Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AER257W5.432ON47745721560.0
Ecym_47635.432ON53847816730.0
KLLA0E21121g5.432ON52642116430.0
SAKL0G02486g5.432ON50039416260.0
KLTH0F16104g5.432ON54047216240.0
YOR119C (RIO1)5.432ON48447415970.0
CAGL0L11594g5.432ON50749315970.0
Suva_8.1725.432ON48647415920.0
Kwal_55.214335.432ON47639415830.0
Skud_15.2825.432ON48547415840.0
Smik_15.2975.432ON48647415740.0
Kpol_1062.315.432ON51340315690.0
NCAS0F033605.432ON50950715630.0
KAFR0E039205.432ON49741315570.0
TBLA0A037605.432ON50440815190.0
TDEL0E019305.432ON50237515160.0
KNAG0C049305.432ON49648815070.0
TPHA0E017805.432ON50841814870.0
NDAI0B056505.432ON46237814610.0
ZYRO0F09988g5.432ON46036913500.0
CAGL0H08019g2.44ON4252191428e-09
NCAS0G015802.44ON4242201383e-08
TPHA0H009202.44ON4292171373e-08
KAFR0A077602.44ON4252171321e-07
NDAI0F036002.44ON4212171285e-07
Suva_14.1362.44ON4262201276e-07
Kwal_23.45632.44ON4252241268e-07
TDEL0A008602.44ON4192171232e-06
Ecym_64492.44ON4172191204e-06
KNAG0F010602.44ON4282191179e-06
Smik_14.1252.44ON4202201171e-05
Skud_14.1292.44ON4252201152e-05
SAKL0E13552g2.44ON4192171115e-05
KLTH0B07722g2.44ON4282241107e-05
Kpol_400.72.44ON4252171081e-04
YNL207W (RIO2)2.44ON4252201072e-04
ABL166W2.44ON4142171062e-04
KLLA0D19008g2.44ON4222171044e-04
ZYRO0C10340g2.44ON416218960.003
KLLA0F15576g5.200ON51251790.39
AGL050C4.155ON483169770.77
NCAS0D028205.200ON531109770.77
KLLA0D07964g2.89ON350109731.8
TDEL0D057203.504ON822138723.4
Ecym_11191.104ON79149714.7
TDEL0B034208.768ON489101696.7
Smik_11.3495.683ON1071100697.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AER257W
         (477 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AER257W Chr5 (1110411..1111844) [1434 bp, 477 aa] {ON} Syntenic ...   835   0.0  
Ecym_4763 Chr4 (1483168..1484784) [1617 bp, 538 aa] {ON} similar...   649   0.0  
KLLA0E21121g Chr5 (1886452..1888032) [1581 bp, 526 aa] {ON} simi...   637   0.0  
SAKL0G02486g Chr7 complement(206119..207621) [1503 bp, 500 aa] {...   630   0.0  
KLTH0F16104g Chr6 (1306436..1308058) [1623 bp, 540 aa] {ON} simi...   630   0.0  
YOR119C Chr15 complement(548792..550246) [1455 bp, 484 aa] {ON} ...   619   0.0  
CAGL0L11594g Chr12 (1239169..1240692) [1524 bp, 507 aa] {ON} hig...   619   0.0  
Suva_8.172 Chr8 complement(306553..308013) [1461 bp, 486 aa] {ON...   617   0.0  
Kwal_55.21433 s55 (835062..836492) [1431 bp, 476 aa] {ON} YOR119...   614   0.0  
Skud_15.282 Chr15 complement(505219..506676) [1458 bp, 485 aa] {...   614   0.0  
Smik_15.297 Chr15 complement(509934..511394) [1461 bp, 486 aa] {...   610   0.0  
Kpol_1062.31 s1062 (67759..69300) [1542 bp, 513 aa] {ON} (67759....   608   0.0  
NCAS0F03360 Chr6 complement(679314..680843) [1530 bp, 509 aa] {O...   606   0.0  
KAFR0E03920 Chr5 complement(775345..776838) [1494 bp, 497 aa] {O...   604   0.0  
TBLA0A03760 Chr1 complement(938917..940431) [1515 bp, 504 aa] {O...   589   0.0  
TDEL0E01930 Chr5 (363913..365421) [1509 bp, 502 aa] {ON} Anc_5.4...   588   0.0  
KNAG0C04930 Chr3 (951832..953322) [1491 bp, 496 aa] {ON} Anc_5.4...   585   0.0  
TPHA0E01780 Chr5 (357819..359345) [1527 bp, 508 aa] {ON} Anc_5.4...   577   0.0  
NDAI0B05650 Chr2 complement(1380239..1381627) [1389 bp, 462 aa] ...   567   0.0  
ZYRO0F09988g Chr6 complement(811306..812688) [1383 bp, 460 aa] {...   524   0.0  
CAGL0H08019g Chr8 (781773..783050) [1278 bp, 425 aa] {ON} highly...    59   8e-09
NCAS0G01580 Chr7 (281438..282712) [1275 bp, 424 aa] {ON} Anc_2.44      58   3e-08
TPHA0H00920 Chr8 complement(188834..190123) [1290 bp, 429 aa] {O...    57   3e-08
KAFR0A07760 Chr1 complement(1560351..1561628) [1278 bp, 425 aa] ...    55   1e-07
NDAI0F03600 Chr6 complement(860282..861547) [1266 bp, 421 aa] {O...    54   5e-07
Suva_14.136 Chr14 (250349..251629) [1281 bp, 426 aa] {ON} YNL207...    54   6e-07
Kwal_23.4563 s23 (768125..769402) [1278 bp, 425 aa] {ON} YNL207W...    53   8e-07
TDEL0A00860 Chr1 (143723..144982) [1260 bp, 419 aa] {ON} Anc_2.4...    52   2e-06
Ecym_6449 Chr6 complement(873295..874548) [1254 bp, 417 aa] {ON}...    51   4e-06
KNAG0F01060 Chr6 (188811..190097) [1287 bp, 428 aa] {ON} Anc_2.4...    50   9e-06
Smik_14.125 Chr14 (234660..235922) [1263 bp, 420 aa] {ON} YNL207...    50   1e-05
Skud_14.129 Chr14 (244224..245501) [1278 bp, 425 aa] {ON} YNL207...    49   2e-05
SAKL0E13552g Chr5 complement(1118842..1120101) [1260 bp, 419 aa]...    47   5e-05
KLTH0B07722g Chr2 complement(625231..626517) [1287 bp, 428 aa] {...    47   7e-05
Kpol_400.7 s400 complement(15841..17118) [1278 bp, 425 aa] {ON} ...    46   1e-04
YNL207W Chr14 (255353..256630) [1278 bp, 425 aa] {ON}  RIO2Essen...    46   2e-04
ABL166W Chr2 (88546..89790) [1245 bp, 414 aa] {ON} Syntenic homo...    45   2e-04
KLLA0D19008g Chr4 complement(1598807..1600075) [1269 bp, 422 aa]...    45   4e-04
ZYRO0C10340g Chr3 complement(793323..794573) [1251 bp, 416 aa] {...    42   0.003
KLLA0F15576g Chr6 (1437595..1439133) [1539 bp, 512 aa] {ON} simi...    35   0.39 
AGL050C Chr7 complement(613063..614514) [1452 bp, 483 aa] {ON} S...    34   0.77 
NCAS0D02820 Chr4 (536140..537735) [1596 bp, 531 aa] {ON} Anc_5.200     34   0.77 
KLLA0D07964g Chr4 complement(682226..683278) [1053 bp, 350 aa] {...    33   1.8  
TDEL0D05720 Chr4 (1028139..1030607) [2469 bp, 822 aa] {ON} Anc_3...    32   3.4  
Ecym_1119 Chr1 complement(244327..246702) [2376 bp, 791 aa] {ON}...    32   4.7  
TDEL0B03420 Chr2 complement(609095..610564) [1470 bp, 489 aa] {O...    31   6.7  
Smik_11.349 Chr11 (589827..593042) [3216 bp, 1071 aa] {ON} YKR08...    31   7.7  

>AER257W Chr5 (1110411..1111844) [1434 bp, 477 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR119C (RIO1)
          Length = 477

 Score =  835 bits (2156), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/457 (90%), Positives = 413/457 (90%)

Query: 1   MDLEDQLRKLKLRDDTDHDNTRILEKFANQIKTDELSLTKGKTNKDKANRATVENVLDPR 60
           MDLEDQLRKLKLRDDTDHDNTRILEKFANQIKTDELSLTKGKTNKDKANRATVENVLDPR
Sbjct: 1   MDLEDQLRKLKLRDDTDHDNTRILEKFANQIKTDELSLTKGKTNKDKANRATVENVLDPR 60

Query: 61  TMRFLRALVNRGVLSEFNGCLSTGKEANVYHALSGATEGAPEKSEYAVKIYKTSILVFKD 120
           TMRFLRALVNRGVLSEFNGCLSTGKEANVYHALSGATEGAPEKSEYAVKIYKTSILVFKD
Sbjct: 61  TMRFLRALVNRGVLSEFNGCLSTGKEANVYHALSGATEGAPEKSEYAVKIYKTSILVFKD 120

Query: 121 RERYVDGEFRFRNARSHHNPRKMIKIWAEKEFRNLKRIYQSGVIPCPQPVEIKSNVLVME 180
           RERYVDGEFRFRNARSHHNPRKMIKIWAEKEFRNLKRIYQSGVIPCPQPVEIKSNVLVME
Sbjct: 121 RERYVDGEFRFRNARSHHNPRKMIKIWAEKEFRNLKRIYQSGVIPCPQPVEIKSNVLVME 180

Query: 181 FLNRGDGFASPRLKDYPFKDRDEIYHYYHVMVSYIRLLYQVCQLVHADLSEYNSIVHQSK 240
           FLNRGDGFASPRLKDYPFKDRDEIYHYYHVMVSYIRLLYQVCQLVHADLSEYNSIVHQSK
Sbjct: 181 FLNRGDGFASPRLKDYPFKDRDEIYHYYHVMVSYIRLLYQVCQLVHADLSEYNSIVHQSK 240

Query: 241 LYIIDVSQSVQPEHPMSLDFLRMDIKNINMYFERMGIDIFPERVIFQFVISETLDKFRGD 300
           LYIIDVSQSVQPEHPMSLDFLRMDIKNINMYFERMGIDIFPERVIFQFVISETLDKFRGD
Sbjct: 241 LYIIDVSQSVQPEHPMSLDFLRMDIKNINMYFERMGIDIFPERVIFQFVISETLDKFRGD 300

Query: 301 MRSAEDLRSYVAANLPRKQTAQDEAEDQVFRSLHLVRNLGGLEERDFDRFTDGKFDLLKS 360
           MRSAEDLRSYVAANLPRKQTAQDEAEDQVFRSLHLVRNLGGLEERDFDRFTDGKFDLLKS
Sbjct: 301 MRSAEDLRSYVAANLPRKQTAQDEAEDQVFRSLHLVRNLGGLEERDFDRFTDGKFDLLKS 360

Query: 361 LIAQDNAKISNTFTASEQYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 420
           LIAQDNAKISNTFTASEQY                                         
Sbjct: 361 LIAQDNAKISNTFTASEQYDLSDSDDAEDEDEDADEGQDEDGSESGTDSDSSSDDESGDD 420

Query: 421 XXXYELRPKVLVGKKYEDKDAKKLRKSEAKENKRERR 457
              YELRPKVLVGKKYEDKDAKKLRKSEAKENKRERR
Sbjct: 421 KDDYELRPKVLVGKKYEDKDAKKLRKSEAKENKRERR 457

>Ecym_4763 Chr4 (1483168..1484784) [1617 bp, 538 aa] {ON} similar to
           Ashbya gossypii AER257W
          Length = 538

 Score =  649 bits (1673), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/478 (66%), Positives = 371/478 (77%), Gaps = 21/478 (4%)

Query: 1   MDLEDQLRKLKLRDDTDHDNTRILEKFANQIKTDELSLTKGKTNKDKANRATVENVLDPR 60
           MDLE++L +LKL D ++H+N+RIL+KFANQIKTDELS+T+GKT+KDKANRATVENVLDPR
Sbjct: 33  MDLENKLGRLKLLDHSEHENSRILDKFANQIKTDELSVTRGKTSKDKANRATVENVLDPR 92

Query: 61  TMRFLRALVNRGVLSEFNGCLSTGKEANVYHALSGA-------------------TEGAP 101
           TMRFLR+L++RG+++EFNGCLSTGKEANVYHA   A                   +EG  
Sbjct: 93  TMRFLRSLIHRGIITEFNGCLSTGKEANVYHAFGNAVDIVEKQHKVIRQSSICSDSEGDT 152

Query: 102 EKSEYAVKIYKTSILVFKDRERYVDGEFRFRNARSHHNPRKMIKIWAEKEFRNLKRIYQS 161
           +K EYA+KIYKTSILVFKDRERYVDGEFRFRN+RS HNPRKMIKIWAEKEFRNLKRIY +
Sbjct: 153 KKVEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYHT 212

Query: 162 GVIPCPQPVEIKSNVLVMEFLNRGDGFASPRLKDYPFKDRDEIYHYYHVMVSYIRLLYQV 221
           GVI CP+P+EIKSNVLVMEFLNRGDGFASP+LKDYP+ DR EIY++YHVMV+YIRLLYQV
Sbjct: 213 GVISCPKPIEIKSNVLVMEFLNRGDGFASPKLKDYPYSDRQEIYYFYHVMVAYIRLLYQV 272

Query: 222 CQLVHADLSEYNSIVHQSKLYIIDVSQSVQPEHPMSLDFLRMDIKNINMYFERMGIDIFP 281
           CQLVHADLSEYNSIVH+SKLYIIDVSQSVQPEHPMSLDFLRMDIKNIN YF ++GI++F 
Sbjct: 273 CQLVHADLSEYNSIVHESKLYIIDVSQSVQPEHPMSLDFLRMDIKNINAYFVKIGINVFS 332

Query: 282 ERVIFQFVISETLDKFRGDMRSAEDLRSYVAANLPRKQTAQDEAEDQVFRSLHLVRNLGG 341
           ER IFQFVISE L+KF+GD RS + L+ Y +  LP K T +DE ED++FRSLHLVRNLGG
Sbjct: 333 ERAIFQFVISEKLEKFKGDYRSYDHLQKYASEYLPLKLTEEDEVEDEIFRSLHLVRNLGG 392

Query: 342 LEERDFDRFTDGKFDLLKSLIAQDNAKISNTFTASEQYXXXXXXXXXXXXXXXXXXXXXX 401
           LEE DFDRFT+GKFDLLKSL++QDN K++ TFTASEQ+                      
Sbjct: 393 LEEGDFDRFTNGKFDLLKSLVSQDNQKVAKTFTASEQFELSDSGTDSVDHGDSDEDLSSD 452

