRSLQAKVFKWMAPTVMLLSGKCVLDD 352

Query: 343 EIVCTKNKRYKAFLQDYPALKDAEQQLALCDRKKRNLIYAIFVRDPWKITNKDLFGDMDT 402
           E    KN RY+ FL  YP LKD +Q L+   + K  +++A+++ +PWK TNKD FG   T
Sbjct: 353 EDFSKKNSRYRDFLSKYPKLKDRDQHLSDLQKNKTKVVFAVYIPEPWKTTNKDYFGGSGT 412

Query: 403 TIIQLAPRQKIFKAQEAPNIYFNAVGGGIGFGSSQPSVKPAGKRYFPGNVSFTVDPSMEF 462
           TI+QL+P Q +FKA     +YFN +GGGIG G++QP +K   K Y PGNVS T+D ++EF
Sbjct: 413 TIVQLSPTQDVFKAASNEVMYFNTLGGGIGIGNNQPHIKNGVKSYSPGNVSLTIDSTLEF 472

Query: 463 AVFRNVGDGGMFSHGSAVPAPAEQPLSYEHRLMIKDLEVWGYGGEEELQKQIQRWQWEEA 522
           A FR+VG GG F+ G  +     +   +E + +I+D+EVWG GG+EEL++Q ++WQWEEA
Sbjct: 473 AAFRHVGYGGTFNPGLLLTQFNREDDPFEIKFLIQDVEVWGCGGKEELEEQYKKWQWEEA 532

Query: 523 EATKRKYIKTNGGNEDRALLEMAGIVGHYQSGGSV 557
           EA +R+ I      EDRALLEMAG+VGH Q+GGS+
Sbjct: 533 EAKRRQNINLRSFGEDRALLEMAGLVGHSQNGGSM 567

>Smik_15.296 Chr15 (507990..509690) [1701 bp, 566 aa] {ON} YOR118W
           (REAL)
          Length = 566

 Score =  349 bits (895), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 207/567 (36%), Positives = 314/567 (55%), Gaps = 22/567 (3%)

Query: 2   GQRASSHVTETTTSRWTFTDRDALIAFFNARALRQLSAVEQWAFHQNIGKNIEPTEE-LD 60
            +  SSH      SR    DRD L  +FN +A RQ++  E  +   N+   IE     + 
Sbjct: 11  NEEGSSH------SRKFANDRDVL-TYFNTKAQRQITVPELVSLKGNL--QIENLNTPIS 61

Query: 61  LQALATLYGVPADVPWFTEVFYTFVCRLTSFPLMNDC-SPPTYMGLLKVCLLFNKKRAAR 119
            + L      P +      +    +  L++FPL+N    P T  GLLK  +L NK R  +
Sbjct: 62  HKRLCNFLYFPQNHTIIVGIVTNMLRVLSNFPLVNSSYEPITGYGLLKCIVLLNKSRCEK 121

Query: 120 YTARKSYDXXXXXXXXXXPPR--------DACDENVDQFDGDKLIDTLDGTFIAELEVRP 171
           +   KSYD            +        D  +  V + +  ++I   D      L +  
Sbjct: 122 FLKIKSYDQLKLLFISLSLQKTDKEELSEDNENNGVKEKNIKQIITGFDDVDTEVLYLPA 181

Query: 172 NKLVRYSPFIAQISQVCNGSNEPLSRSMFPAWNRNNQIPLALLRSLDSTIVSRSDARSRS 231
           + ++++  ++  +S  C  +N  ++      W++     + LLR+++  +V+  +  S  
Sbjct: 182 DFMLQFLTWLLILSVECPTTNSTINNETNVQWDKFKIPAMNLLRTMNPDVVN--NIESHF 239

Query: 232 ITYQQFAGGLRSVFPNVFDALGLFLERLFYVKRDTTNKLLYTPTKETSTIVTNLLLTQLS 291
           ITYQQF+  +R+V PN+   L   +E   Y++ D  +      + + S I+T  LL QLS
Sbjct: 240 ITYQQFSTAIRTVMPNLLKPLENLMEHFLYLQHDLVDYDTNLSSIQDSKIMTPALLAQLS 299

Query: 292 TLYPRINLFTSMQRLFVAGDAGFSMSVFQAKVFKWMAPTILFVSGTRIQD-DEIVCTKNK 350
           T  P+      +Q L++   +GFSM   QAKVFKWMAP+IL VSG RI + +E    KN 
Sbjct: 300 TGLPKELFIQKLQSLYIGRKSGFSMRSLQAKVFKWMAPSILVVSGVRITNSEEYAANKNP 359

Query: 351 RYKAFLQDYPALKDAEQQLALCDRKKRNLIYAIFVRDPWKITNKDLFGDMDTTIIQLAPR 410
           RY+ FL+++P LKD++Q++      K+   +A+++ DPWK+TNKD FGD++T IIQ++PR
Sbjct: 360 RYRHFLEEFPILKDSDQKMDASLMNKKKTTFAVYIDDPWKVTNKDYFGDLNTRIIQISPR 419

Query: 411 QKIFKAQEAPNIYFNAVGGGIGFGSSQPSVKPAGKRYFPGNVSFTVDPSMEFAVFRNVGD 470
           Q I+K  +   +YFN +GGGIG G+ QP +K A KRY PGNVS T D ++EFAVFRN G 
Sbjct: 420 QDIYKVNKKGTVYFNTIGGGIGIGNKQPLIKSASKRYVPGNVSLTFDSTLEFAVFRNTGY 479

