Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AER256C5.433ON23923912121e-171
Ecym_47625.433ON2212216311e-82
SAKL0G02508g5.433ON2282265722e-73
Suva_2.5395.433ON2272255173e-65
Smik_4.6335.433ON2212135121e-64
YDR367W (KEI1)5.433ON2212195112e-64
KAFR0E039305.433ON2112175032e-63
CAGL0A02794g5.433ON2162165024e-63
KNAG0C049205.433ON2172175016e-63
TPHA0E017705.433ON2172164991e-62
NCAS0F033705.433ON2112154963e-62
KLLA0E21099g5.433ON2242234955e-62
Skud_4.6365.433ON2342204741e-58
Kpol_1062.305.433ON2142214661e-57
TDEL0E019205.433ON2202134485e-55
Kwal_55.214325.433ON2072064432e-54
ZYRO0F10010g5.433ON2082054354e-53
TBLA0A065205.433ON2062124172e-50
KLTH0F16082g5.433ON2062053972e-47
TBLA0G020105.433ON2132033642e-42
NDAI0B056605.433ON1611703158e-36
TPHA0K018104.74ON48860657.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AER256C
         (239 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AER256C Chr5 complement(1109526..1110152,1110213..1110305) [720 ...   471   e-171
Ecym_4762 Chr4 complement(1482336..1482983,1483049..1483066) [66...   247   1e-82
SAKL0G02508g Chr7 (207823..207855,207940..208593) [687 bp, 228 a...   224   2e-73
Suva_2.539 Chr2 (963328..963357,963470..964123) [684 bp, 227 aa]...   203   3e-65
Smik_4.633 Chr4 (1132870..1132899,1133000..1133635) [666 bp, 221...   201   1e-64
YDR367W Chr4 (1212848..1212877,1212979..1213614) [666 bp, 221 aa...   201   2e-64
KAFR0E03930 Chr5 (777060..777089,777170..777775) [636 bp, 211 aa...   198   2e-63
CAGL0A02794g Chr1 (295534..295563,295751..296371) [651 bp, 216 a...   197   4e-63
KNAG0C04920 Chr3 complement(950839..951462,951584..951613) [654 ...   197   6e-63
TPHA0E01770 Chr5 complement(356743..357396) [654 bp, 217 aa] {ON...   196   1e-62
NCAS0F03370 Chr6 (681041..681070,681141..681746) [636 bp, 211 aa...   195   3e-62
KLLA0E21099g Chr5 complement(1885338..1885976,1886092..1886127) ...   195   5e-62
Skud_4.636 Chr4 (1135660..1135689,1135789..1136463) [705 bp, 234...   187   1e-58
Kpol_1062.30 s1062 complement(66657..67301) [645 bp, 214 aa] {ON...   184   1e-57
TDEL0E01920 Chr5 complement(363042..363665,363727..363765) [663 ...   177   5e-55
Kwal_55.21432 s55 complement(834129..834752) [624 bp, 207 aa] {O...   175   2e-54
ZYRO0F10010g Chr6 (812835..812861,812941..813540) [627 bp, 208 a...   172   4e-53
TBLA0A06520 Chr1 complement(1599308..1599928) [621 bp, 206 aa] {...   165   2e-50
KLTH0F16082g Chr6 complement(1305673..1306293) [621 bp, 206 aa] ...   157   2e-47
TBLA0G02010 Chr7 (525436..526077) [642 bp, 213 aa] {ON} Anc_5.43...   144   2e-42
NDAI0B05660 Chr2 (1382276..1382761) [486 bp, 161 aa] {ON} Anc_5....   125   8e-36
TPHA0K01810 Chr11 (384112..385578) [1467 bp, 488 aa] {ON} Anc_4....    30   7.0  

>AER256C Chr5 complement(1109526..1110152,1110213..1110305) [720 bp,
           239 aa] {ON} Syntenic homolog of Saccharomyces
           cerevisiae YDR367W; 1-intron
          Length = 239

 Score =  471 bits (1212), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 227/239 (94%), Positives = 227/239 (94%)

Query: 1   MTRTLHQRPEMRNIYSSLPTKSHSNMNHLPKSFFGLPLYIGVELSLGIAIFNKFCGLFGL 60
           MTRTLHQRPEMRNIYSSLPTKSHSNMNHLPKSFFGLPLYIGVELSLGIAIFNKFCGLFGL
Sbjct: 1   MTRTLHQRPEMRNIYSSLPTKSHSNMNHLPKSFFGLPLYIGVELSLGIAIFNKFCGLFGL 60