Query: 402 XXXXXXXXXXXXXXXXXXX--XXXYELRPKVLVGKKYEDKDAKKLRKSEAKENKRERR 457
                                    E R K   GKKYEDKD +KLRK + KE+KRE+R
Sbjct: 453 ESNSETENDSDDSQSSDEEPDEDTREHRIKEPKGKKYEDKDTRKLRKQDVKESKREKR 510

>KLLA0E21121g Chr5 (1886452..1888032) [1581 bp, 526 aa] {ON} similar
           to uniprot|Q12196 YOR119C Saccharomyces cerevisiae RIO1
           Essential protein that plays a role in cell cycle
           progression
          Length = 526

 Score =  637 bits (1643), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/421 (72%), Positives = 351/421 (83%), Gaps = 42/421 (9%)

Query: 1   MDLEDQLRKLKLRDDTDHDNTRILEKFANQIKTDELSLTKGKTNKDKANRATVENVLDPR 60
           M+++D+L KL L +  +H NT+ILE++AN IKTDELSLT+GKT+KDKANRATVENVLDPR
Sbjct: 2   MNIDDKLEKLNLANRDEHVNTQILERYANSIKTDELSLTRGKTSKDKANRATVENVLDPR 61

Query: 61  TMRFLRALVNRGVLSEFNGCLSTGKEANVYHALSGATE-------------GAPE----- 102
           TMRFL++++NRG+LS FNGCLSTGKEANVYHA +G  E             GAP+     
Sbjct: 62  TMRFLKSMMNRGILSAFNGCLSTGKEANVYHAFAGNHEERHLLVEGHDDTIGAPQNIEST 121

Query: 103 ------------------------KSEYAVKIYKTSILVFKDRERYVDGEFRFRNARSHH 138
                                   K EYAVKIYKTSILVFKDRERYVDGEFRFRN+RS H
Sbjct: 122 KQKALTAESEDATSTSTATDEPKNKKEYAVKIYKTSILVFKDRERYVDGEFRFRNSRSQH 181

Query: 139 NPRKMIKIWAEKEFRNLKRIYQSGVIPCPQPVEIKSNVLVMEFLNRGDGFASPRLKDYPF 198
           NPRKMIKIWAEKEFRNLKRIYQSGVIPCP+P+E++SNVLVMEFLNRGDGFASPRLKD+P+
Sbjct: 182 NPRKMIKIWAEKEFRNLKRIYQSGVIPCPKPIEVRSNVLVMEFLNRGDGFASPRLKDHPY 241

Query: 199 KDRDEIYHYYHVMVSYIRLLYQVCQLVHADLSEYNSIVHQSKLYIIDVSQSVQPEHPMSL 258
           KDR+EI HYY++M++Y+RLLYQVC+LVHADLSEYNSIVH+ KLYIIDVSQSVQPEHPMSL
Sbjct: 242 KDREEIKHYYNLMIAYMRLLYQVCRLVHADLSEYNSIVHEDKLYIIDVSQSVQPEHPMSL 301

Query: 259 DFLRMDIKNINMYFERMGIDIFPERVIFQFVISETLDKFRGDMRSAEDLRSYVAANLPRK 318
           DFLRMDIKN+N YF+++GIDIFPERVIFQF+ISE LDKF+GD RS++DL +YVA NLP K
Sbjct: 302 DFLRMDIKNVNSYFQKLGIDIFPERVIFQFIISEVLDKFKGDYRSSDDLETYVADNLPLK 361

Query: 319 QTAQDEAEDQVFRSLHLVRNLGGLEERDFDRFTDGKFDLLKSLIAQDNAKISNTFTASEQ 378
            T +DEAED+VFRSLHL+RNLGGLEERDFDRFTDGKFDLLKSLIA +N K S  FTASEQ
Sbjct: 362 LTDEDEAEDEVFRSLHLIRNLGGLEERDFDRFTDGKFDLLKSLIANENRKYSENFTASEQ 421

Query: 379 Y 379
           Y
Sbjct: 422 Y 422

 Score = 38.9 bits (89), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 20/25 (80%)

Query: 431 LVGKKYEDKDAKKLRKSEAKENKRE 455
           L GKKYEDKDAKK RK E KE KRE
Sbjct: 480 LKGKKYEDKDAKKQRKQETKEAKRE 504

>SAKL0G02486g Chr7 complement(206119..207621) [1503 bp, 500 aa] {ON}
           similar to uniprot|Q12196 YOR119C Saccharomyces
           cerevisiae RIO1 Essential protein that plays a role in
           cell cycle progression
          Length = 500

 Score =  630 bits (1626), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/394 (76%), Positives = 339/394 (86%), Gaps = 15/394 (3%)

Query: 1   MDLEDQLRKLKLRDDTD----HDNTRILEKFANQIKTDELSLTKGKTNKDKANRATVENV 56
           M +E    KL LRD  D    H N+RIL+K++++IKTDELSLT+GKTNKDKANRATVENV
Sbjct: 1   MSVEASFSKLHLRDGPDEHRDHVNSRILDKYSHRIKTDELSLTRGKTNKDKANRATVENV 60

Query: 57  LDPRTMRFLRALVNRGVLSEFNGCLSTGKEANVYHALSGATEGAPE-----------KSE 105
           LDPRTMRFLR LV+RGVLS+ NGCLSTGKEANVYHA +G      E           K E
Sbjct: 61  LDPRTMRFLRGLVSRGVLSDLNGCLSTGKEANVYHAFAGNANQPSEEAEKDSKDELVKRE 120

Query: 106 YAVKIYKTSILVFKDRERYVDGEFRFRNARSHHNPRKMIKIWAEKEFRNLKRIYQSGVIP 165
           YAVKIYKTSILVFKDRERYVDGEFRFRN+RS HNPRKMIKIWAEKEFRNLKRI+QSGVIP
Sbjct: 121 YAVKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQSGVIP 180

Query: 166 CPQPVEIKSNVLVMEFLNRGDGFASPRLKDYPFKDRDEIYHYYHVMVSYIRLLYQVCQLV 225
           CPQP+E++SNVLVMEFLNRG+GFASPRLKD+P+KDR+EI +YYH MV+Y+RLLYQVCQLV
Sbjct: 181 CPQPIEVRSNVLVMEFLNRGNGFASPRLKDHPYKDREEIKYYYHTMVAYMRLLYQVCQLV 240

Query: 226 HADLSEYNSIVHQSKLYIIDVSQSVQPEHPMSLDFLRMDIKNINMYFERMGIDIFPERVI 285
           HADLSEYN+IVH  +LY+IDVSQSVQPEHPMSLDFLRMDIKNIN YFE+ GIDIFPERVI
Sbjct: 241 HADLSEYNTIVHHDRLYMIDVSQSVQPEHPMSLDFLRMDIKNINSYFEKTGIDIFPERVI 300

Query: 286 FQFVISETLDKFRGDMRSAEDLRSYVAANLPRKQTAQDEAEDQVFRSLHLVRNLGGLEER 345
           FQF+ISETLDKF+GD  + +DLR YV+ NLP K TA+DEAED+VFRSLHLVRNL GLEER
Sbjct: 301 FQFIISETLDKFQGDYHNDQDLRDYVSKNLPLKSTAEDEAEDEVFRSLHLVRNLNGLEER 360

Query: 346 DFDRFTDGKFDLLKSLIAQDNAKISNTFTASEQY 379
           DFDRFTDGKFDLLKSLIA DN K +  F ASEQ+
Sbjct: 361 DFDRFTDGKFDLLKSLIAHDNKKNATNFNASEQF 394

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 22/25 (88%)

Query: 433 GKKYEDKDAKKLRKSEAKENKRERR 457
           GKKYEDKDAK+LRK E KE KRE+R
Sbjct: 456 GKKYEDKDAKRLRKQETKEAKREKR 480

>KLTH0F16104g Chr6 (1306436..1308058) [1623 bp, 540 aa] {ON} similar
           to uniprot|Q12196 YOR119C Saccharomyces cerevisiae RIO1
           Essential protein that plays a role in cell cycle
           progression
          Length = 540

 Score =  630 bits (1624), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/472 (67%), Positives = 361/472 (76%), Gaps = 19/472 (4%)

Query: 1   MDLEDQLRKLKLRD----DTDHDNTRILEKFANQIKTDELSLTKGKTNKDKANRATVENV 56
           M LED L KL L +    D DH NT+IL+K A+ IKTDELS+T+ KT+KDKANRATVENV
Sbjct: 53  MSLEDGLGKLSLHEKHGADRDHINTQILDKHAHNIKTDELSVTRAKTSKDKANRATVENV 112

Query: 57  LDPRTMRFLRALVNRGVLSEFNGCLSTGKEANVYHALSGATEGAPE-----------KSE 105
           LDPRTMRFL+AL +RGV+SEFNGCLSTGKEANVYHA +G    + E           + E
Sbjct: 113 LDPRTMRFLQALKSRGVISEFNGCLSTGKEANVYHAFAGYGAKSSEEEQKVLPNQGERRE 172

Query: 106 YAVKIYKTSILVFKDRERYVDGEFRFRNARSHHNPRKMIKIWAEKEFRNLKRIYQSGVIP 165
           YA+KIYKTSILVFKDRERYVDGEFRFRN+RS HNPRKMIKIWAEKEFRNLKRIYQSGV+P
Sbjct: 173 YAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVVP 232

Query: 166 CPQPVEIKSNVLVMEFLNRGDGFASPRLKDYPFKDRDEIYHYYHVMVSYIRLLYQVCQLV 225
            P+P+E+KSNVLVMEFLNRGDGFASP+LKD+P+KDRDE  +YYH MV+YIRLLYQ CQLV
Sbjct: 233 APEPIEVKSNVLVMEFLNRGDGFASPKLKDFPYKDRDETLYYYHTMVAYIRLLYQCCQLV 292

Query: 226 HADLSEYNSIVHQSKLYIIDVSQSVQPEHPMSLDFLRMDIKNINMYFERMGIDIFPERVI 285
           HADLSEYN+IVH  KLY+IDVSQSVQPEHPMSLDFLRMDIKNIN YFERM IDIFPER I
Sbjct: 293 HADLSEYNTIVHNQKLYVIDVSQSVQPEHPMSLDFLRMDIKNINSYFERMSIDIFPERAI 352

Query: 286 FQFVISETLDKFRGDMRSAEDLRSYVAANLPRKQTAQDEAEDQVFRSLHLVRNLGGLEER 345
           FQFVIS+ L+KF G+  +AEDLR YVA  L  K   +DEAED+VFRSLHLVRNLGGLEER
Sbjct: 353 FQFVISDKLEKFEGEYTNAEDLRQYVAKTLRPKSGPEDEAEDEVFRSLHLVRNLGGLEER 412

Query: 346 DFDRFTDGKFDLLKSLIAQDNAKISNTFTASEQYXXXXXXXXXXXXXXXXXXXXXXXXXX 405
           DFDRFT GKFDLLKSLIA DN K+++ FTASEQY                          
Sbjct: 413 DFDRFTLGKFDLLKSLIAHDNQKVASNFTASEQY----ELSSSSDEEVSEDEDYNESGSG 468

Query: 406 XXXXXXXXXXXXXXXXXXYELRPKVLVGKKYEDKDAKKLRKSEAKENKRERR 457
                             +  + K + GKK+EDKD+KK RK++AKE KRE+R
Sbjct: 469 SEDDDGDDESGESSDEEEWLEKSKEIKGKKHEDKDSKKQRKTDAKEAKREKR 520

>YOR119C Chr15 complement(548792..550246) [1455 bp, 484 aa] {ON}
           RIO1Essential serine kinase involved in cell cycle
           progression and processing of the 20S pre-rRNA into
           mature 18S rRNA
          Length = 484

 Score =  619 bits (1597), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/474 (64%), Positives = 365/474 (77%), Gaps = 27/474 (5%)

Query: 1   MDLEDQLRKLKL-RDDTDHDNTRILEKFANQIKTDELSLTKGKTNKDKANRATVENVLDP 59
           M LED+   L + +  +DH N ++LEK++++IKTDELS ++ KT+KDKANRATVENVLDP
Sbjct: 1   MSLEDKFDSLSVSQGASDHINNQLLEKYSHKIKTDELSFSRAKTSKDKANRATVENVLDP 60

Query: 60  RTMRFLRALVNRGVLSEFNGCLSTGKEANVYHALSGATEGAP----------------EK 103
           RTMRFL+++V RGV+++ NGCLSTGKEANVYHA +G T  AP                 +
Sbjct: 61  RTMRFLKSMVTRGVIADLNGCLSTGKEANVYHAFAG-TGKAPVIDEETGQYEVLETDGSR 119

Query: 104 SEYAVKIYKTSILVFKDRERYVDGEFRFRNARSHHNPRKMIKIWAEKEFRNLKRIYQSGV 163
           +EYA+KIYKTSILVFKDRERYVDGEFRFRN+RS HNPRKMIKIWAEKEFRNLKRIYQSGV
Sbjct: 120 AEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGV 179

Query: 164 IPCPQPVEIKSNVLVMEFLNRGDGFASPRLKDYPFKDRDEIYHYYHVMVSYIRLLYQVCQ 223
           IP P+P+E+K+NVLVMEFL+RG+GFASP+LKDYP+K+RDEI+HYYH MV+Y+RLLYQVC+
Sbjct: 180 IPAPKPIEVKNNVLVMEFLSRGNGFASPKLKDYPYKNRDEIFHYYHTMVAYMRLLYQVCR 239

Query: 224 LVHADLSEYNSIVHQSKLYIIDVSQSVQPEHPMSLDFLRMDIKNINMYFERMGIDIFPER 283
           LVHADLSEYN+IVH  KLY+IDVSQSV+PEHPMSLDFLRMDIKN+N+YFE+MGI IFPER
Sbjct: 240 LVHADLSEYNTIVHDDKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGISIFPER 299

Query: 284 VIFQFVISETLDKFRGDMRSAEDLRSYVAANLPRKQTAQDEAEDQVFRSLHLVRNLGGLE 343
           VIFQFVISETL+KF+GD  +   L +Y+A+NLP K T QDEAED++FRSLHLVR+LGGLE
Sbjct: 300 VIFQFVISETLEKFKGDYNNISALVAYIASNLPIKSTEQDEAEDEIFRSLHLVRSLGGLE 359

Query: 344 ERDFDRFTDGKFDLLKSLIAQDNAKISNTFTASEQYXXXXXXXXXXXXXXXXXXXXXXXX 403
           ERDFDR+TDGKFDLLKSLIA DN +    F ASEQ+                        
Sbjct: 360 ERDFDRYTDGKFDLLKSLIAHDNER---NFAASEQFEFDNADHECSSGTEEFSDDEEDGS 416

Query: 404 XXXXXXXXXXXXXXXXXXXXYELRPKVLVGKKYEDKDAKKLRKSEAKENKRERR 457
                                   PKVL GKK+EDKD KKLRK EAK+ KRE+R
Sbjct: 417 SGSEEDDEEEGEYYDDD------EPKVLKGKKHEDKDLKKLRKQEAKDAKREKR 464