Query: 471 GGMFSHGSAVPAPAEQPLSYEHRLMIKDLEVWGYGGEEELQKQIQRWQWEEAEATKRKYI 530
           GG    G       E+  S+E  ++I+D+EVWG GGE+EL++QI++  WEEAE+ +R+ I
Sbjct: 480 GGSLDPGLLSMERKEENSSFELHILIQDVEVWGCGGEKELEEQIKQLAWEEAESKRRQQI 539

Query: 531 KTNGGNEDRALLEMAGIVGHYQSGGSV 557
                 EDRALLEMAG+VG +Q GGS+
Sbjct: 540 NLRSLGEDRALLEMAGLVGQHQGGGSM 566

>ZYRO0F09966g Chr6 (809604..811268) [1665 bp, 554 aa] {ON} similar
           to uniprot|Q12108 YOR118W Saccharomyces cerevisiae
           Hypothetical ORF
          Length = 554

 Score =  347 bits (890), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 211/570 (37%), Positives = 314/570 (55%), Gaps = 29/570 (5%)

Query: 1   MGQRASSHVTETTTSRWTFTDRDALIAFFNARALRQLSAVEQWAFHQNIGKNIEPTEELD 60
           MGQR S    +++T    FT    ++  FN RAL+Q +  E  +F   +GK++   E L 
Sbjct: 1   MGQRTSQATLQSSTH---FTSNSDILKSFNDRALKQFTVTELVSFKNKLGKDL--NERLT 55

Query: 61  LQALATLYGVPADVPWFTEVFYTFVCRLTSFPLM-NDCSPPTYMGLLKVCLLFNKKRAAR 119
            + L     VP D     E+ Y FV  L +FPLM N     T +G+LK  +L N +R  +
Sbjct: 56  NEELTKWLSVPQDEILLRELLYNFVQVLGNFPLMKNSYENVTGIGVLKAIILTNPERCKK 115

Query: 120 YTARKSYDXXXX--------XXXXXXPPRDACDENVDQFDGDKLIDTLDGTFIAELEVRP 171
           Y   ++YD                  P   +   + + FD  +++ T DG  + EL V  
Sbjct: 116 YVKSRNYDQLKLWFIALSIRKTVKEDPNLSSSSSSEESFDVTRILKTFDGLHVNELSVPF 175

Query: 172 NKLVRYSPFIAQISQVCNGSNEPLSR-SMFPAWNRNNQIPLALLRSLDSTIVSRSDARSR 230
             +V +  ++  ++  C  +N  L   +MF  WN   +    +LRS+      R    S 
Sbjct: 176 AYMVPFISWLLILTTYCPINNCKLENVAMFDNWNSYIKSAHTILRSM------RPMDESS 229

Query: 231 SITYQQFAGGLRSVFPNVFDALGLFLERLFYVKRDTTNKLLYTPTK-ETSTIVTNLLLTQ 289
            I Y+ FA  +RS+ P++FD L   +E L +   +  + L     +  +S ++ + LL Q
Sbjct: 230 WIEYEPFAHTMRSIAPHIFDPLTRVMEHLLFKDDELVDPLSENRGEIASSKLLNSALLAQ 289

Query: 290 LSTLYPRINLFTSMQRLFVAGDAGFSMSVFQAKVFKWMAPTILFVSGTRIQDDEIVCTKN 349
           +S+   +      +QRL++  D GFSM  FQAKVFKW APTI+ + G RI DDE    KN
Sbjct: 290 ISSALSKQLPIYHLQRLYLGRDHGFSMRSFQAKVFKWSAPTIMLLRGKRILDDEEYSVKN 349

Query: 350 KRYKAFLQDYPALK--DAEQQLALCDRKKRNLIYAIFVRDPWKITNKDLFGDMDTTIIQL 407
            R++ FL +YP LK  D + ++      K  +I A++V DPWKITNK+ FG   TTI+QL
Sbjct: 350 TRFRKFLHEYPKLKPSDMDTEVEEMYPAKSKIILAVYVSDPWKITNKEFFGGPHTTIVQL 409

Query: 408 APRQKIFKAQEAPNIYFNAVGGGIGFGSSQPSVKPAGKRYFPGNVSFTVDPSMEFAVFRN 467
           +P Q++F +     +YFN +GGGIG G+ QP +K   K Y PGNVS T+D ++EFAV R+
Sbjct: 410 SPFQEVFGSSRENALYFNTIGGGIGIGNKQPVIKSTAKSYSPGNVSLTMDSALEFAVLRH 469

Query: 468 VGDGGMFSHGSAVPAPAEQPLSYEHRLMIKDLEVWGYGGEEELQKQIQRWQWEEAEATKR 527
            G GG+   G  V         +E +++++D+EVWG GGE+EL++Q+++W+WEE+EA +R
Sbjct: 470 AGQGGVLKPGLVVGDK-----DFEVKMLLQDVEVWGCGGEKELEEQLKQWEWEESEAKRR 524

Query: 528 KYIKTNGGNEDRALLEMAGIVGHYQSGGSV 557
           + I      EDRALLEMAG+VG  QSGGSV
Sbjct: 525 QQINLRSIGEDRALLEMAGLVGQAQSGGSV 554

>KNAG0B04230 Chr2 complement(803845..805578) [1734 bp, 577 aa] {ON}
           Anc_5.431 YOR118W
          Length = 577

 Score =  328 bits (841), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 196/583 (33%), Positives = 311/583 (53%), Gaps = 32/583 (5%)