>CAGL0L11594g Chr12 (1239169..1240692) [1524 bp, 507 aa] {ON} highly
           similar to uniprot|Q12196 Saccharomyces cerevisiae
           YOR119c
          Length = 507

 Score =  619 bits (1597), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/493 (63%), Positives = 362/493 (73%), Gaps = 45/493 (9%)

Query: 2   DLEDQLRKLKLRDDTDHDNTRILEKFANQIKTDELSLTKGKTNKDKANRATVENVLDPRT 61
           DL D+ R +K+   TDH N +I++K+ ++IKTDELS+ K KTNKDKANRATVENVLDPRT
Sbjct: 3   DLSDKFRNVKV--STDHINNQIMDKYGHKIKTDELSINKAKTNKDKANRATVENVLDPRT 60

Query: 62  MRFLRALVNRGVLSEFNGCLSTGKEANVYHALSG---ATE-------------GAPEKS- 104
           MRFL ALVNRGV++  NGCLSTGKEANVYHA +G   ATE               P K  
Sbjct: 61  MRFLNALVNRGVIAGLNGCLSTGKEANVYHAFAGSKMATEQQSDEPKEDIDANAIPSKGN 120

Query: 105 --------------------EYAVKIYKTSILVFKDRERYVDGEFRFRNARSHHNPRKMI 144
                               EYA+KIYKTSIL+FKDRERYVDGEFRFRN+RS HNPRKMI
Sbjct: 121 IDISENRAKTAEDLIREGRKEYAIKIYKTSILIFKDRERYVDGEFRFRNSRSQHNPRKMI 180

Query: 145 KIWAEKEFRNLKRIYQSGVIPCPQPVEIKSNVLVMEFLNRGDGFASPRLKDYPFKDRDEI 204
           KIWAEKEFRNLKRIYQ GVIP P+P+E+K+NVLVMEFLNRGDGFASP+L+DYP+KDR+EI
Sbjct: 181 KIWAEKEFRNLKRIYQMGVIPSPEPIEVKNNVLVMEFLNRGDGFASPKLRDYPYKDREEI 240

Query: 205 YHYYHVMVSYIRLLYQVCQLVHADLSEYNSIVHQSKLYIIDVSQSVQPEHPMSLDFLRMD 264
           Y+YYH++VSY+RLLYQVC+LVHADLSEYN+IVH+ KLY+IDVSQSV+PEHPMSLDFLRMD
Sbjct: 241 YYYYHILVSYMRLLYQVCRLVHADLSEYNTIVHKEKLYMIDVSQSVEPEHPMSLDFLRMD 300

Query: 265 IKNINMYFERMGIDIFPERVIFQFVISETLDKFRGDMRSAEDLRSYVAANLPRKQTAQDE 324
           IKN+N+YFE+MGI+IF E+ IFQFVI++TLDKF GDM S EDLR YVA N+P K+T +DE
Sbjct: 301 IKNVNLYFEKMGIEIFQEKAIFQFVITDTLDKFDGDMNSYEDLRKYVATNIPIKRTQEDE 360

Query: 325 AEDQVFRSLHLVRNLGGLEERDFDRFTDGKFDLLKSLIAQDNAKISNTFTASEQYXXXXX 384
           AED+VFRSLHLVRNL GLEERDFDRFTDGKFDLLKSL+AQDN K      AS+       
Sbjct: 361 AEDEVFRSLHLVRNLEGLEERDFDRFTDGKFDLLKSLLAQDNKKNYIAAQASK------I 414

Query: 385 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYELRPKVLVGKKYEDKDAKKL 444
                                                  YE  PK L GKKYEDKD KK 
Sbjct: 415 NVDSSDENISDSEDEGSDDGSDDDTDGSDEEEQYSEAESYEEVPKELKGKKYEDKDLKKQ 474

Query: 445 RKSEAKENKRERR 457
           RK EAKE KRE+R
Sbjct: 475 RKQEAKEAKREKR 487

>Suva_8.172 Chr8 complement(306553..308013) [1461 bp, 486 aa] {ON}
           YOR119C (REAL)
          Length = 486

 Score =  617 bits (1592), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/474 (64%), Positives = 365/474 (77%), Gaps = 25/474 (5%)

Query: 1   MDLEDQLRKLKLRD-DTDHDNTRILEKFANQIKTDELSLTKGKTNKDKANRATVENVLDP 59
           M  ED+  KL +    +DH N ++L+KF+++IKTDELS +K KT+KDK+NRATVENVLDP
Sbjct: 1   MSFEDKFEKLTVSQRASDHINNQLLDKFSHKIKTDELSFSKAKTSKDKSNRATVENVLDP 60

Query: 60  RTMRFLRALVNRGVLSEFNGCLSTGKEANVYHALSGATEGAPE----------------K 103
           RTMRFL+++VNRGV+++ NGCLSTGKEANVYHA +G T  AP                 +
Sbjct: 61  RTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAG-TGKAPVVDEETGKYEVLETDGLR 119

Query: 104 SEYAVKIYKTSILVFKDRERYVDGEFRFRNARSHHNPRKMIKIWAEKEFRNLKRIYQSGV 163
           +EYA+KIYKTSILVFKDRE+YVDGEFRFRNARS HNPRKMIKIWAEKEFRNLKRI+QSGV
Sbjct: 120 AEYAIKIYKTSILVFKDREKYVDGEFRFRNARSQHNPRKMIKIWAEKEFRNLKRIHQSGV 179

Query: 164 IPCPQPVEIKSNVLVMEFLNRGDGFASPRLKDYPFKDRDEIYHYYHVMVSYIRLLYQVCQ 223
           IP P+PVE+K+NVLVMEFL+RGDGFASP+LKDYP+KDR+EI+HYY+ MV+Y+RLLYQVC+
Sbjct: 180 IPAPKPVEVKNNVLVMEFLSRGDGFASPKLKDYPYKDREEIFHYYYTMVAYMRLLYQVCR 239

Query: 224 LVHADLSEYNSIVHQSKLYIIDVSQSVQPEHPMSLDFLRMDIKNINMYFERMGIDIFPER 283
           LVHADLSEYN+I+H  +LY+IDVSQSV+PEHPMSLDFLRMDIKN+N+YFE+MGI+IFPER
Sbjct: 240 LVHADLSEYNTIIHDDQLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGINIFPER 299

Query: 284 VIFQFVISETLDKFRGDMRSAEDLRSYVAANLPRKQTAQDEAEDQVFRSLHLVRNLGGLE 343
           VIFQFVISE L+KF+GD ++  DL  Y++ NLP K T QDEAED++FRSLHLVR+LGGLE
Sbjct: 300 VIFQFVISEVLEKFKGDYKNVPDLIGYISKNLPIKSTEQDEAEDEIFRSLHLVRSLGGLE 359

Query: 344 ERDFDRFTDGKFDLLKSLIAQDNAKISNTFTASEQYXXXXXXXXXXXXXXXXXXXXXXXX 403
           ERDFDR+TDGKFDLLKSLIA DN +    F ASEQ+                        
Sbjct: 360 ERDFDRYTDGKFDLLKSLIAHDNER---NFAASEQFEFNDNDHGSAPESEESSGSEYEDL 416

Query: 404 XXXXXXXXXXXXXXXXXXXXYELRPKVLVGKKYEDKDAKKLRKSEAKENKRERR 457
                                   PK+L GKKYEDKD KKLRK EAK+ KRE+R
Sbjct: 417 SGSEEDEDDSDDSEYYDDD----EPKILKGKKYEDKDVKKLRKQEAKDTKREKR 466

>Kwal_55.21433 s55 (835062..836492) [1431 bp, 476 aa] {ON} YOR119C
           (RIO1) - similar to a C.elegans ZK632.3 protein [contig
           130] FULL
          Length = 476

 Score =  614 bits (1583), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/394 (75%), Positives = 342/394 (86%), Gaps = 15/394 (3%)

Query: 1   MDLEDQLRKLKLRDD----TDHDNTRILEKFANQIKTDELSLTKGKTNKDKANRATVENV 56
           M L+D++  L+LRD+     DH NT+IL+K A+ IK DELS+++GKT+KDKANRATVENV
Sbjct: 1   MSLKDRMDNLRLRDNFEPQDDHINTQILDKHAHNIKADELSVSRGKTSKDKANRATVENV 60

Query: 57  LDPRTMRFLRALVNRGVLSEFNGCLSTGKEANVYHALS--GA--TEGA-------PEKSE 105
           LDPRTMRFL+AL +RGV+S+FNGC+STGKEANVYHA +  GA  TE A        E+ E
Sbjct: 61  LDPRTMRFLQALTSRGVISQFNGCVSTGKEANVYHAFAEIGAKNTEEAGEVLPNLEERRE 120

Query: 106 YAVKIYKTSILVFKDRERYVDGEFRFRNARSHHNPRKMIKIWAEKEFRNLKRIYQSGVIP 165
            A+KI+KTSILVFKDRERYVDGEFRFRN+RS HNPRKMIKIWAEKEFRNLKRIYQSG++P
Sbjct: 121 LAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGLVP 180

Query: 166 CPQPVEIKSNVLVMEFLNRGDGFASPRLKDYPFKDRDEIYHYYHVMVSYIRLLYQVCQLV 225
            P+PVE++SNVLVMEFL+RG+GFASPRLKDYP+KDR+E  HYY+ MV+YIRLLYQ CQLV
Sbjct: 181 APEPVEVRSNVLVMEFLSRGNGFASPRLKDYPYKDREETAHYYYTMVAYIRLLYQCCQLV 240

Query: 226 HADLSEYNSIVHQSKLYIIDVSQSVQPEHPMSLDFLRMDIKNINMYFERMGIDIFPERVI 285
           HADLSEYN+IVH  +LYIIDVSQSVQPEHPMSLDFLRMDIKN+N YFERM +D+FPERVI
Sbjct: 241 HADLSEYNAIVHNKELYIIDVSQSVQPEHPMSLDFLRMDIKNVNNYFERMSVDVFPERVI 300

Query: 286 FQFVISETLDKFRGDMRSAEDLRSYVAANLPRKQTAQDEAEDQVFRSLHLVRNLGGLEER 345
           FQFVISETLDKF GD  S+ DLR YV+ NLP K   QDEAED+VFRSLHLVRNLGGLEER
Sbjct: 301 FQFVISETLDKFSGDYTSSVDLRDYVSKNLPVKSGPQDEAEDEVFRSLHLVRNLGGLEER 360

Query: 346 DFDRFTDGKFDLLKSLIAQDNAKISNTFTASEQY 379
           DFDRFT GKFDLLKSLIA DN ++++TFTASEQ+
Sbjct: 361 DFDRFTLGKFDLLKSLIAHDNERVASTFTASEQF 394

>Skud_15.282 Chr15 complement(505219..506676) [1458 bp, 485 aa] {ON}
           YOR119C (REAL)
          Length = 485

 Score =  614 bits (1584), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/474 (64%), Positives = 364/474 (76%), Gaps = 26/474 (5%)

Query: 1   MDLEDQLRKLKLRD-DTDHDNTRILEKFANQIKTDELSLTKGKTNKDKANRATVENVLDP 59
           M LED+  +L +    +DH N ++LEK++++IKTDELS +K KT+KDKANRATVENVLDP
Sbjct: 1   MSLEDRFDRLTVSQRASDHINNQLLEKYSHKIKTDELSFSKAKTSKDKANRATVENVLDP 60

Query: 60  RTMRFLRALVNRGVLSEFNGCLSTGKEANVYHALSGATEGAPE----------------K 103
           RTMRFL+++VNRGV+++ NGCLSTGKEANVYHA +G T  AP                 +
Sbjct: 61  RTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAG-TGKAPVIDEETGQYEVLETDGLR 119

Query: 104 SEYAVKIYKTSILVFKDRERYVDGEFRFRNARSHHNPRKMIKIWAEKEFRNLKRIYQSGV 163
            EYA+KIYKTSILVFKDRERYVDGEFRFRN+RS HNPRKMIKIWAEKEFRNLKRI+QSGV
Sbjct: 120 KEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIHQSGV 179

Query: 164 IPCPQPVEIKSNVLVMEFLNRGDGFASPRLKDYPFKDRDEIYHYYHVMVSYIRLLYQVCQ 223
           IP P+PVE+K+NVLVMEFL+RG+GFASP+L+DYP++DR+EI+HYYH MV+Y+RLLYQVC+
Sbjct: 180 IPAPRPVEVKNNVLVMEFLSRGNGFASPKLRDYPYRDREEIFHYYHTMVAYMRLLYQVCR 239

Query: 224 LVHADLSEYNSIVHQSKLYIIDVSQSVQPEHPMSLDFLRMDIKNINMYFERMGIDIFPER 283
           LVHADLSEYN+I+H  KLY+IDVSQSV+PEHPMSLDFLRMDIKN+N+YFE+MG+ IFPER
Sbjct: 240 LVHADLSEYNTIIHNDKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGVSIFPER 299

Query: 284 VIFQFVISETLDKFRGDMRSAEDLRSYVAANLPRKQTAQDEAEDQVFRSLHLVRNLGGLE 343
           VIFQFVISE+L+KF+GD  +  DL  Y+A NLP K T QDEAED++FRSLHLVR+LGGLE
Sbjct: 300 VIFQFVISESLEKFKGDYHNVIDLVGYIAKNLPIKSTEQDEAEDEIFRSLHLVRSLGGLE 359

Query: 344 ERDFDRFTDGKFDLLKSLIAQDNAKISNTFTASEQYXXXXXXXXXXXXXXXXXXXXXXXX 403
           ERDFDR+TDGKFDLLKSLIA DN +    F ASEQ+                        
Sbjct: 360 ERDFDRYTDGKFDLLKSLIAHDNER---NFAASEQFEFDNADHESSSDLEESSDEEGDNS 416

Query: 404 XXXXXXXXXXXXXXXXXXXXYELRPKVLVGKKYEDKDAKKLRKSEAKENKRERR 457
                                   PK+L GKKYEDKD KKLRK EAK+ KRE+R
Sbjct: 417 SGGEEDEESDDREYYEDD-----EPKILKGKKYEDKDIKKLRKQEAKDAKREKR 465

>Smik_15.297 Chr15 complement(509934..511394) [1461 bp, 486 aa] {ON}
           YOR119C (REAL)
          Length = 486

 Score =  610 bits (1574), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/474 (63%), Positives = 360/474 (75%), Gaps = 25/474 (5%)

Query: 1   MDLEDQLRKLKLRD-DTDHDNTRILEKFANQIKTDELSLTKGKTNKDKANRATVENVLDP 59
           M LED   KL +    +DH N ++LEK++++IKTDELS  + KT+KDKANRATVENVLDP
Sbjct: 1   MSLEDNFDKLTVSQRASDHINNQLLEKYSHKIKTDELSFNRAKTSKDKANRATVENVLDP 60

Query: 60  RTMRFLRALVNRGVLSEFNGCLSTGKEANVYHALSGATEGAP----------------EK 103
           RTMRFL+++VNRGV+++ NGCLSTGKEANVYHA +G T  AP                 +
Sbjct: 61  RTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAG-TGKAPVIDEETGKYEVLETDGPR 119

Query: 104 SEYAVKIYKTSILVFKDRERYVDGEFRFRNARSHHNPRKMIKIWAEKEFRNLKRIYQSGV 163
            EYA+KIYKTSILVFKDRERYVDGEFRFRN+RS HNPRKMIKIWAEKEFRNLKRIYQSGV
Sbjct: 120 PEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGV 179

Query: 164 IPCPQPVEIKSNVLVMEFLNRGDGFASPRLKDYPFKDRDEIYHYYHVMVSYIRLLYQVCQ 223
           IP P+P+E+K+NVLVMEFL+RG+GFASP+LKDYP++DR EI+HYY+ MV+Y+RLLYQVC+
Sbjct: 180 IPAPKPIEVKNNVLVMEFLSRGNGFASPKLKDYPYRDRGEIFHYYYTMVAYMRLLYQVCR 239

Query: 224 LVHADLSEYNSIVHQSKLYIIDVSQSVQPEHPMSLDFLRMDIKNINMYFERMGIDIFPER 283
           LVHADLSEYN+I+H  KL++IDVSQSV+PEHPMSLDFLRMDIKN+N+YFE+MGI IFPER
Sbjct: 240 LVHADLSEYNTIIHDDKLFMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGISIFPER 299

Query: 284 VIFQFVISETLDKFRGDMRSAEDLRSYVAANLPRKQTAQDEAEDQVFRSLHLVRNLGGLE 343
           VIFQFVISE+L+KF+ D  +  DL  Y+A NLP K T QDEAED++FRSLHLVR+LGGLE
Sbjct: 300 VIFQFVISESLEKFKDDYHNVTDLVGYIAKNLPIKSTEQDEAEDEIFRSLHLVRSLGGLE 359

Query: 344 ERDFDRFTDGKFDLLKSLIAQDNAKISNTFTASEQYXXXXXXXXXXXXXXXXXXXXXXXX 403
           ERDFDR+TDGKFDLLKSLIA DN +    F ASEQ+                        
Sbjct: 360 ERDFDRYTDGKFDLLKSLIAHDNER---NFAASEQFEFDNADHTSGSGSEEFSDDEDDSS 416

Query: 404 XXXXXXXXXXXXXXXXXXXXYELRPKVLVGKKYEDKDAKKLRKSEAKENKRERR 457
                                   PK+L GK+YEDKD KKLRK EAK+ KRE+R
Sbjct: 417 ENDKEGNEESDDCAYYEDD----EPKILKGKRYEDKDVKKLRKQEAKDAKREKR 466

>Kpol_1062.31 s1062 (67759..69300) [1542 bp, 513 aa] {ON}
           (67759..69300) [1542 nt, 514 aa]
          Length = 513

 Score =  608 bits (1569), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/403 (72%), Positives = 329/403 (81%), Gaps = 46/403 (11%)

Query: 20  NTRILEKFANQIKTDELSLTKGKTNKDKANRATVENVLDPRTMRFLRALVNRGVLSEFNG 79
           NTRILEK+ ++IKTDELS TKGKTNKDKANRATVENVLDPRTMRFL+AL NRGV+S FNG
Sbjct: 18  NTRILEKYGHKIKTDELSFTKGKTNKDKANRATVENVLDPRTMRFLKALTNRGVISAFNG 77

Query: 80  CLSTGKEANVYHALSG-------------------------------------------A 96
           CLSTGKEANVYHA +G                                            
Sbjct: 78  CLSTGKEANVYHAFAGDGTSSRNTDVKVEDLVKLTSVEVNQDSEEDNGDNNNVADIDGSK 137

Query: 97  TEGAPEKSEYAVKIYKTSILVFKDRERYVDGEFRFRNARSHHNPRKMIKIWAEKEFRNLK 156
            EG   + EYA+KIYKTSILVFKDRERYVDGE+RFRN+RS HNPRKMIKIWAEKEFRNL+
Sbjct: 138 PEGVELRKEYAIKIYKTSILVFKDRERYVDGEYRFRNSRSQHNPRKMIKIWAEKEFRNLR 197

Query: 157 RIYQSGVIPCPQPVEIKSNVLVMEFLNRGDGFASPRLKDYPFKDRDEIYHYYHVMVSYIR 216
           RI+QSGVIP P+PVE+KSNVLVMEFLNRG+GFASPRLKDYP+KDRDEI+ YYH++V+Y+R
Sbjct: 198 RIHQSGVIPAPKPVEVKSNVLVMEFLNRGNGFASPRLKDYPYKDRDEIFWYYHILVAYMR 257

Query: 217 LLYQVCQLVHADLSEYNSIVHQSKLYIIDVSQSVQPEHPMSLDFLRMDIKNINMYFERMG 276
           LLYQVC+LVHADLSEYN+IVHQ KLY+IDVSQSV+PEHPMSLDFLRMDIKN+N YFE+MG
Sbjct: 258 LLYQVCRLVHADLSEYNTIVHQGKLYMIDVSQSVEPEHPMSLDFLRMDIKNVNGYFEKMG 317

Query: 277 IDIFPERVIFQFVISETLDKFRGDMRSAEDLRSYVAANLPRKQTAQDEAEDQVFRSLHLV 336
           IDIFPER+IFQFVISE L+ F+GD+ SA+DLR +V  NLP K T +DEAED+VFRSLHLV
Sbjct: 318 IDIFPERIIFQFVISEKLETFKGDLNSADDLREFVKNNLPIKSTDEDEAEDEVFRSLHLV 377

Query: 337 RNLGGLEERDFDRFTDGKFDLLKSLIAQDNAKISNTFTASEQY 379
           RNLGGLEERDFDRFTDGKFDLLK+LIA DN K    FTASEQY
Sbjct: 378 RNLGGLEERDFDRFTDGKFDLLKTLIASDNQK---NFTASEQY 417

>NCAS0F03360 Chr6 complement(679314..680843) [1530 bp, 509 aa] {ON}
           Anc_5.432 YOR119C
          Length = 509

 Score =  606 bits (1563), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/507 (60%), Positives = 364/507 (71%), Gaps = 68/507 (13%)

Query: 1   MDLEDQLRKLKLRDD--TDHDNTRILEKFANQIKTDELSLTKGKTNKDKANRATVENVLD 58
           M LED+  +L + ++  T+H N +IL+K+ ++ KTDE+S T+ KTNKDKANRATVENVLD
Sbjct: 1   MSLEDKFDRLNISNEPRTEHANNKILDKYEHKFKTDEMSFTRSKTNKDKANRATVENVLD 60

Query: 59  PRTMRFLRALVNRGVLSEFNGCLSTGKEANVYHALSG----------------------- 95
           PRTMRFL+AL +RGV+S+FNGCLSTGKEANVYHA +G                       
Sbjct: 61  PRTMRFLKALTSRGVISDFNGCLSTGKEANVYHAFAGDSKLHADVVLEAKEEEDEDEDEN 120

Query: 96  -----------------ATEGAPE--------KSEYAVKIYKTSILVFKDRERYVDGEFR 130
                             TE  PE        K EYAVKI+KTSILVFKDRERYVDGEFR
Sbjct: 121 EEDEDDLPIDHNLKEKLETELRPEMLTKVSQDKKEYAVKIFKTSILVFKDRERYVDGEFR 180

Query: 131 FRNARSHHNPRKMIKIWAEKEFRNLKRIYQSGVIPCPQPVEIKSNVLVMEFLNRGDGFAS 190
           FRN+RS HNPRKMIKIWAEKEFRNL+RIYQSGVIP P+P+E+K+NVLVMEFL RGDGFAS
Sbjct: 181 FRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSGVIPVPKPIEVKNNVLVMEFLGRGDGFAS 240

Query: 191 PRLKDYPFKDRDEIYHYYHVMVSYIRLLYQVCQLVHADLSEYNSIVHQSKLYIIDVSQSV 250
           PRLKD+P+KDR+EI+HYYH +V+Y+RL+YQ+C+LVHADLSEYN ++H+ K+YIIDVSQSV
Sbjct: 241 PRLKDHPYKDREEIFHYYHTIVAYMRLMYQICRLVHADLSEYNILIHKDKMYIIDVSQSV 300

Query: 251 QPEHPMSLDFLRMDIKNINMYFERMGIDIFPERVIFQFVISETLDKFRGDMRSAEDLRSY 310
           +PEHPMSLDFLRMDIKNIN YFE+MGIDIFPERVIFQF+IS+TL+ F GD R   DLR Y
Sbjct: 301 EPEHPMSLDFLRMDIKNINFYFEKMGIDIFPERVIFQFIISDTLENFNGDYRDYNDLRDY 360

Query: 311 VAANLPRKQTAQDEAEDQVFRSLHLVRNLGGLEERDFDRFTDGKFDLLKSLIAQDNAKIS 370
           VA NLP K++ QDEAED++FRSL+LVRNL GLEERDFDR+TDGKFDLLKSLIA DN K  
Sbjct: 361 VAQNLPIKKSEQDEAEDEIFRSLYLVRNLEGLEERDFDRYTDGKFDLLKSLIAHDNEK-- 418

Query: 371 NTFTASEQYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYELRPKV 430
             F+A+EQ+                                                 KV
Sbjct: 419 -NFSAAEQFDLKAQDATTDEEDEISEEDFDGEDDDDEGYESEE---------------KV 462

Query: 431 LVGKKYEDKDAKKLRKSEAKENKRERR 457
           L GK+YEDKDAKKLRK EAK+ KRE+R
Sbjct: 463 LKGKRYEDKDAKKLRKQEAKDAKREKR 489

>KAFR0E03920 Chr5 complement(775345..776838) [1494 bp, 497 aa] {ON}
           Anc_5.432 YOR119C
          Length = 497

 Score =  604 bits (1557), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/413 (69%), Positives = 338/413 (81%), Gaps = 37/413 (8%)

Query: 1   MDLEDQLRKLKL---RDDTDHDNTRILEKFANQIKTDELSLTKGKTNKDKANRATVENVL 57
           M +ED+   LK+   R  +DH N +IL+K+ ++IKT+E SL++GKTNKDKANRATVENVL
Sbjct: 1   MSIEDKFDNLKISGGRGSSDHINNQILDKYGHKIKTNEFSLSRGKTNKDKANRATVENVL 60

Query: 58  DPRTMRFLRALVNRGVLSEFNGCLSTGKEANVYHALSGATEGAPE--------------- 102
           DPRTM+FL+AL++RGV+S F+GCLSTGKEANVYHA +G    A +               
Sbjct: 61  DPRTMKFLQALMSRGVISSFDGCLSTGKEANVYHAFAGTGRPAGQVPTLVQEEMSVPVDP 120

Query: 103 ----------------KSEYAVKIYKTSILVFKDRERYVDGEFRFRNARSHHNPRKMIKI 146
                           + EYA+KIYKTSILVFKDRERYVDGEFRFRNARS HNPRKMIKI
Sbjct: 121 SELSAQEDKDENSTDRREEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQHNPRKMIKI 180

Query: 147 WAEKEFRNLKRIYQSGVIPCPQPVEIKSNVLVMEFLNRGDGFASPRLKDYPFKDRDEIYH 206
           WAEKEFRNLKRIYQS VIP P+P+EIK+NVLVMEFLNRGDGFASPRLKD+P+KDR+EI+H
Sbjct: 181 WAEKEFRNLKRIYQSEVIPAPKPIEIKNNVLVMEFLNRGDGFASPRLKDHPYKDREEIFH 240

Query: 207 YYHVMVSYIRLLYQVCQLVHADLSEYNSIVHQSKLYIIDVSQSVQPEHPMSLDFLRMDIK 266
           YYH +V+YIRLLYQVC LVHADLSEYN++VHQ +LY+IDVSQSV+PEHPMSLDFLRMDIK
Sbjct: 241 YYHTLVAYIRLLYQVCHLVHADLSEYNTLVHQGRLYVIDVSQSVEPEHPMSLDFLRMDIK 300

Query: 267 NINMYFERMGIDIFPERVIFQFVISETLDKFRGDMRSAEDLRSYVAANLPRKQTAQDEAE 326
           N+N YFE+MGIDIFPER+IFQFVISETLDKF GD +S++DLR YV  NLP K T QDEAE
Sbjct: 301 NVNFYFEKMGIDIFPERIIFQFVISETLDKFNGDYKSSDDLRDYVRQNLPIKATGQDEAE 360

Query: 327 DQVFRSLHLVRNLGGLEERDFDRFTDGKFDLLKSLIAQDNAKISNTFTASEQY 379
           D++FRSL+LVRNL GLEERDFDR+T+G+FDLLKSL+A DN K    F ASEQY
Sbjct: 361 DEIFRSLYLVRNLNGLEERDFDRYTEGRFDLLKSLLAHDNEK---NFAASEQY 410

>TBLA0A03760 Chr1 complement(938917..940431) [1515 bp, 504 aa] {ON}
           Anc_5.432 YOR119C
          Length = 504

 Score =  589 bits (1519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/408 (69%), Positives = 331/408 (81%), Gaps = 34/408 (8%)

Query: 1   MDLEDQLRKLKLRDDTDHDNTRILEKFANQIKTDELSLTKGKTNKDKANRATVENVLDPR 60
           M L+D  +KL L ++  HDN RIL+K  ++IKTDE S+++GKTNKDKANRATVENVLDPR
Sbjct: 1   MVLDDDFQKLDLSNN--HDNNRILDKHGHKIKTDEFSISRGKTNKDKANRATVENVLDPR 58

Query: 61  TMRFLRALVNRGVLSEFNGCLSTGKEANVYHALSGATEGAPE------------------ 102
           TMRFL+AL +RG++S+FNGC+STGKEANVYHA +G T    E                  
Sbjct: 59  TMRFLKALTSRGIISDFNGCISTGKEANVYHAFAGDTISPFEPKTHDSFENLVNTYDPYS 118

Query: 103 -----------KSEYAVKIYKTSILVFKDRERYVDGEFRFRNARSHHNPRKMIKIWAEKE 151
                      + EYA+KIYKTSILVFKDRERYVDGE+RFRN+RS HNPRKMIKIWAEKE
Sbjct: 119 NPNNNDTILEPRKEYAIKIYKTSILVFKDRERYVDGEYRFRNSRSQHNPRKMIKIWAEKE 178

Query: 152 FRNLKRIYQSGVIPCPQPVEIKSNVLVMEFLNRGDGFASPRLKDYPFKDRDEIYHYYHVM 211
           FRNLKRIYQS VIP P+P+E+K+NVLVMEFLNRGDGFASPRLKDYP+KD ++I HYYH M
Sbjct: 179 FRNLKRIYQSKVIPVPKPIEVKNNVLVMEFLNRGDGFASPRLKDYPYKDHNDIVHYYHTM 238