Query: 1   MGQRASSHVTETTTS---RWTFTDRDALIAFFNARALRQLSAVEQWAFHQNIGKNIEPTE 57
           MGQ  SS   E T     +      + +   +N R LRQ +A E + F   +G   +  +
Sbjct: 1   MGQSVSSQEPEPTQESDPQLGNGTTEEIEQEYNDRVLRQFNASELYTFKCRVGMTRQLND 60

Query: 58  ELDLQALATLYGVPAD--VPWFTEVFYTFVCRLTSFPLM-NDCSPPTYMGLLKVCLLFNK 114
            +  Q L     +P +  +   +++    +  L  FP + N     T + LLK  +L N+
Sbjct: 61  VVLEQELLEWLCLPLEGHLQQPSKLLVGVIKVLGQFPFISNTGGNLTAVSLLKAVILINR 120

Query: 115 KRAARYTARKSYDXXXXXXXXXXPPRDACDENVDQ-------FDGDKLIDTLDGT--FIA 165
            +  +Y   KSY+            +D+ D    +        + +K+I + DG    ++
Sbjct: 121 GKCLKYIGNKSYNHLELIFMALYLAQDSHDSTKKESYDPKEPHNIEKVISSYDGNSDCVS 180

Query: 166 ELEVRPNKLVRYSPFIAQISQVCNGSNEPLS-RSMFPAWNRNNQIPLALLRSLDSTIVSR 224
           E+ V+ + L++++  +  +S      N  +  ++    W +  +    ++R+++S+I+S 
Sbjct: 181 EITVQADNLLQFTTMLLLLSARIPRPNSQIDLKTADNDWAKYEKSAYNVIRTMNSSIIS- 239

Query: 225 SDARSRSITYQQFAGGLRSVFPNVFDALGLFLERLFYVKRDTTNKLLYTPTKETSTIVTN 284
              ++ +I++ QF   +  + P +   L   L+ L Y      +     PT   + ++ +
Sbjct: 240 -SCQTHTISFHQFYDVISILLPTILTTLDNLLQHLLYTPDQLVDHTALGPTFTETKVMNH 298

Query: 285 --LLLTQLSTL---YPRINLFTSMQRLFVAGDAGFSMSVFQAKVFKWMAPTILFVSGTRI 339
               L Q +     YP     + +Q+L+V  D+GFSM  FQ KVF W APT+LFVSG+RI
Sbjct: 299 GSFALLQFALADKGYP----ISKLQKLYVGRDSGFSMRSFQGKVFHWHAPTLLFVSGSRI 354

Query: 340 QDDEIVC-TKNKRYKAFLQDYPALKDAEQQLALCDRKKRNLIYAIFVRDPWKITNKDLFG 398
           QDD+     KN RY  FL+D+  L+D +QQL+ C  KKR +++ I++  PW++TNKD F 
Sbjct: 355 QDDDDYSKNKNPRYSKFLEDFRKLRDTDQQLSPCLLKKRKVMFVIYIESPWRVTNKDYFS 414

Query: 399 DMDTTIIQLAPRQKIFKAQEAPNIYFNAVGGGIGFGSSQPSVKPAGKRYFPGNVSFTVDP 458
              TTI QL+P   IFKA     +YFN +GGGIG G +QP  K   + Y PGN+S T+D 
Sbjct: 415 AGRTTIFQLSPELDIFKANRDDVVYFNTMGGGIGIGDTQPYTKVNYREYRPGNISLTLDS 474

Query: 459 SMEFAVFRNVGDGGMFSHGSAVPAPAEQPL----SYEHRLMIKDLEVWGYGGEEELQKQI 514
           S+EF  FRNVG GGMF  G+         +    SYE R +I+D+EVWG GGE+EL +Q+
Sbjct: 475 SLEFGAFRNVGPGGMFEPGALFTRRNGDGVVTSNSYELRFLIQDVEVWGCGGEKELSEQM 534

Query: 515 QRWQWEEAEATKRKYIKTNGGNEDRALLEMAGIVGHYQSGGSV 557
           ++ QWEE EA +R+++     +EDRALLEMAG+VG +QSGGS+
Sbjct: 535 KQLQWEETEAKRRQHVNLKSLSEDRALLEMAGLVGQHQSGGSI 577

>NDAI0C01610 Chr3 complement(343850..345604) [1755 bp, 584 aa] {ON}
           Anc_5.431 YOR118W
          Length = 584

 Score =  324 bits (830), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 199/591 (33%), Positives = 309/591 (52%), Gaps = 41/591 (6%)

Query: 1   MGQRASSHVTETTTSR----WTFTDRDALIAFFNARALRQLSAVEQWAFHQNIGKNIEPT 56
           MGQ  SS     T +       F +   +  +F  R +   + +E  ++   +  +    
Sbjct: 1   MGQHISSAEKPNTKTHNEKEIQFGNALEVQKYFQKRTIGHFTPLELISYKNKLNHD-HLD 59

Query: 57  EELDLQALATLYGVPADVPWFTEVFYTFVCRLTSFPLMNDCSPPTYMGLLKVCL-LFNKK 115
           + +  + +  L  +P D    + + +  V  L +FP + +       G L  C+ L +  
Sbjct: 60  DMITKEEIIQLLHLPDDNVILSNMIFNMVHSLCNFPFLGERIWDITAGNLLTCIILLDND 119

Query: 116 RAARYTARKSYDXXX--------XXXXXXXPPRDACD-------ENVD------QFDGDK 154
           R  R+   KSYD                   P  A +       EN+       Q  G  
Sbjct: 120 RCQRFIGSKSYDQIKLLFILLCLSTNNSSGKPLSASNSKLREKSENISTTSIYSQEIGYN 179

Query: 155 LIDTL---DGTFIAELEVRPNKLVRYSPFIAQISQVCNGSNEPL--SRSMFPAWNRNNQI 209
           L D L   +G  I +L V    L     +   +S  C  +N  +  + +++ +WN   + 
Sbjct: 180 LTDILQSYNGISIDDLSVPALSLSECFTWTLIMSIKCPTANCKILPNETIYNSWNEYQKA 239

Query: 210 PLALLRSLDSTIVSRSDARSRSITYQQFAGGLRSVFPNVFDALGLFLERLFYVKRDTTNK 269
            L +LRS+DS+IVS  D     I++ QF     SV PN    L   +  L Y+ +D  N 
Sbjct: 240 SLNILRSMDSSIVSNLD--DYRISFTQFENVFTSVVPNFTHPLENIMNHLLYMDKDLINH 297

Query: 270 LLYTPTKETSTIVTNLLLTQLSTLYPRINLFTSMQRLFVAGDAGFSMSVFQAKVFKWMAP 329
            +    K  S +++  LL QLST  P+    + +Q+L++   +GFSM   Q+K FKW+AP
Sbjct: 298 PVMEIPK--SKLMSESLLAQLSTTLPKELFISKLQKLYIGRQSGFSMRSLQSKCFKWLAP 355

Query: 330 TILFVSGTRIQDDEIVCTKNKRYKAFLQDYPALKDAEQQLALCDRKKRNLIYAIFVRDPW 389
           TIL VSG  I +DE     N R+K FLQ++P L D EQ L  C   K+ + +A+++ +PW
Sbjct: 356 TILLVSGLIIPNDEEY--NNPRFKRFLQEFPKLNDNEQSLEPCHSYKKKISFAVYIDEPW 413

Query: 390 KITNKDLFGDMDTTIIQLAPRQKIFKAQEAPN-IYFNAVGGGIGFGSSQPSVKPAG--KR 446
           ++TNK+ FGD+++ II+L+PRQ IFK+ ++   IYFN +G GIG G  QP V      ++
Sbjct: 414 RVTNKEFFGDLNSRIIELSPRQDIFKSLKSHELIYFNTIGCGIGIGDKQPHVSNGANSRK 473

Query: 447 YFPGNVSFTVDPSMEFAVFRNVGDGGMFSHGSAVPAPAEQPLSYEHRLMIKDLEVWGYGG 506
           Y PGNVS T++ ++EFAVFR+VG GG FS    +     +  S+E + +I+D+EVWG GG
Sbjct: 474 YQPGNVSLTLESTLEFAVFRHVGHGGAFSPSELLTKRGTEEESFEIKFIIQDVEVWGCGG 533

Query: 507 EEELQKQIQRWQWEEAEATKRKYIKTNGGNEDRALLEMAGIVGHYQSGGSV 557
           E+EL++Q+++  WEEAEA +R+ +     +EDRALLEM G+VG +QSGGS+
Sbjct: 534 EKELEEQMKQLAWEEAEAKRRQQVNLKSISEDRALLEMVGLVGQHQSGGSM 584

>Skud_15.281 Chr15 (503290..504993) [1704 bp, 567 aa] {ON} YOR118W
           (REAL)
          Length = 567

 Score =  319 bits (818), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 200/564 (35%), Positives = 307/564 (54%), Gaps = 28/564 (4%)

Query: 1   MGQRAS--SHVTETTTSRWTFTDRDALIAFFNARALRQLSAVEQWAFHQNIGKNIEPTEE 58
           MGQ +S  S   E ++S   FT+   ++++FN +A +Q++  E  +F  N+   IE    
Sbjct: 1   MGQSSSVSSRNEEGSSSSKKFTNNRDVLSYFNNKAQQQVTIPELVSFKGNL--QIENLNT 58

Query: 59  -LDLQALATLYGVPADVPWFTEVFYTFVCRLTSFPLMNDC-SPPTYMGLLKVCLLFNKKR 116
            +  + L  +   P +      +    +  L++FPL+N    P T  GLLK  LL N+ R
Sbjct: 59  PISHKPLFNVLHFPPNHTIVVGIVTNMLRVLSNFPLINSSYEPITGFGLLKCILLLNRTR 118

Query: 117 AARYTARKSYDXXXXXXXXXXPPR-------------DACDENVDQFDGDKLIDTLDGTF 163
             ++   KSYD            +                + +V Q   D   D +D   
Sbjct: 119 CEKFLKIKSYDQLKLLFISLSLQKTDKEELSEENEENINRERHVKQIITD--FDDVDTEM 176

Query: 164 IAELEVRPNKLVRYSPFIAQISQVCNGSNEPLSR-SMFPAWNRNNQIPLALLRSLDSTIV 222
           +    +  + ++++  ++  +S     +N        +  W+      + LLR+++  +V
Sbjct: 177 LC---LPADFMLQFLSWLLILSVKFPTTNSKTDNDKTYEQWDTFKISAMNLLRTMNPDVV 233

Query: 223 SRSDARSRSITYQQFAGGLRSVFPNVFDALGLFLERLFYVKRDTTNKLLYTPTKETSTIV 282
           S  +  S  IT++QF+  +R+V PN+F  L   +E  FY+  D  ++     + + S I+
Sbjct: 234 S--NVESHFITFEQFSTAIRTVMPNLFKPLENLMEHFFYLDNDLVSRDANLSSIQDSRIM 291