Query: 212 VSYIRLLYQVCQLVHADLSEYNSIVHQSKLYIIDVSQSVQPEHPMSLDFLRMDIKNINMY 271
           + YIRLLYQVC+LVHADLSEYN++VH++KLY+IDVSQSV+PEHPMSLDFLRMDIKNIN Y
Sbjct: 239 IVYIRLLYQVCRLVHADLSEYNTLVHKNKLYVIDVSQSVEPEHPMSLDFLRMDIKNINNY 298

Query: 272 FERMGIDIFPERVIFQFVISETLDKFRGDMRSAEDLRSYVAANLPRKQTAQDEAEDQVFR 331
           FERMG+ IF ER+IFQF ISETLD F G+  + +DLR YV  NLP K   +D+AED++FR
Sbjct: 299 FERMGVAIFAERIIFQFTISETLDNFNGNYSNEDDLRMYVKNNLPLKVPGKDDAEDEIFR 358

Query: 332 SLHLVRNLGGLEERDFDRFTDGKFDLLKSLIAQDNAKISNTFTASEQY 379
           SLHLVRNLGGLEERDFDR+TDGKFDLLKSLIA DN K    F+ASEQY
Sbjct: 359 SLHLVRNLGGLEERDFDRYTDGKFDLLKSLIAHDNEK---NFSASEQY 403

>TDEL0E01930 Chr5 (363913..365421) [1509 bp, 502 aa] {ON} Anc_5.432
           YOR119C
          Length = 502

 Score =  588 bits (1516), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/375 (75%), Positives = 323/375 (86%), Gaps = 7/375 (1%)

Query: 1   MDLEDQLRKLKLRDDTDHDNTRILEKFANQIKTDELSLTKGKTNKDKANRATVENVLDPR 60
           M LEDQ  +L +    +H N +IL+K +N IKTDELS T+ K++KDKANRATVENVLDPR
Sbjct: 1   MSLEDQFDRLDISHGREHANIQILDKHSNNIKTDELSFTRSKSSKDKANRATVENVLDPR 60

Query: 61  TMRFLRALVNRGVLSEFNGCLSTGKEANVYHALSGAT-----EG--APEKSEYAVKIYKT 113
           TMRFL++++NRGV+SEFNGCLSTGKEANVYHA +G +     +G    EK E A+KIYKT
Sbjct: 61  TMRFLKSMMNRGVISEFNGCLSTGKEANVYHAFAGESIEDSKDGHVQGEKKELAIKIYKT 120

Query: 114 SILVFKDRERYVDGEFRFRNARSHHNPRKMIKIWAEKEFRNLKRIYQSGVIPCPQPVEIK 173
           SILVFKDRERYVDGEFRFRN+RS HNPRKMIKIWAEKEFRNL+RI QSGVIP P+PVE+K
Sbjct: 121 SILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRINQSGVIPAPKPVEVK 180

Query: 174 SNVLVMEFLNRGDGFASPRLKDYPFKDRDEIYHYYHVMVSYIRLLYQVCQLVHADLSEYN 233
           +NVLVMEFL+RGDGFASPRLKD+ F DR EIYHYYH M++YIRLLYQVC+LVHADLSEYN
Sbjct: 181 NNVLVMEFLSRGDGFASPRLKDHLFADRAEIYHYYHTMLAYIRLLYQVCRLVHADLSEYN 240

Query: 234 SIVHQSKLYIIDVSQSVQPEHPMSLDFLRMDIKNINMYFERMGIDIFPERVIFQFVISET 293
           +IVH  KLYIIDVSQSV+PEHPMSLDFLRMDIKNIN YFE+MGIDIFPER+IFQFVISET
Sbjct: 241 AIVHDQKLYIIDVSQSVEPEHPMSLDFLRMDIKNINAYFEKMGIDIFPERLIFQFVISET 300

Query: 294 LDKFRGDMRSAEDLRSYVAANLPRKQTAQDEAEDQVFRSLHLVRNLGGLEERDFDRFTDG 353
           L+KF G+ +S+ DL +YV+  LP K T  D  ED++FRSLHLVRNL GLEERDFDRFTDG
Sbjct: 301 LEKFDGNPKSSADLSNYVSKALPVKSTTGDVEEDEIFRSLHLVRNLEGLEERDFDRFTDG 360

Query: 354 KFDLLKSLIAQDNAK 368
           KFDLLKSLIA DN +
Sbjct: 361 KFDLLKSLIAHDNER 375

>KNAG0C04930 Chr3 (951832..953322) [1491 bp, 496 aa] {ON} Anc_5.432
           YOR119C
          Length = 496

 Score =  585 bits (1507), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/488 (61%), Positives = 355/488 (72%), Gaps = 43/488 (8%)

Query: 1   MDLEDQLRKLKL----RDDTDHDNTRILEKFANQIKTDELSLTK-GKTNKDKANRATVEN 55
           M +E++  KL +    +DDT   N ++L+K+A++IK D+ S +K  KT KDKANRATVEN
Sbjct: 1   MSVEEKFEKLSIDHHVKDDTA--NNKLLDKYAHKIKNDQFSFSKVKKTTKDKANRATVEN 58

Query: 56  VLDPRTMRFLRALVNRGVLSEFNGCLSTGKEANVYHALSG-----ATEGAPE-------- 102
           VLDPRTMRFL+AL+NRG++S+FNGCLSTGKEANVYHA +G     A+   P+        
Sbjct: 59  VLDPRTMRFLQALMNRGIISDFNGCLSTGKEANVYHAFAGDGVSRASGTLPDEESLLARL 118

Query: 103 -------------KSEYAVKIYKTSILVFKDRERYVDGEFRFRNARSHHNPRKMIKIWAE 149
                        K EYA+KI+KTSILVFKDRERYVDGEFRFRN+RS HNPRKMIKIWAE
Sbjct: 119 TQEERAVQASVGGKKEYAIKIFKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAE 178

Query: 150 KEFRNLKRIYQSGVIPCPQPVEIKSNVLVMEFLNRGDGFASPRLKDYPFKDRDEIYHYYH 209
           KEFRNLKRIYQSG +P P+PVE+K+NVLVMEFLNRGDGFASPRL+DYP+KD D I  YY 
Sbjct: 179 KEFRNLKRIYQSGAVPVPKPVEVKNNVLVMEFLNRGDGFASPRLRDYPYKDTDSIRQYYC 238

Query: 210 VMVSYIRLLYQVCQLVHADLSEYNSIVHQSKLYIIDVSQSVQPEHPMSLDFLRMDIKNIN 269
            +V+Y+RL+YQVC LVHADLSEYN +VH  +LYIIDVSQSVQPEHPMSLDFLRMDIKN+N
Sbjct: 239 TLVAYMRLMYQVCGLVHADLSEYNVLVHNDRLYIIDVSQSVQPEHPMSLDFLRMDIKNVN 298

Query: 270 MYFERMGIDIFPERVIFQFVISETLDKFRGDMRSAEDLRSYVAANLPRKQTAQDEAEDQV 329
           +YF +MGIDIFPER+IFQFVISE+LDKF GD +S++DL  YV +NLP K+T QDE ED+V
Sbjct: 299 LYFGKMGIDIFPERIIFQFVISESLDKFEGDYKSSKDLTEYVESNLPVKKTEQDEMEDEV 358

Query: 330 FRSLHLVRNLGGLEERDFDRFTDGKFDLLKSLIAQDNAKISNTFTASEQYXXXXXXXXXX 389
           FRSL+LVRNL GLEERDFDRFT+GKFDLLKSL+A D  K  N   A +Q+          
Sbjct: 359 FRSLYLVRNLEGLEERDFDRFTEGKFDLLKSLLAHDMEK--NFTAAEQQFEFDDENDSSS 416

Query: 390 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYELRPKVLVGKKYEDKDAKKLRKSEA 449
                                                  KVL GKKYEDKDAKKLRK EA
Sbjct: 417 GSQDDDGEDEDEEESDGEDEEDVYYTTDD--------EDKVLKGKKYEDKDAKKLRKQEA 468

Query: 450 KENKRERR 457
           K+ KRE+R
Sbjct: 469 KDAKREKR 476

>TPHA0E01780 Chr5 (357819..359345) [1527 bp, 508 aa] {ON} Anc_5.432
           YOR119C
          Length = 508

 Score =  577 bits (1487), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/418 (68%), Positives = 331/418 (79%), Gaps = 43/418 (10%)

Query: 1   MDLEDQLRKLKLRDDTDHDNTRILEKFANQIKTDELSLTKGKTNKDKANRATVENVLDPR 60
           M LE +  KLK+ + ++H N++ILEK+ ++IKTDELS TKGKTNKDKANRATVENVLDPR
Sbjct: 1   MSLEGKFDKLKVHE-SEHINSKILEKYGHKIKTDELSDTKGKTNKDKANRATVENVLDPR 59

Query: 61  TMRFLRALVNRGVLSEFNGCLSTGKEANVYHALSG------ATEGAPEKSE--------- 105
           TM+ L+ L+NRGV+ EFNGCLSTGKEANVYHA +G        E  P+ SE         
Sbjct: 60  TMKSLKTLINRGVIFEFNGCLSTGKEANVYHAFAGDGKVKGNAEVLPQISELEDVLNKEL 119

Query: 106 ------------------------YAVKIYKTSILVFKDRERYVDGEFRFRNARSHHNPR 141
                                   YA+KIYKTSILVFKDRERYVDGEFRFRNARS HNPR
Sbjct: 120 IPGQIEVPTIKSEEEQTQLKQRKEYAIKIYKTSILVFKDRERYVDGEFRFRNARSQHNPR 179

Query: 142 KMIKIWAEKEFRNLKRIYQSGVIPCPQPVEIKSNVLVMEFLNRGDGFASPRLKDYPFKDR 201
           KMIKIWAEKEFRNL+RI+QSG+IP P+PVE+K N+LVMEFL RGDGFASPRL+D+ +K R
Sbjct: 180 KMIKIWAEKEFRNLRRIFQSGIIPAPEPVEVKYNILVMEFLGRGDGFASPRLRDHQYKTR 239

Query: 202 DEIYHYYHVMVSYIRLLYQVCQLVHADLSEYNSIVHQSKLYIIDVSQSVQPEHPMSLDFL 261
           +EI +YYH +V+YIRLLYQVC+LVHADLSEYN+IVH  KLY+IDVSQSV+PEHPMSLDFL
Sbjct: 240 EEIIYYYHTLVAYIRLLYQVCRLVHADLSEYNTIVHDDKLYVIDVSQSVEPEHPMSLDFL 299

Query: 262 RMDIKNINMYFERMGIDIFPERVIFQFVISETLDKFRGDMRSAEDLRSYVAANLPRKQTA 321
           RMDIKN+N YFE+MGIDIFPER+IFQFVIS  LDKF GD RS+ DLR+Y+A  LP K T 
Sbjct: 300 RMDIKNVNGYFEKMGIDIFPERIIFQFVISSELDKFTGDPRSSVDLRNYIAHYLPVKCTD 359

Query: 322 QDEAEDQVFRSLHLVRNLGGLEERDFDRFTDGKFDLLKSLIAQDNAKISNTFTASEQY 379
           +DE +D++FRSLHLVRNL GLEERDFDRFTDGKFDLLK+LIA DN K    FTAS Q+
Sbjct: 360 EDELKDEIFRSLHLVRNLDGLEERDFDRFTDGKFDLLKTLIASDNQK---NFTASTQF 414

>NDAI0B05650 Chr2 complement(1380239..1381627) [1389 bp, 462 aa]
           {ON} Anc_5.432 YOR119C
          Length = 462

 Score =  567 bits (1461), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/378 (71%), Positives = 312/378 (82%), Gaps = 37/378 (9%)

Query: 36  LSLTKGKTNKDKANRATVENVLDPRTMRFLRALVNRGVLSEFNGCLSTGKEANVYHALSG 95
           +S TKGKTNKDKANRATVENVLDPRTM+FL+AL +RGV+S+FNGCLSTGKEANVYHA +G
Sbjct: 1   MSFTKGKTNKDKANRATVENVLDPRTMKFLKALTSRGVISDFNGCLSTGKEANVYHAFAG 60

Query: 96  ---------------------------ATEGAPE-------KSEYAVKIYKTSILVFKDR 121
                                       T+  PE       K EYAVKI+KTSILVFKDR
Sbjct: 61  DSKLHSDDTDEPHDDNNIDEEALKEKLETQINPEETRLQKDKKEYAVKIFKTSILVFKDR 120

Query: 122 ERYVDGEFRFRNARSHHNPRKMIKIWAEKEFRNLKRIYQSGVIPCPQPVEIKSNVLVMEF 181
           ERYVDGEFRFRN+RS HNPRKMIKIWAEKEFRNL+RIYQS VIP P+P+E+K+NVL+MEF
Sbjct: 121 ERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSNVIPVPKPIEVKNNVLIMEF 180

Query: 182 LNRGDGFASPRLKDYPFKDRDEIYHYYHVMVSYIRLLYQVCQLVHADLSEYNSIVHQSKL 241
           LNRGDGFASPRL+DYP+KDR+E+ HYYH+ ++Y+RL+YQVC+LVHADLSEYN ++H + +
Sbjct: 181 LNRGDGFASPRLRDYPYKDREEVIHYYHIAIAYMRLMYQVCRLVHADLSEYNILIHNNLM 240

Query: 242 YIIDVSQSVQPEHPMSLDFLRMDIKNINMYFERMGIDIFPERVIFQFVISETLDKFRGDM 301
           YIIDVSQSV+PEHPMSLDFLRMDIKNINMYF+RMGIDIFPERVIFQF+ISETLDKF G+ 
Sbjct: 241 YIIDVSQSVEPEHPMSLDFLRMDIKNINMYFDRMGIDIFPERVIFQFIISETLDKFTGNY 300

Query: 302 RSAEDLRSYVAANLPRKQTAQDEAEDQVFRSLHLVRNLGGLEERDFDRFTDGKFDLLKSL 361
               DLR YVA  LP K+TAQDEAED++FRSL+LVRNL GLEERDFDR+TDGKFDLLKSL
Sbjct: 301 NDYNDLRDYVAKTLPIKKTAQDEAEDEIFRSLYLVRNLEGLEERDFDRYTDGKFDLLKSL 360

Query: 362 IAQDNAKISNTFTASEQY 379
           IA DN K    F+A+EQ+
Sbjct: 361 IAHDNEK---NFSAAEQF 375

>ZYRO0F09988g Chr6 complement(811306..812688) [1383 bp, 460 aa] {ON}
           similar to uniprot|Q12196 YOR119C Saccharomyces
           cerevisiae RIO1 Essential protein that plays a role in
           cell cycle progression
          Length = 460

 Score =  524 bits (1350), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 252/369 (68%), Positives = 301/369 (81%), Gaps = 9/369 (2%)

Query: 1   MDLEDQLRKLKLRDDTDHDNTRILEKFANQIKTDELSLTKG-KTNKDKANRATVENVLDP 59
           M LE +  +L +      DNTRILEK+ N+I+    +  KG KT KDK++RATVENVLDP
Sbjct: 1   MSLETEFDRLHV--SKHQDNTRILEKYENRIENGGFTSGKGNKTYKDKSDRATVENVLDP 58