Query: 283 TNLLLTQLSTLYPRINLFTSMQRLFVAGDAGFSMSVFQAKVFKWMAPTILFVSGTRIQD- 341
           T  LL QLST  P+      +Q L++   +GFSM   QAKVFKWMAP+IL VSG RI + 
Sbjct: 292 TPALLAQLSTGLPKELFIQKLQSLYIGRKSGFSMRSLQAKVFKWMAPSILVVSGMRITNS 351

Query: 342 DEIVCTKNKRYKAFLQDYPALKDAEQQLALCDRKKRNLIYAIFVRDPWKITNKDLFGDMD 401
           DE    KN RY+ FL ++P LKD++Q++      K+   +A+++ DPWK+TNKD FGD++
Sbjct: 352 DEYAAEKNPRYRHFLDEFPKLKDSDQKMDASHLSKKKTTFAVYIDDPWKVTNKDYFGDLN 411

Query: 402 TTIIQLAPRQKIFKAQEAPNIYFNAVGGGIGFGSSQPSVKPAGKRYFPGNVSFTVDPSME 461
           T IIQ++PRQ I+K  +   IYFN +GGGIG G  QP +K A KRY PGNVS T D ++E
Sbjct: 412 TRIIQISPRQDIYKVNQKGTIYFNTIGGGIGIGDKQPFIKAASKRYIPGNVSLTFDSTLE 471

Query: 462 FAVFRNVGDGGMFSHGSAVPAPAEQPLSYEHRLMIKDLEVWGYGGEEELQKQIQRWQWEE 521
           FAVFR+ G GG+   G       E+   +E   +I+D+EVWG GGE+EL++QI++  WEE
Sbjct: 472 FAVFRHTGYGGLLDPGLLSMERKEENSFFELHFLIQDVEVWGCGGEKELEEQIKQMAWEE 531

Query: 522 AEATKRKYIKTNGGNEDRALLEMA 545
           AE+ +R+ I      EDRALLEMA
Sbjct: 532 AESKRRQQINFRSLGEDRALLEMA 555

>Kpol_1016.7 s1016 complement(14315..16003) [1689 bp, 562 aa] {ON}
           complement(14315..16003) [1689 nt, 563 aa]
          Length = 562

 Score =  318 bits (814), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 195/566 (34%), Positives = 310/566 (54%), Gaps = 13/566 (2%)

Query: 1   MGQR---ASSHVTETTTSRWTFTDRDALIAFFNARALRQLSAVEQWAFHQNIGKNIEPTE 57
           MGQ     S    ET         R+ ++ FFN R+L  L  +E   F   +G   + ++
Sbjct: 1   MGQTPSVESQESKETKNEMPELKSREDILDFFNNRSLSILLPMEIECFKSRLGDK-DLSD 59

Query: 58  ELDLQALATLYGVPADVPWFTEVFYTFVCRLTSFPLMNDCSPP-TYMGLLKVCLLFNKKR 116
            L      TL  +         + + F  ++++FP +++ S   T  G+LK  +L  ++R
Sbjct: 60  PLTKDEFNTLLRIADSNSQLQILLWNFFLKISAFPFLSNRSESMTGFGILKGIILLTRER 119

Query: 117 AARYTARKSYDXXXXX-XXXXXPPRDACDENVDQFDGDKLIDTLDGTFIAELEVRPNKLV 175
             +Y    +               +         F    ++DTLDG  +A   V+   ++
Sbjct: 120 IKKYLGWSNAKLIKLIFIGLTSQEKVGVKTEASVFKIQHVLDTLDGIDLASSTVKDTDML 179

Query: 176 RYSPFIAQISQVCNGSNEPLS-RSMFPAWNRNNQIPLALLRSLDSTIVSRSDARSRSITY 234
            +  ++  +S  C  SN  L+ +S++  W     +  +++RS++  I +    +   I+Y
Sbjct: 180 SFITWLLLLSVHCPTSNCKLNEKSLYDKWKDYEIVASSMVRSMNKKITTT--GKGIGISY 237

Query: 235 QQFAGGLRSVFPNVFDALGLFLERLFYVKRDTTN-KLLYTPTKETSTIVTNLLLTQLSTL 293
             F+  + +V  NV   L   +E + Y + D      L T  KET  ++T  L+ QL T+
Sbjct: 238 SDFSHTIVAVSKNVMSPLENIVEHMLYKQDDLLEFPCLDTFLKETK-LMTYPLVAQLCTV 296

Query: 294 YPRINLFTSMQRLFVAGDAGFSMSVFQAKVFKWMAPTILFVSGTRIQDD-EIVCTKNKRY 352
            P   + + +Q+L+V  ++G+SM   Q+KVF W A TIL VSGTRI DD E    KN RY
Sbjct: 297 LPNEIVMSQLQKLYVGRESGYSMRSLQSKVFNWKAATILLVSGTRIVDDIEYSENKNPRY 356

Query: 353 KAFLQDYPALKDAEQQLALCDRKKRNLIYAIFVRDPWKITNKDLFGDMDTTIIQLAPRQK 412
           K FL++YP LKD +Q++  C   K+ + +A+++ +PW++TNK+ FG+  T+II+L+PRQ 
Sbjct: 357 KRFLEEYPKLKDEDQEMDDCHNLKKKVTFAVYIDEPWRVTNKNYFGEKRTSIIELSPRQD 416

Query: 413 IFKAQEAPNIYFNAVGGGIGFGSSQPSVKPAGKRYFPGNVSFTVDPSMEFAVFRNVGDGG 472
            F + +  ++YFN +GGGIG G++QP  K    RY PGNVS T+D ++EF VFR+ G GG
Sbjct: 417 KFNSLKVGSVYFNTIGGGIGIGNNQPVTKLNSVRYAPGNVSLTLDNTLEFGVFRHTGYGG 476

Query: 473 MFSHGSAVPAPAEQPLSYEHRLMIKDLEVWGYGGEEELQKQIQRWQWEEAEATKRKYIKT 532
                  +    E+  ++E R +I+D+EVWG GGE+EL++Q++ W+WEEAEA +R+ I  
Sbjct: 477 TIGPSELLKKNNEENKAFEIRFLIRDVEVWGCGGEKELEEQLREWKWEEAEAKRRQEINL 536

Query: 533 NGGNEDRALLEMAGIVG-HYQSGGSV 557
               EDRALLEMAGI+G H QSGGS+
Sbjct: 537 KTMGEDRALLEMAGIIGQHGQSGGSI 562

>TPHA0H01790 Chr8 (412229..413926) [1698 bp, 565 aa] {ON} Anc_5.431
           YOR118W
          Length = 565

 Score =  312 bits (799), Expect = 7e-99,   Method: Compositional matrix adjust.
 Identities = 191/569 (33%), Positives = 305/569 (53%), Gaps = 16/569 (2%)

Query: 1   MGQRAS---SHVTETTTSRWTFTDRDALIAFFNARALRQLSAVEQWAFHQNIGKNIEPTE 57
           MGQ +S   +   ++  S    T    ++ +FN R + Q S +E   F   +  + + + 
Sbjct: 1   MGQGSSIPEASSGDSNESIKDLTSELEIVDYFNKRVISQFSNIELLCFKHLLEID-DYST 59

Query: 58  ELDLQALATLYGVPADVPWFTEVFYTFVCRLTSFPLMNDCSPP-TYMGLLKVCLLFNKKR 116
            +D   +  L  +         +   F+ RLT+FP ++  +   T  GLLK  ++  K++
Sbjct: 60  IIDDAVVYKLLQIQDVSDRLRNLILNFIKRLTNFPFISTVADNVTAYGLLKTIVILQKQK 119

Query: 117 AARYTARKSYDXXXXXXXXXXPPRDACDENVDQFDGDKL-----IDTLDGTFIAELEVRP 171
             +YT     +             D  ++N    D   +     + T DG  I ++ V  
Sbjct: 120 FIKYTNNNQLNMLKILFIALGD-YDREEDNKKILDCHNISISTILTTYDGIPIHDISVSS 178

Query: 172 NKLVRYSPFIAQISQVCNGSNEPL-SRSMFPAWNRNNQIPLALLRSLDSTIVSRSDARSR 230
           + ++ +  +I  +S VC  +N  + ++ MF  W +     ++L+RS++  I+   D  ++
Sbjct: 179 SNMISFLTWILALSNVCPTNNSIVDTKHMFKYWEKYETSAISLVRSMNPDIIKPDD--NQ 236

Query: 231 SITYQQFAGGLRSVFPNVFDALGLFLERLFYVKRDTTNKLLYTPTKETSTIVTNLLLTQL 290
           +I + QF   L ++ P+V+  L   L  L +++           + + S ++T  + +QL
Sbjct: 237 NILFIQFKTALETIMPHVYLPLEHLLNHLLFMESSLIKSQEIEISFQESKLMTFAVASQL 296

Query: 291 STLYPRINLFTSMQRLFVAGDAGFSMSVFQAKVFKWMAPTILFVSGTRIQDD-EIVCTKN 349
           STL     + + + +L+   ++GFSM  FQ+K FKW APTIL +SG R+ DD E    KN
Sbjct: 297 STLLRNDVVISKLHKLYSGRESGFSMRSFQSKAFKWNAPTILLISGMRVTDDVEYATKKN 356

Query: 350 KRYKAFLQDYPALKDAEQQLALCDRKKRNLIYAIFVRDPWKITNKDLFGDMDTTIIQLAP 409
            RYK F+  YP L+D +Q L  C  K R + +A++V +PWK++NK  FG + T I++L+P
Sbjct: 357 PRYKKFIDQYPRLRDLDQNLEPCHSKLRKVTFAVYVDEPWKVSNKLQFGGLKTLIVELSP 416

Query: 410 RQKIFKAQEAPNIYFNAVGGGIGFGSSQPSVKPAGKRYFPGNVSFTVDPSMEFAVFRNVG 469
           RQ  F+A +   IYFN VGGGIG GSSQP  K     Y PGNVS T+D S+EF  FR+ G
Sbjct: 417 RQDCFRAAKPGVIYFNTVGGGIGIGSSQPVQKKNSLSYTPGNVSLTIDNSLEFGAFRHTG 476

Query: 470 DGGMFSHGSAVPAPAEQPLSYEHRLMIKDLEVWGYGGEEELQKQIQRWQWEEAEATKRKY 529
            GG     S +    +   ++E R +I+D+EVWG GGE+E+ +Q+++W WEE EA KR+ 
Sbjct: 477 YGGSIEPSSILQKKEDATRTFEIRFLIQDIEVWGCGGEKEIDEQLKQWAWEEEEAKKRQR 536