Query: 60  RTMRFLRALVNRGVLSEFNGCLSTGKEANVYHALSGATEGAPEKSEYAVKIYKTSILVFK 119
           RTM+FL AL NRGV+SEFNGC+S+GKEANVYHA        PE  E A+KIYKTSILVFK
Sbjct: 59  RTMKFLSALTNRGVISEFNGCISSGKEANVYHAF------GPEGQELAIKIYKTSILVFK 112

Query: 120 DRERYVDGEFRFRNARSHHNPRKMIKIWAEKEFRNLKRIYQSGVIPCPQPVEIKSNVLVM 179
           DRERYVDGEFRFRN+RS HNPRKMIKIWAEKEFRNL+RI+ SGV+P   PVE+KSNVLVM
Sbjct: 113 DRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIHSSGVVPTACPVEVKSNVLVM 172

Query: 180 EFLNRGDGFASPRLKDYPFKDRDEIYHYYHVMVSYIRLLYQVCQLVHADLSEYNSIVHQS 239
           +FLNRGDG  SPRLKDY +KD  E+ HYY+  ++Y+RLLYQVC+LVHADLSEYN +VHQ+
Sbjct: 173 QFLNRGDGAPSPRLKDYQYKDELEVAHYYYKAIAYMRLLYQVCRLVHADLSEYNIVVHQN 232

Query: 240 KLYIIDVSQSVQPEHPMSLDFLRMDIKNINMYFERMGIDIFPERVIFQFVISETLDKFRG 299
            L+IIDVSQSV+P HPMSLDFLRMDIKNIN YF +MG+ +F ER+IFQF+I+ETL+ F+G
Sbjct: 233 ALHIIDVSQSVEPYHPMSLDFLRMDIKNINAYFGKMGVSLFQERMIFQFIIAETLEGFQG 292

Query: 300 DMRSAEDLRSYVAANLPRKQTAQDEAEDQVFRSLHLVRNLGGLEERDFDRFTDGKFDLLK 359
           D ++A+DL  Y+  +LP K   +   ED++FRSLHLVR+LGGLEERDFDRFTDGKFDLLK
Sbjct: 293 DYKTADDLVEYLVEHLPLKTPTEGADEDEIFRSLHLVRSLGGLEERDFDRFTDGKFDLLK 352

Query: 360 SLIAQDNAK 368
           SLIA DN +
Sbjct: 353 SLIANDNER 361

>CAGL0H08019g Chr8 (781773..783050) [1278 bp, 425 aa] {ON} highly
           similar to uniprot|P40160 Saccharomyces cerevisiae
           YNL207w
          Length = 425

 Score = 59.3 bits (142), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 51/219 (23%), Positives = 97/219 (44%), Gaps = 28/219 (12%)

Query: 65  LRALVNRGVLSEFNGCLSTGKEANVYHALSGATEGAPEKSEYAVKIYKTSILVFKDRERY 124
           LR L+N+ V+      +  GKE+++Y     +      K     ++ +TS    K+   Y
Sbjct: 85  LRTLLNQEVVYSVGNTIGVGKESDIYQV---SDRNGTAKVMKIHRLGRTSFHTVKNNRDY 141

Query: 125 VDGEFRFRNARSHHNPRKMIKIWAEKEFRNLKRIYQSGVIPCPQPVEIKSNVLVMEFLNR 184
           +      RN+R   N   + K+ A KEF  +  +Y  G I  PQ      +V+VM+ +  
Sbjct: 142 L------RNSRQGTNWMHLSKLAASKEFEFMSMLYAKGFI-VPQAYGCSRHVVVMDLI-- 192

Query: 185 GDGFASPRLKDYPFKDRDEIYHYYHVMVSYIRLLYQVCQLVHADLSEYNSIVHQSK---- 240
            DG+   RL+++       I   Y  ++++I  L     L+H D +E+N ++   +    
Sbjct: 193 -DGYPMRRLREHK-----NIPKLYSDLMTFIVKLAN-SGLIHCDFNEFNIMIKNDEAVTD 245

Query: 241 -----LYIIDVSQSVQPEHPMSLDFLRMDIKNINMYFER 274
                  +ID  Q +  +H  +  + + D+  I  +F++
Sbjct: 246 EKDCGFVVIDFPQCISIQHKDAEFYFKRDVDCIRRFFKK 284

>NCAS0G01580 Chr7 (281438..282712) [1275 bp, 424 aa] {ON} Anc_2.44
          Length = 424

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 48/220 (21%), Positives = 100/220 (45%), Gaps = 32/220 (14%)

Query: 65  LRALVNRGVLSEFNGCLSTGKEANVYHALSGATEGAPEKSEYAVKIY---KTSILVFKDR 121
           L+ ++NR  +    G +  GKE+++Y     A +G P      +KI+   +TS    ++ 
Sbjct: 85  LKTMLNRNTIYSIGGSIGVGKESDIYQV--SAVDGNPR----VMKIHRLGRTSFHTVRNN 138

Query: 122 ERYVDGEFRFRNARSHHNPRKMIKIWAEKEFRNLKRIYQSGVIPCPQPVEIKSNVLVMEF 181
             Y+      RN +   N   + ++ A KE++ +  +Y  G    P+P +   +++VME 
Sbjct: 139 RDYL------RNTKQGVNWMYLSRLAANKEYQFMSMLYTKG-FEVPEPFDNSRHIIVMEL 191

Query: 182 LNRGDGFASPRLKDYPFKDRDEIYHYYHVMVSYIRLLYQVCQLVHADLSEYNSIV----- 236
           +    G+   RL+ +       I   Y  ++++I  L     L+H D +E+N ++     
Sbjct: 192 IK---GYPMRRLRKHK-----NIPKLYSDLMNFIVKLGN-SGLIHCDFNEFNIMIKDKPE 242

Query: 237 --HQSKLYIIDVSQSVQPEHPMSLDFLRMDIKNINMYFER 274
             +     +ID  Q +  +H  +  + + D+  I  +F++
Sbjct: 243 DENDCGFVVIDFPQCISIQHQDAAYYFQRDVDCIRRFFKK 282

>TPHA0H00920 Chr8 complement(188834..190123) [1290 bp, 429 aa] {ON}
           Anc_2.44 YNL207W
          Length = 429

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 46/217 (21%), Positives = 99/217 (45%), Gaps = 26/217 (11%)

Query: 65  LRALVNRGVLSEFNGCLSTGKEANVYHALSGATEGAPEKSEYAVKIYKTSILVFKDRERY 124
           L++L+N+  +    G +  GKE+++Y    G+ +   ++     ++ +TS    K+   Y
Sbjct: 85  LKSLLNKDTVYSIGGTIGVGKESDIYE---GSDKNGNKRVLKIHRLGRTSFHTVKNNRDY 141

Query: 125 VDGEFRFRNARSHHNPRKMIKIWAEKEFRNLKRIYQSGVIPCPQPVEIKSNVLVMEFLNR 184
           +      R +    N   + K+ A KE++ +  +Y  G    P+P +   +V+VME +  
Sbjct: 142 L------RRSNQGTNWMNLSKLAANKEYQFMSLLYTKG-FKVPEPFDNSRHVIVMELIR- 193

Query: 185 GDGFASPRLKDYPFKDRDEIYHYYHVMVSYIRLLYQVCQLVHADLSEYNSIV-------H 237
             G+   RL+ +      +I   Y  ++ +I  L     L+H D +E+N ++       +
Sbjct: 194 --GYPMRRLRKHK-----DIPKLYSDLMKFILQLAN-SGLIHCDFNEFNIMIKDEVEDEN 245

Query: 238 QSKLYIIDVSQSVQPEHPMSLDFLRMDIKNINMYFER 274
                +ID  Q +  +H  +  + + D+  I  +F++
Sbjct: 246 DCGFVVIDFPQCISIQHKDADFYFKRDVDGIRRFFKK 282

>KAFR0A07760 Chr1 complement(1560351..1561628) [1278 bp, 425 aa]
           {ON} Anc_2.44 YNL207W
          Length = 425

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 47/217 (21%), Positives = 98/217 (45%), Gaps = 25/217 (11%)

Query: 65  LRALVNRGVLSEFNGCLSTGKEANVYHALSGATEGAPEKSEYAVKIYKTSILVFKDRERY 124
           L+ ++NR  +    G +  GKE+++Y     +     EK     ++ +TS    K++  Y
Sbjct: 85  LKTMLNRETVYSVGGTIGVGKESDIYRV---SDRNGTEKVMKIHRLGRTSFHTVKNKRDY 141

Query: 125 VDGEFRFRNARSHHNPRKMIKIWAEKEFRNLKRIYQSGVIPCPQPVEIKSNVLVMEFLNR 184
           +      +NA++  N   + KI A KE++ +  ++  G    P+  +   + +VME +  
Sbjct: 142 IK-----KNAKNGVNWMYLSKIAAGKEYQFMTLLFAKG-FDVPEAFDCSRHCIVMELIK- 194

Query: 185 GDGFASPRLKDYPFKDRDEIYHYYHVMVSYIRLLYQVCQLVHADLSEYNSIV-------H 237
             G+   RL+ +       I   Y  ++S+I  L     L+H D +E+N ++       +
Sbjct: 195 --GYPMRRLRKHK-----NIPKLYSDLMSFIVKLGN-SGLIHCDFNEFNIMIKDKVEDEN 246

Query: 238 QSKLYIIDVSQSVQPEHPMSLDFLRMDIKNINMYFER 274
                +ID  Q +  +H  +  + + D+  I  +F++
Sbjct: 247 DPGFVVIDFPQCISIQHNDAEFYFKRDVDCIRRFFKK 283

>NDAI0F03600 Chr6 complement(860282..861547) [1266 bp, 421 aa] {ON}
           Anc_2.44 YNL207W
          Length = 421

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 42/217 (19%), Positives = 100/217 (46%), Gaps = 25/217 (11%)

Query: 65  LRALVNRGVLSEFNGCLSTGKEANVYHALSGATEGAPEKSEYAVKIYKTSILVFKDRERY 124
           L+ ++NR  +    G +  GKE+++Y     + +    K     ++ +TS    ++   Y
Sbjct: 85  LKTMLNRDTVYSIGGSIGVGKESDIYQV---SDKNGVSKVMKIHRLGRTSFHTVRNNRDY 141

Query: 125 VDGEFRFRNARSHHNPRKMIKIWAEKEFRNLKRIYQSGVIPCPQPVEIKSNVLVMEFLNR 184
           +      +N ++  N   + ++ A KE++ +  +Y  G    P+P +   ++++M  +  
Sbjct: 142 LK-----KNVKNGVNWMYLSQLAANKEYQFMSMLYTKG-FEVPEPFDNSRHIIIMGLI-- 193

Query: 185 GDGFASPRLKDYPFKDRDEIYHYYHVMVSYIRLLYQVCQLVHADLSEYNSIV-------H 237
            +G+   RL+ +     + I   Y+ ++ +I  L     L+H D +E+N ++       +
Sbjct: 194 -EGYPMRRLRKH-----NNIPKLYNDLMKFIVRLAN-SGLIHCDFNEFNIMIKDEVEDEN 246

Query: 238 QSKLYIIDVSQSVQPEHPMSLDFLRMDIKNINMYFER 274
                +ID  Q +  +HP +  + + D+  I  +F++
Sbjct: 247 DCGFVVIDFPQCISIQHPDAEFYFQRDVDCIRRFFKK 283

>Suva_14.136 Chr14 (250349..251629) [1281 bp, 426 aa] {ON} YNL207W
           (REAL)
          Length = 426

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 48/220 (21%), Positives = 97/220 (44%), Gaps = 32/220 (14%)

Query: 65  LRALVNRGVLSEFNGCLSTGKEANVYHALSGATEGAPEKSEYAVKIY---KTSILVFKDR 121
           L+ ++NR  +      +  GKE+++Y       +G P      +KI+   +TS    ++ 
Sbjct: 85  LKTMLNRDTVYSVGNTIGVGKESDIYKV--SDKDGNPR----VIKIHRLGRTSFHTVRNN 138

Query: 122 ERYVDGEFRFRNARSHHNPRKMIKIWAEKEFRNLKRIYQSGVIPCPQPVEIKSNVLVMEF 181
             Y+      R +    N   + ++ A KE++ +  +Y  G    P+P +   +++VME 
Sbjct: 139 RDYL------RKSSQGANWMHLSRLAANKEYQFMSMLYSKG-FKVPEPFDNSRHIVVMEL 191

Query: 182 LNRGDGFASPRLKDYPFKDRDEIYHYYHVMVSYIRLLYQVCQLVHADLSEYNSIV----- 236
           +N   GF   RL+ +       I   Y  ++ +I  L     L+H D +E+N ++     
Sbjct: 192 IN---GFPMRRLRKHK-----NIPKLYSDLMCFIVQLGN-SGLIHCDFNEFNVMIKDELE 242

Query: 237 --HQSKLYIIDVSQSVQPEHPMSLDFLRMDIKNINMYFER 274
             +     +ID  Q V  +H  +  + + D+  I  +F++
Sbjct: 243 DENDCGFVVIDFPQCVSIQHQDADYYFQRDVDCIRRFFKK 282

>Kwal_23.4563 s23 (768125..769402) [1278 bp, 425 aa] {ON} YNL207W
           (RIO2) -  [contig 4] FULL
          Length = 425

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 47/224 (20%), Positives = 100/224 (44%), Gaps = 41/224 (18%)

Query: 65  LRALVNRGVLSEFNGCLSTGKEANVYHALSGATEGAPEKSEYAVKIY---KTSILVFKDR 121
           L+A++NR  +      +  GKE++VY     A +G P      +KI+   +TS    K+ 
Sbjct: 85  LKAMLNRDTVYSIGNVIGVGKESDVYRV--SAKDGTPR----VLKIHRLGRTSFTTVKNN 138

Query: 122 ERYV----DGEFRFRNARSHHNPRKMIKIWAEKEFRNLKRIYQSGVIPCPQPVEIKSNVL 177
             Y+     G + F           + ++ A KE++ +  +Y  G +  P+P +   +++
Sbjct: 139 RDYLKRNQSGSWMF-----------LSRLAANKEYQFMSLLYSKGFV-VPEPFDNSRHMI 186

Query: 178 VMEFLNRGDGFASPRLKDYPFKDRDEIYHYYHVMVSYIRLLYQVCQLVHADLSEYNSIVH 237
           +M+ +   DG+   R++ +       +   Y  ++S+I  L     L+H D +E+N ++ 
Sbjct: 187 LMQLI---DGYPMRRMRSHK-----NLPKLYSDLMSFIVKLAN-HGLIHCDFNEFNIMIK 237

Query: 238 Q-------SKLYIIDVSQSVQPEHPMSLDFLRMDIKNINMYFER 274
                       +ID  Q +  +H  + ++ + D+  I  +F +
Sbjct: 238 NKVTDADDCGFIVIDFPQCISIQHQDAEEYFKRDVDCIRRFFAK 281

>TDEL0A00860 Chr1 (143723..144982) [1260 bp, 419 aa] {ON} Anc_2.44
           YNL207W
          Length = 419

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 46/217 (21%), Positives = 99/217 (45%), Gaps = 26/217 (11%)

Query: 65  LRALVNRGVLSEFNGCLSTGKEANVYHALSGATEGAPEKSEYAVKIYKTSILVFKDRERY 124
           +++++NR  +  F   +  GKE+++Y     + +    K     ++ +TS    K+   Y
Sbjct: 85  VKSMLNRDTVYSFGNTIGVGKESDIYQV---SDKNGVAKVMKIHRLGRTSFHTVKNNRDY 141

Query: 125 VDGEFRFRNARSHHNPRKMIKIWAEKEFRNLKRIYQSGVIPCPQPVEIKSNVLVMEFLNR 184
           +      +NA    N   +  + A+KE++ +  +Y  G I  PQP +   ++++ME +  
Sbjct: 142 LK-----KNAHG-TNWMHLSLLAAQKEYQFMSLLYSKGFI-VPQPYDNSRHIVLMELI-- 192

Query: 185 GDGFASPRLKDYPFKDRDEIYHYYHVMVSYIRLLYQVCQLVHADLSEYNSIVHQS----- 239
            DGF    L+++       I   Y  ++++   L     L+H D +E+N ++  +     
Sbjct: 193 -DGFPMRNLRNHS-----NIPKLYSDLMTFAVKLAN-SGLIHCDFNEFNIMIKNTVEDSK 245

Query: 240 --KLYIIDVSQSVQPEHPMSLDFLRMDIKNINMYFER 274
                +ID  Q +  +H  +  + + DI+ I  +F +
Sbjct: 246 DCGFVVIDFPQCISIQHKDADFYFQRDIECIRRFFRK 282

>Ecym_6449 Chr6 complement(873295..874548) [1254 bp, 417 aa] {ON}
           similar to Ashbya gossypii ABL166W
          Length = 417

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 45/219 (20%), Positives = 101/219 (46%), Gaps = 31/219 (14%)

Query: 65  LRALVNRGVLSEFNGCLSTGKEANVYHALSGATEGAPEKSEYAVKIYKTSILVFKDRERY 124
           L++L+N+  L      +  GKE+++Y   +  +E    K     ++ +TS    K+   Y
Sbjct: 85  LKSLLNKNALYSVGNTIGVGKESDIYQVSTSTSEALVMKIH---RLGRTSFHTVKNNRDY 141

Query: 125 VDGEFRFRNARSHHNPRKMIKIWAEKEFRNLKRIYQSGVIPCPQPVEIKSNVLVMEFLNR 184
           +    R ++A   H    +  + A KE++ +  +Y  G    P+P +   ++++ME++  
Sbjct: 142 LK---RGQSASWMH----LSSLAANKEYQFMNLLYSKG-FKVPRPYDNSRHIILMEYIK- 192

Query: 185 GDGFASPRLKDYPFKDRDEIYHYYHVMVSYIRLLYQVCQ--LVHADLSEYNSIVHQSK-- 240
             G+   RL+++  KD   +Y         ++ + Q+    L+H D +E+N ++      
Sbjct: 193 --GYPMRRLREH--KDLPRLYS------ELMKFIVQLGNHGLIHCDFNEFNIMIKDKTDG 242

Query: 241 -----LYIIDVSQSVQPEHPMSLDFLRMDIKNINMYFER 274
                  +ID  Q +  +H  +  + + D++ I  +F++
Sbjct: 243 PDDLGFIVIDFPQCISIQHKDAEYYFQRDVECIRRFFKK 281

>KNAG0F01060 Chr6 (188811..190097) [1287 bp, 428 aa] {ON} Anc_2.44
           YNL207W
          Length = 428

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 43/219 (19%), Positives = 99/219 (45%), Gaps = 27/219 (12%)

Query: 65  LRALVNRGVLSEFNGCLSTGKEANVYHALSGATEGAPEKSEYAVKIYKTSILVFKDRERY 124
           L+ ++NR  L      +  GKE+++Y     + +   EK     ++ +TS    ++   Y
Sbjct: 85  LKTMLNRDSLYSVGNTIGVGKESDIYKV---SDKNGVEKVMKIHRLGRTSFHTVRNNRDY 141

Query: 125 VDGEFRFRNARSHHNPRKMIKIWAEKEFRNLKRIYQSGVIPCPQPVEIKSNVLVMEFLNR 184
           +      +N+++  N   + K+ A KE++ +  ++  G    P+P +   ++++ME +  
Sbjct: 142 LR-----KNSKNGANWMFLSKLAAAKEYQFMSLLHSRG-FRVPEPFDHSRHIIIMELIK- 194

Query: 185 GDGFASPRLKDYPFKDRDEIYHYYHVMVSYIRLLYQVCQLVHADLSEYNSIV-------- 236
             GF   RL+ +       +   Y  ++ +I  L     L+H D +E+N ++        
Sbjct: 195 --GFPMTRLRKHQ-----NVPKLYSDLMKFILELGN-SGLIHCDFNEFNIMIKDKLDGSD 246

Query: 237 -HQSKLYIIDVSQSVQPEHPMSLDFLRMDIKNINMYFER 274
            + +   +ID  Q +  +H  +  + + D+  I  +F++
Sbjct: 247 PNDTGFIVIDFPQCISIQHQDASFYFQRDVDCIRRFFKK 285

>Smik_14.125 Chr14 (234660..235922) [1263 bp, 420 aa] {ON} YNL207W
           (REAL)
          Length = 420

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 47/220 (21%), Positives = 96/220 (43%), Gaps = 32/220 (14%)

Query: 65  LRALVNRGVLSEFNGCLSTGKEANVYHALSGATEGAPEKSEYAVKIY---KTSILVFKDR 121
           L+ ++NR  +      +  GKE+++Y        G P      +KI+   +TS    ++ 
Sbjct: 85  LKTMLNRDTVYSVGNTIGVGKESDIYKV--SDKNGKPR----VMKIHRLGRTSFHSVRNN 138

Query: 122 ERYVDGEFRFRNARSHHNPRKMIKIWAEKEFRNLKRIYQSGVIPCPQPVEIKSNVLVMEF 181
             Y+      RN+    N   + ++ A KE++ +  +Y  G    P+P +   +++VME 
Sbjct: 139 RDYL------RNSNQGANWMHLSRLAANKEYQFMSMLYSKG-FKVPEPFDNSRHIVVMEL 191

Query: 182 LNRGDGFASPRLKDYPFKDRDEIYHYYHVMVSYIRLLYQVCQLVHADLSEYNSIVHQ--- 238
           +   +G+   RL+ +       I   Y  ++ +I  L     L+H D +E+N ++     
Sbjct: 192 I---EGYPMRRLRKHK-----NIPKLYSDLMCFIVELAN-SGLIHCDFNEFNIMIKNEVE 242

Query: 239 ----SKLYIIDVSQSVQPEHPMSLDFLRMDIKNINMYFER 274
                   +ID  Q V  +H  +  + + D+  I  +F++
Sbjct: 243 DEKDCGFVVIDFPQCVSIQHQDADYYFQRDVDCIRRFFKK 282

>Skud_14.129 Chr14 (244224..245501) [1278 bp, 425 aa] {ON} YNL207W
           (REAL)
          Length = 425

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/220 (20%), Positives = 96/220 (43%), Gaps = 32/220 (14%)

Query: 65  LRALVNRGVLSEFNGCLSTGKEANVYHALSGATEGAPEKSEYAVKIY---KTSILVFKDR 121
           L+ ++NR  +      +  GKE+++Y        G P      +KI+   +TS    ++ 
Sbjct: 85  LKTMLNRNTVYSVGNTIGVGKESDIYKV--SDKNGNPR----VMKIHRLGRTSFHSVRNN 138

Query: 122 ERYVDGEFRFRNARSHHNPRKMIKIWAEKEFRNLKRIYQSGVIPCPQPVEIKSNVLVMEF 181
             Y+      +N+    N   + ++ A KE++ +  +Y  G    P+P +   +++VME 
Sbjct: 139 RDYL------KNSNQGANWMHLSRLAANKEYQFMSMLYSKG-FKVPEPFDNSRHIVVMEL 191

Query: 182 LNRGDGFASPRLKDYPFKDRDEIYHYYHVMVSYIRLLYQVCQLVHADLSEYNSIV----- 236
           +   +G+   RL+ +       I   Y  ++ ++  L     L+H D +E+N +V     
Sbjct: 192 I---EGYPMRRLRKHK-----NIPKLYSDLMCFVVELAN-SGLIHCDFNEFNIMVKDKVE 242

Query: 237 --HQSKLYIIDVSQSVQPEHPMSLDFLRMDIKNINMYFER 274
                   +ID  Q V  +H  +  + + D+  I  +F++
Sbjct: 243 DEQDCGFVVIDFPQCVSIQHQDADYYFQRDVDCIRRFFKK 282

>SAKL0E13552g Chr5 complement(1118842..1120101) [1260 bp, 419 aa]
           {ON} highly similar to uniprot|P40160 YNL207W
           Saccharomyces cerevisiae RIO2 Protein required for cell
           viability
          Length = 419

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 43/217 (19%), Positives = 93/217 (42%), Gaps = 27/217 (12%)

Query: 65  LRALVNRGVLSEFNGCLSTGKEANVYHALSGATEGAPEKSEYAVKIYKTSILVFKDRERY 124
           L+A++NR  +      +  GKE+++Y     +      +     ++ +TS    K+   Y
Sbjct: 85  LKAMLNRDTVYSIGATIGVGKESDIYQV---SDRNGNSRVMKIHRLGRTSFQTVKNNRDY 141

Query: 125 VDGEFRFRNARSHHNPRKMIKIWAEKEFRNLKRIYQSGVIPCPQPVEIKSNVLVMEFLNR 184
           + G       R   +   + ++ A KE++ +  +Y  G    P+P +   ++++ME +  
Sbjct: 142 LKG-------RQSASWMFLSRLAANKEYQFMSLLYSKG-FKVPEPFDNSRHIILMELIK- 192

Query: 185 GDGFASPRLKDYPFKDRDEIYHYYHVMVSYIRLLYQVCQLVHADLSEYNSIV-------H 237
             G+   RL+    K  D    Y  +M   + L      L+H D +E+N ++       +
Sbjct: 193 --GYPMRRLR----KHHDLPKLYSDLMCFIVNLANH--GLIHCDFNEFNIMIKDEVDDEN 244

Query: 238 QSKLYIIDVSQSVQPEHPMSLDFLRMDIKNINMYFER 274
                +ID  Q +  +H  +  + + D+  I  +F++
Sbjct: 245 DCGFVVIDFPQCISIQHKDAEYYFQRDVDCIRRFFKK 281

>KLTH0B07722g Chr2 complement(625231..626517) [1287 bp, 428 aa] {ON}
           similar to uniprot|P40160 Saccharomyces cerevisiae
           YNL207W RIO2 Protein required for cell viability
          Length = 428

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 47/224 (20%), Positives = 101/224 (45%), Gaps = 41/224 (18%)

Query: 65  LRALVNRGVLSEFNGCLSTGKEANVYHALSGATEGAPEKSEYAVKIY---KTSILVFKDR 121
           LRA+++R  +      +  GKE++VY         A + S   +KI+   +TS    K+ 
Sbjct: 85  LRAMLSRDTIYSVGNVIGVGKESDVYRV------SAKDGSARVLKIHRLGRTSFTTVKNN 138

Query: 122 ERYV----DGEFRFRNARSHHNPRKMIKIWAEKEFRNLKRIYQSGVIPCPQPVEIKSNVL 177
             Y+     G + F           + ++ A KE++ +  ++  G    P+P +   +++
Sbjct: 139 RDYLKRNQSGSWMF-----------LSRLAANKEYQFMSLLHSKG-FTVPEPFDNSRHMI 186

Query: 178 VMEFLNRGDGFASPRLKDYPFKDRDEIYHYYHVMVSYIRLLYQVCQLVHADLSEYNSIVH 237
           +ME +   DG+    ++ +  K+  ++Y    +M+  ++L      L+H D +E+N ++ 
Sbjct: 187 LMELI---DGYPMRNMRLH--KNLPKLYS--DLMLFIVKLANH--GLIHCDFNEFNIMIK 237

Query: 238 QS-------KLYIIDVSQSVQPEHPMSLDFLRMDIKNINMYFER 274
            S          +ID  Q +  +H  +  F + D+  I  +F++
Sbjct: 238 NSVTGPEDNGFIVIDFPQCISIQHQDAEFFFKRDVDCIRRFFKK 281

>Kpol_400.7 s400 complement(15841..17118) [1278 bp, 425 aa] {ON}
           complement(15841..17118) [1278 nt, 426 aa]
          Length = 425

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 44/217 (20%), Positives = 95/217 (43%), Gaps = 26/217 (11%)

Query: 65  LRALVNRGVLSEFNGCLSTGKEANVYHALSGATEGAPEKSEYAVKIYKTSILVFKDRERY 124
           L++L+N+  +      +  GKE+++Y A   +      +     ++ +TS    K+   Y
Sbjct: 85  LKSLLNKDTVYSVGNTIGVGKESDIYQA---SDRNGEHRVMKIHRLGRTSFHTVKNNRDY 141

Query: 125 VDGEFRFRNARSHHNPRKMIKIWAEKEFRNLKRIYQSGVIPCPQPVEIKSNVLVMEFLNR 184
           +    ++    S      + ++ A KE++ +  +Y  G    P+  +   +++VME +  
Sbjct: 142 LK---KYNQGASW---MFLSRVAANKEYQFMSLLYSKG-FTVPKAFDNSRHIVVMELIK- 193

Query: 185 GDGFASPRLKDYPFKDRDEIYHYYHVMVSYIRLLYQVCQLVHADLSEYNSIVHQSK---- 240
             GF   RL+ +     D I   Y  ++ +I  L     L+H D +E+N ++   K    
Sbjct: 194 --GFPLRRLRKH-----DNIPKLYSDLMCFIVNLAN-SGLIHCDFNEFNIMIKDEKDDEN 245

Query: 241 ---LYIIDVSQSVQPEHPMSLDFLRMDIKNINMYFER 274
                +ID  Q +  +H  +  + + D+  I  +F++
Sbjct: 246 DCGFIVIDFPQCISIQHKDADFYFKRDVDCIRRFFKK 282

>YNL207W Chr14 (255353..256630) [1278 bp, 425 aa] {ON}
           RIO2Essential serine kinase involved in the processing
           of the 20S pre-rRNA into mature 18S rRNA; has similarity
           to Rio1p
          Length = 425

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/220 (20%), Positives = 96/220 (43%), Gaps = 32/220 (14%)

Query: 65  LRALVNRGVLSEFNGCLSTGKEANVYHALSGATEGAPEKSEYAVKIY---KTSILVFKDR 121
           L+ ++NR  +      +  GKE+++Y        G P      +KI+   +TS    ++ 
Sbjct: 85  LKTMLNRDTVYSVGNTIGVGKESDIYKV--SDKNGNPR----VMKIHRLGRTSFHSVRNN 138