Query: 530 IKTNGGNEDRALLEMAGIVG-HYQSGGSV 557
           +      EDRALLEMAGI+G H  SGGS+
Sbjct: 537 VNLKSMGEDRALLEMAGIIGNHAHSGGSL 565

>CAGL0L11616g Chr12 complement(1240790..1242457) [1668 bp, 555 aa]
           {ON} similar to uniprot|Q12108 Saccharomyces cerevisiae
           YOR118w
          Length = 555

 Score =  283 bits (724), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 176/564 (31%), Positives = 288/564 (51%), Gaps = 16/564 (2%)

Query: 1   MGQRASS-HVTETTTSRWTFTDRDALIAFFNARALRQLSAVEQWAFHQNIGKNIEPTEEL 59
           MGQ ASS    + + S   F  RD ++ +FN R ++  +  E  AF +     I+  E +
Sbjct: 1   MGQTASSPQDNKESKSHPQFKTRDEILQYFNTRVVKLFTVTEIAAFKKRFNA-IDLNEPI 59

Query: 60  DLQALATLYGVPADVPWFTEVFYTFVCRLTSFPLMND--CSPPTYMGLLKVCLLFNKKRA 117
           D   +     + A    ++ V  T +  L +FPL +       T  GLLKV  + N KR 
Sbjct: 60  DDTLIKEALYLDAQPNVWSAVSET-IRLLQNFPLFHQPIADSITGFGLLKVIAIINVKRF 118

Query: 118 ARY--TARKSYDXXXXXXXXXXPPRDACDENVDQFDGDKLIDTLDGTFIAELEVRPNKLV 175
            +   T    YD                +  +   +   ++ T D   I  + +  +KL+
Sbjct: 119 EKLVNTTITRYDITVTLGLCGQAKE--SENKIKSTNLGDILKTYDHIEIESIHIPYDKLI 176

Query: 176 RYSPFIAQISQVCNGSNEPLSRS-MFPAWNRNNQIPLALLRSLDSTIVSRSDARSRSITY 234
               ++  +      +N  +  S     WN      +++  ++ ++ +   +A    I  
Sbjct: 177 LLVAWLLTLVTGVATTNCKVELSDTIANWNNFKSSAISIANTISTSALG--NANDIGIPA 234

Query: 235 QQFAGGLRSVFPNVFDALGLFLERLFYVKRDTTNKLLYTPTKETSTIVTNLLLTQLSTLY 294
                   ++  ++   +    E L +   D  + +          ++T  L  Q+    
Sbjct: 235 TDILNAFNTIMISLVPYMSNLFEHLLFGVDDLIDHVNDLANLSHQDVLTPSLYAQVIIGL 294

Query: 295 PRINLFTSMQRLFVAGDAGFSMSVFQAKVFKWMAPTILFVSGTRIQDDEIVC-TKNKRYK 353
           P     T +Q+L+V  ++GFSM   Q+KVF+W APT++ VSGTRI DDE    +KN RY+
Sbjct: 295 PNSITITKLQKLYVGKESGFSMRSLQSKVFRWKAPTLMIVSGTRISDDESYADSKNPRYR 354

Query: 354 AFLQDYPALKDAEQQLALCDRKKRNLIYAIFVRDPWKITNKDLFGDMDTTIIQLAPRQKI 413
           +FL  +P L++ +Q L      K+ + YA+++ +PWK++NK+ FG  + TI++L P+QK 
Sbjct: 355 SFLYSFPKLRENDQNLDAIHLTKKKVTYAVYIDEPWKVSNKEKFGATNMTIMELTPQQKT 414

Query: 414 FKAQEAPNIYFNAVGGGIGFGSSQPSVKPAGKRYFPGNVSFTVDPSMEFAVFRNVGDGGM 473
           +++     +YFN +GGGIG GS QP VK    ++ PGN+S T+D S+EF VFR+VG GG 
Sbjct: 415 YQSCMERTMYFNTIGGGIGVGSEQPIVKQNDIKFIPGNISLTMDSSLEFGVFRHVGAGGG 474

Query: 474 FSHGSAVPAPAEQPLSYEHRLMIKDLEVWGYGGEEELQKQIQRWQWEEAEATKRKYIKTN 533
           F          +   S+E R +I+++EVWG GGE+EL +Q+++ +WEEAEA +R+ I   
Sbjct: 475 FKTS---LLDNDDSKSFEIRFIIQNVEVWGCGGEKELAEQLKQLEWEEAEAKRRQTINLQ 531

Query: 534 GGNEDRALLEMAGIVGHYQSGGSV 557
             +ED+ALLEM G+VG +QSGGSV
Sbjct: 532 SLSEDKALLEMVGLVGQHQSGGSV 555

>TBLA0A06530 Chr1 complement(1600111..1601589) [1479 bp, 492 aa]
           {ON} Anc_5.431 YOR118W
          Length = 492

 Score =  216 bits (550), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 121/306 (39%), Positives = 182/306 (59%), Gaps = 19/306 (6%)

Query: 244 VFPNVFDALGLFLERLFYVKRDTTNKLLYTPTKETSTIVTNLLLTQLSTLYPRINLFTSM 303
           + PN+FD L   +E   Y K D   +    P++ T T +   +L Q+     + ++   +
Sbjct: 202 IVPNIFDCLKNLIEHSLYTK-DQLKECPLGPSQFTKTKMNQAILCQILLSMRKRSM--DI 258

Query: 304 QRLFVAGDAGFSMSVFQAKVFKWMAPTILFVSGTRIQDDEIVCTKNKRYKAFLQDYPALK 363
            +L++  + G+SM  FQ+KVFKW APTIL ++G +I +D+    KN RYK+FL  YP LK
Sbjct: 259 SKLYIGRENGYSMRSFQSKVFKWKAPTILLITGKKIINDQEYSEKNNRYKSFLNSYPRLK 318

Query: 364 DAEQQLALCDRKKRNLIYAIFVRDPWKITNKDLFGDMDTTIIQLAPRQKIFKAQEAPNIY 423
           D +       +   +  +AI++ +PWK+T K  FG + T IIQL+PRQ +F   +   +Y
Sbjct: 319 DGKTTF----QTPLHYTFAIYIEEPWKMT-KGYFGGLHTKIIQLSPRQDVFTCTDPNAVY 373

Query: 424 FNAVGGGIGFGSSQPSVKPAGKRYFPGNVSFTVDPSMEFAVFRNVGDGGMFSHGSAVPAP 483
           F+    GIG G+   S   +  +Y PGNVS T+D ++EFAVFR+ G  G+F  G      
Sbjct: 374 FHT-QNGIGIGNEHMS---SDNKYKPGNVSITIDSTLEFAVFRHSG-PGVFKTGII---- 424

Query: 484 AEQPLSYEHRLMIKDLEVWGYGGEEELQKQIQRWQWEEAEATKRKYIKTNGGNEDRALLE 543
           A Q + +E RL I+ +EVWG GG +EL +Q   W+WEE EA +R+++  +   EDRALLE
Sbjct: 425 ANQEI-FEIRLHIQSVEVWGCGGAKELAEQKHEWEWEEREAQRRQHVSMH-VTEDRALLE 482

Query: 544 MAGIVG 549
           +AGI+G
Sbjct: 483 LAGIIG 488

>TDEL0D04300 Chr4 (786841..787488) [648 bp, 215 aa] {ON} Anc_3.192
           YDR007W
          Length = 215

 Score = 33.9 bits (76), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 35/82 (42%), Gaps = 10/82 (12%)

Query: 481 PAPAEQPLSYEHRLMIKDLEVW-----GYGGEEELQKQIQRWQWEEAEATKRKYIKTNG- 534
           PA  E+ +    R   +DLEVW       GG  EL        W EAE    K+I   G 
Sbjct: 116 PADCEEVVELSRR---RDLEVWPLFDSEAGGTGELLDWQDISNWSEAEGKGSKFILAGGL 172

Query: 535 -GNEDRALLEMAGIVGHYQSGG 555
             N     L ++G++G   SGG
Sbjct: 173 TTNNVSEALALSGVIGVDVSGG 194

>TDEL0F00110 Chr6 complement(1368..2072) [705 bp, 234 aa] {ON} 
          Length = 234

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 35/69 (50%), Gaps = 6/69 (8%)

Query: 473 MFSHGSAVPAPAEQPLSYEH------RLMIKDLEVWGYGGEEELQKQIQRWQWEEAEATK 526
           +++HG  V A    P+ ++        L+IKD ++ G+  E E+  ++ +   E+   T 
Sbjct: 125 IYAHGGVVAAVCHGPVIFDGLKKLDGELLIKDRKLTGFTDEGEVIMKVDKLMEEKGMKTV 184

Query: 527 RKYIKTNGG 535
           ++  K NGG
Sbjct: 185 KQIAKINGG 193

>Smik_2.393 Chr2 (705234..706805) [1572 bp, 523 aa] {ON} YBR250W
           (REAL)
          Length = 523

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 41/85 (48%), Gaps = 7/85 (8%)

Query: 354 AFLQDYPALKDAEQQLALCDRKKRNLIYAIFVRDPWKITNK--DLFGDMDTTIIQLAPRQ 411
           +F  +Y ALK     L   +  +  ++  I VR  ++IT     L GD D +   L P+ 
Sbjct: 439 SFYPNYAALKVTHLLLFKINYSRNEMVEGIEVRKNYRITVNFPILVGDSDISTSSLLPKY 498

Query: 412 KIFK----AQEAPNIYFNAVGGGIG 432
           ++F+     Q+ P +Y + V GG G
Sbjct: 499 EMFENISDLQDEPPLY-SVVTGGSG 522

>TPHA0J00670 Chr10 complement(148901..150883) [1983 bp, 660 aa] {ON}
           Anc_4.189 YGR044C
          Length = 660

 Score = 32.0 bits (71), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 39/89 (43%), Gaps = 5/89 (5%)

Query: 140 RDACDENVDQFDGDKLIDTLDGTFIAELEVRPNKLVRYSPFIAQISQVCNGSNEPLSRSM 199
           R   D N D+      ++  D    ++L   P     YS +   I    NG++E  ++ +
Sbjct: 72  RSILDNNRDK----PALNNFDNNPASKLPNYPLPHNSYSSYFTNIVNKVNGTSEQPNKML 127

Query: 200 FPAWNRNNQIPLALLRSLDSTIVSRSDAR 228
            P W  N +IP  L   +D TI+S+   R
Sbjct: 128 SPDWTLNKEIPRELSFDID-TIISQEIPR 155

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.136    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 57,603,397
Number of extensions: 2467405
Number of successful extensions: 5276
Number of sequences better than 10.0: 25
Number of HSP's gapped: 5305
Number of HSP's successfully gapped: 25
Length of query: 557
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 442
Effective length of database: 40,294,809
Effective search space: 17810305578
Effective search space used: 17810305578
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 68 (30.8 bits)