Query: 122 ERYVDGEFRFRNARSHHNPRKMIKIWAEKEFRNLKRIYQSGVIPCPQPVEIKSNVLVMEF 181
             Y+      + +    N   + ++ A KE++ +  +Y  G    P+P +   +++VME 
Sbjct: 139 RDYL------KKSNQGANWMHLSRLAANKEYQFMSMLYSKG-FKVPEPFDNSRHIVVMEL 191

Query: 182 LNRGDGFASPRLKDYPFKDRDEIYHYYHVMVSYIRLLYQVCQLVHADLSEYNSIV----- 236
           +   +G+   RL+ +       I   Y  ++ +I  L     L+H D +E+N ++     
Sbjct: 192 I---EGYPMRRLRKHK-----NIPKLYSDLMCFIVDLAN-SGLIHCDFNEFNIMIKDKLE 242

Query: 237 --HQSKLYIIDVSQSVQPEHPMSLDFLRMDIKNINMYFER 274
             +     +ID  Q +  +H  +  + + D+  I  +F++
Sbjct: 243 DENDCGFVVIDFPQCISIQHQDADYYFQRDVDCIRRFFKK 282

>ABL166W Chr2 (88546..89790) [1245 bp, 414 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YNL207W (RIO2)
          Length = 414

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 41/217 (18%), Positives = 96/217 (44%), Gaps = 27/217 (12%)

Query: 65  LRALVNRGVLSEFNGCLSTGKEANVYHALSGATEGAPEKSEYAVKIYKTSILVFKDRERY 124
           L++L+ +  +      +  GKE+++Y     A++    K     ++ +TS    K +  Y
Sbjct: 85  LKSLLEKNAIYSVGNTIGVGKESDIYQVSDAASQSLVMKIH---RLGRTSFHTVKTKREY 141

Query: 125 VDGEFRFRNARSHHNPRKMIKIWAEKEFRNLKRIYQSGVIPCPQPVEIKSNVLVMEFLNR 184
           +    R ++A    N  ++  + AE+E+  +  +Y  G    P+P     + +VME++  
Sbjct: 142 LK---RGQSA----NWMRLSHLSAEREYAYMCLLYSKG-FSVPKPYANSRHAIVMEYIR- 192

Query: 185 GDGFASPRLKDYPFKDRDEIYHYYHVMVSYIRLLYQVCQLVHADLSEYNSIV-------H 237
             G+   RL+ +       +   Y  +++++  L     ++H D +E+N ++        
Sbjct: 193 --GYPMRRLRSHS-----NVPKLYSDLMAFVVKLAN-HGMIHCDFNEFNIMIKDDIDDPE 244

Query: 238 QSKLYIIDVSQSVQPEHPMSLDFLRMDIKNINMYFER 274
                +ID  Q +  +H  +  + + D+  I  +F++
Sbjct: 245 DQGFVVIDFPQCISIQHQEAEYYFKRDVDCIRRFFKK 281

>KLLA0D19008g Chr4 complement(1598807..1600075) [1269 bp, 422 aa]
           {ON} highly similar to uniprot|P40160 YNL207W
           Saccharomyces cerevisiae RIO2 Protein required for cell
           viability,
          Length = 422

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 46/217 (21%), Positives = 94/217 (43%), Gaps = 27/217 (12%)

Query: 65  LRALVNRGVLSEFNGCLSTGKEANVYHALSGATEGAPEKSEYAVKIYKTSILVFKDRERY 124
           L++++NR  L      +  GKE+++Y     + E    K     ++ +TS    K+   Y
Sbjct: 85  LKSMLNRDTLYSVGTTIGVGKESDIYQVSDRSGESKVLKIH---RLGRTSFHTIKNNRDY 141

Query: 125 VDGEFRFRNARSHHNPRKMIKIWAEKEFRNLKRIYQSGVIPCPQPVEIKSNVLVMEFLNR 184
           +      RN +S  +   + K+ A KE++ +  +Y       PQP +   + ++ME +  
Sbjct: 142 L------RNGQS-ASWMHLSKLAANKEYQFMTMLYDRN-FEVPQPFDNSRHCVLMEHIR- 192

Query: 185 GDGFASPRLKDYPFKDRDEIYHYYHVMVSYIRLLYQVCQLVHADLSEYNSIVHQS----- 239
             G+   RL     K ++    Y  +M   ++L      L+H D +E+N ++        
Sbjct: 193 --GYPMRRLG----KHKNLPKLYSDLMCFIVKLANH--GLIHCDFNEFNIMIKDEPEGED 244

Query: 240 --KLYIIDVSQSVQPEHPMSLDFLRMDIKNINMYFER 274
                +ID  Q +  +H  +  + + D+  I  +F++
Sbjct: 245 DPGYVVIDFPQCISIQHQDAAYYFKRDVDCIRRFFKK 281

>ZYRO0C10340g Chr3 complement(793323..794573) [1251 bp, 416 aa] {ON}
           similar to uniprot|P40160 Saccharomyces cerevisiae
           YNL207W RIO2 Protein required for cell viability
          Length = 416

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 43/218 (19%), Positives = 93/218 (42%), Gaps = 27/218 (12%)

Query: 65  LRALVNRGVLSEFNGCLSTGKEANVYHALSGATEGAPEKSEYAVKIYKTSILVFKDRERY 124
           ++A++NR  +      +  GKE+++Y            K     ++ +TS    ++   Y
Sbjct: 85  IKAMLNRDTVYSIGNTIGVGKESDIYKVSDRNGNAQVMKIH---RLGRTSFTSVRNNRDY 141

Query: 125 VDGEFRFRNARSHHNPRKMIKIWAEKEFRNLKRIYQSGVIPCPQPVEIKSNVLVMEFLNR 184
           +      +++R   +   +  + A KE+  L  ++  G    P+  +   ++++MEF+  
Sbjct: 142 L------KHSRQGTSWMHLSLLAAHKEYEFLALLHSRG-FQVPEAFDNSRHMVLMEFIK- 193

Query: 185 GDGFASPRLKDYPFKDRDEIYHYYHVMVSYIRLLYQVCQLVHADLSEYNSIV-------- 236
             GF    L+ +       I   Y  ++ +   L +   L+H D +E+N ++        
Sbjct: 194 --GFPMKNLRTHS-----NIPKLYSDLMKFAVDLAK-SGLIHCDYNEFNIMIKDQDTTDS 245

Query: 237 HQSKLYIIDVSQSVQPEHPMSLDFLRMDIKNINMYFER 274
                 +ID  Q +  +HP +  F R DI+ I  +F++
Sbjct: 246 SDCGFVVIDFPQCISIQHPDAEFFFRRDIECIRRFFKK 283

>KLLA0F15576g Chr6 (1437595..1439133) [1539 bp, 512 aa] {ON} similar
           to uniprot|Q07950 Saccharomyces cerevisiae YLR020C YEH2
           Steryl ester hydrolase catalyzes steryl ester hydrolysis
           at the plasma membrane involved in sterol metabolism
          Length = 512

 Score = 35.0 bits (79), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 115 ILVFKDRE-RYVDGEFRFRNARSHHNPRKMIKIWAEKEFRNLKRIYQSGVI 164
           IL+F  R+ R VDGE R  N   +H P  + KIW   E+ +L  ++ S VI
Sbjct: 443 ILLFTPRQDRLVDGE-RLINHFINHEPHSVYKIWYIDEYSHLDVLWASDVI 492

>AGL050C Chr7 complement(613063..614514) [1452 bp, 483 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR019W
           (UGA1)
          Length = 483

 Score = 34.3 bits (77), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 67/169 (39%), Gaps = 35/169 (20%)

Query: 16  TDHDNTRILEKFANQIKTDELSLTKGKTNKDKANRATVENVLDPRTMRFLRALVNRGVLS 75
            D D    L+ +A QI     S+  G  N +    AT        +   +RALVNR  L 
Sbjct: 70  ADVDGNMYLDMYA-QIA----SIALGYNNPELIKAAT--------SSEMVRALVNRPALG 116

Query: 76  EFNGC-----------LSTGKEANVYHALSGATEGAPEKSEYAVKIYKTSILVFKDRERY 124
            F GC           L+   +  V+  LSG+     + +E A   +K + + ++ ++R 
Sbjct: 117 NFPGCDLREILARLLRLAPAGQDKVWSGLSGS-----DANELA---FKAAFIYYRSKKRG 168

Query: 125 VDGEFRFRNARS-HHNPRKMIKIWAEKEFRNL--KRIYQSGVIPCPQPV 170
            D EF      S   N        A   F++    R++ SG   C +P+
Sbjct: 169 YDKEFSAEELSSVMGNSAPGSPQLAVLSFKSAFHGRLFASGSATCSKPI 217

>NCAS0D02820 Chr4 (536140..537735) [1596 bp, 531 aa] {ON} Anc_5.200
          Length = 531

 Score = 34.3 bits (77), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 48/109 (44%), Gaps = 13/109 (11%)

Query: 89  VYHALSGATEGA------PEKSEYAVKIYKTSILVFKDRE-RYVDGEFRFRNARSHHNPR 141
           ++  + G T GA      P K     KI   +IL+F  R+ R VDGE R  N   HH   
Sbjct: 429 IWFPVDGQTPGADVSFQAPGKQRTKDKI--PNILMFIPRQDRLVDGE-RLINHFIHHESH 485

Query: 142 KMIKIWAEKEFRNLKRIYQSGVIPCPQPVEIKSNVLVMEFLNRGDGFAS 190
            +  IW   E+ +L  ++   VI       IK    + E   +G+GF S
Sbjct: 486 DIFNIWYIDEYSHLDVLWAHDVIERIGEPMIKH---LREPTEKGNGFES 531

>KLLA0D07964g Chr4 complement(682226..683278) [1053 bp, 350 aa] {ON}
           weakly similar to uniprot|P53891 Saccharomyces
           cerevisiae YNL165W Hypothetical ORF
          Length = 350

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 50/109 (45%), Gaps = 9/109 (8%)

Query: 80  CLSTGKEANVYHALSGATEGAPEKSEYAVKIYKTSILVFKDRERYVDGEFRFRNARSHHN 139
           CL +GK   ++H +S   +    KS    KIYK  ++   D ++  D +   +     + 
Sbjct: 100 CLDSGKGWPLFHYVSVGFKSYFRKSTPVSKIYKYKVV---DNDKVDDIKEPNKELLHQNE 156

Query: 140 PRKMIKIWAEKEFRNLKRIYQSGVI----PCPQPVEIKSNVLVMEFLNR 184
            R + K+     FRN+  I   G++     C QP  I+ +VL+M  + R
Sbjct: 157 KRSLFKVEFCNVFRNV--INSEGIVYHKFVCFQPDGIRCSVLMMNSIGR 203

>TDEL0D05720 Chr4 (1028139..1030607) [2469 bp, 822 aa] {ON}
           Anc_3.504 YGR140W
          Length = 822

 Score = 32.3 bits (72), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 33/138 (23%), Positives = 61/138 (44%), Gaps = 17/138 (12%)

Query: 193 LKDYPFKDRDE-IYHYYHVMVSYIRLLYQVCQLVHADLSEYNSIVHQSKLYIIDVSQSVQ 251
           L DYP   R+E + +YY  +  Y  L Y+  +  +    EY +  HQS     D   S +
Sbjct: 283 LTDYP---REETMSNYYSAVFRYCHLPYKRREYFNKSTLEYPTWSHQSFTDFFDKYPSAK 339

Query: 252 P---EHPMSLDFLR-MDIKNINMYFERMGIDIFPERVIFQFV---------ISETLDKFR 298
               +H +  D+ R M+++++N   E   +   PE ++ Q           + +   + +
Sbjct: 340 RTAFQHEVPFDYDRIMNLRSLNETKENEALSALPESLLVQIFPEVEQYKREVDQLSPEAK 399

Query: 299 GDMRSAEDLRSYVAANLP 316
             +++ E+LR     NLP
Sbjct: 400 AFIQTMENLRKRFLYNLP 417

>Ecym_1119 Chr1 complement(244327..246702) [2376 bp, 791 aa] {ON}
           similar to Ashbya gossypii AFR647C
          Length = 791

 Score = 32.0 bits (71), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 12/49 (24%), Positives = 31/49 (63%), Gaps = 3/49 (6%)

Query: 110 IYKTSILVFKDRERYVDGEFRFRNARSHHNPRKMIKIWAEKEFRNLKRI 158
           +++T  + F+D++R+ +G    R   + H+P +++K+    E+ ++KR+
Sbjct: 312 LFETKPMYFEDQKRFFNGVIEIR---TQHDPLELLKLCKRIEYEDMKRV 357

>TDEL0B03420 Chr2 complement(609095..610564) [1470 bp, 489 aa] {ON}
           Anc_8.768 YOR298W
          Length = 489

 Score = 31.2 bits (69), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 43/101 (42%), Gaps = 11/101 (10%)

Query: 11  KLRDDTDHDNTRILEKFAN-QIKTDELSLTKGKTNKDKANRATVENVLDPRTMRFLR--- 66
           K+++       ++L  F    I T ELS+ + K N+D    A   NVL PR   F+    
Sbjct: 234 KIKNHLTRTGNQVLTIFPEVNIMTTELSIVQRKLNQDYPFVAKFYNVLYPRFKTFISTIK 293

Query: 67  --ALVNRGVLSEFNGCLSTGKEANVYHALSGATEGAPEKSE 105
             A +    L E NG LS     N  H L+   +    K++
Sbjct: 294 CFAYIKHVKLKEQNGLLS-----NARHLLTNGVDKIILKAQ 329

>Smik_11.349 Chr11 (589827..593042) [3216 bp, 1071 aa] {ON} YKR086W
            (REAL)
          Length = 1071

 Score = 31.2 bits (69), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 44/100 (44%), Gaps = 3/100 (3%)

Query: 232  YNSIVHQSKLYIIDVSQSVQPEHPMSLDFLRMDIKNINMYFERMGIDIFPERVIFQFVIS 291
            Y+ ++  S  YI  V+ SV P   M    L  DIK I    E     +F ER   + VI 
Sbjct: 953  YHELLMTSNEYICCVT-SVDPFWLMEYGVLLYDIKRITHDQESDTTGLFGER--HEHVID 1009

Query: 292  ETLDKFRGDMRSAEDLRSYVAANLPRKQTAQDEAEDQVFR 331
            E  D+   ++R  +D+R+ V   L     +     +Q FR
Sbjct: 1010 EVEDEIDINIRVCKDMRNDVVQELKIANESNSRENEQRFR 1049

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 44,280,291
Number of extensions: 1898300
Number of successful extensions: 6453
Number of sequences better than 10.0: 60
Number of HSP's gapped: 6603
Number of HSP's successfully gapped: 86
Length of query: 477
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 364
Effective length of database: 40,524,141
Effective search space: 14750787324
Effective search space used: 14750787324
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)