Query: 61  LALFTGHPLDILQWLFYLWSFVTLLVYLHGLMQIYQPRLAAYCLVLVVYSTDTILTCLYT 120
           LALFTGHPLDILQWLFYLWSFVTLLVYLHGLMQIYQPRLAAYCLVLVVYSTDTILTCLYT
Sbjct: 61  LALFTGHPLDILQWLFYLWSFVTLLVYLHGLMQIYQPRLAAYCLVLVVYSTDTILTCLYT 120

Query: 121 LWFTRGWFIDGDVGVXXXXXXXXXXXXQGSVTVENEPVSHQSASKSYEYAFTMAFTLFAL 180
           LWFTRGWFIDGDVGV            QGSVTVENEPVSHQSASKSYEYAFTMAFTLFAL
Sbjct: 121 LWFTRGWFIDGDVGVTATAKEDDADATQGSVTVENEPVSHQSASKSYEYAFTMAFTLFAL 180

Query: 181 SLRFYSNFLIASFVQRMFQHNKFAAGCDDVEQDLKHKSVAYRAYAKMQRWCYFLCRRYL 239
           SLRFYSNFLIASFVQRMFQHNKFAAGCDDVEQDLKHKSVAYRAYAKMQRWCYFLCRRYL
Sbjct: 181 SLRFYSNFLIASFVQRMFQHNKFAAGCDDVEQDLKHKSVAYRAYAKMQRWCYFLCRRYL 239

>Ecym_4762 Chr4 complement(1482336..1482983,1483049..1483066) [666
           bp, 221 aa] {ON} similar to Ashbya gossypii AER256C
           1-intron
          Length = 221

 Score =  247 bits (631), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 122/221 (55%), Positives = 149/221 (67%), Gaps = 7/221 (3%)

Query: 26  MNHLPKSFFGLPLYIGVELSLGIAIFNKFCGLFGLLALFTGHPLDILQWLFYLWSFVTLL 85
           M +LP+SFFGLPLYIGVELSLG+AIFNKFCGL+G+LALFTG PLD++QW FY+WSF  LL
Sbjct: 1   MVYLPQSFFGLPLYIGVELSLGVAIFNKFCGLYGILALFTGRPLDLIQWGFYVWSFAALL 60

Query: 86  VYLHGLMQIYQPRLAAYCLVLVVYSTDTILTCLYTLWFTRGWFIDGDV--GVXXXXXXXX 143
           V+  GL Q+Y+P+L  YC+VL VYS DT+L C + + FT  WF   D   G         
Sbjct: 61  VFTKGLSQVYKPKLMTYCMVLTVYSLDTVLACFFAVLFTGDWFSKEDTSSGSNPVSGKGI 120

Query: 144 XXXXQGSVTVEN-----EPVSHQSASKSYEYAFTMAFTLFALSLRFYSNFLIASFVQRMF 198
                G    +N          QSAS  YEY+ T+  TL   +LRFYSNF+IASFV+RM 
Sbjct: 121 GVVDVGKSGTQNFAYRRTVDDTQSASTHYEYSSTILLTLIVSALRFYSNFIIASFVRRMM 180

Query: 199 QHNKFAAGCDDVEQDLKHKSVAYRAYAKMQRWCYFLCRRYL 239
           + N++    DDVE DLK+ SVAYRAY   QRWCY+ CRRYL
Sbjct: 181 KQNRYITEPDDVEYDLKNTSVAYRAYVSTQRWCYYFCRRYL 221

>SAKL0G02508g Chr7 (207823..207855,207940..208593) [687 bp, 228 aa]
           {ON} similar to uniprot|Q06999 Saccharomyces cerevisiae
           YDR367W Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 228

 Score =  224 bits (572), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 114/226 (50%), Positives = 146/226 (64%), Gaps = 8/226 (3%)

Query: 22  SHSNMNHLPKSFFG-LPLYIGVELSLGIAIFNKFCGLFGLLALFTGHPLDILQWLFYLWS 80
           + + M HLPKSF G LPLYIGVEL LGI+IFNKF G +G+LALFTGHPLD +QW FY  S
Sbjct: 2   TKAEMVHLPKSFLGFLPLYIGVELGLGISIFNKFSGFYGILALFTGHPLDFMQWCFYSLS 61

Query: 81  FVTLLVYLHGLMQIYQPRLAAYCLVLVVYSTDTILTCLYTLWFTRGWFI-------DGDV 133
            +TLLVYL GL QI +P    Y LVLVV++ DT+L C +T+WF+  WF         G V
Sbjct: 62  VLTLLVYLSGLWQIRKPNPLTYSLVLVVFTIDTLLNCFFTIWFSAQWFSIEENDDNKGAV 121

Query: 134 GVXXXXXXXXXXXXQGSVTVENEPVSHQSASKSYEYAFTMAFTLFALSLRFYSNFLIASF 193
           G                +   N  ++ QSAS+ YEY  TM FT+  L++RFY NF++A+F
Sbjct: 122 GTSKLQSAGRALGPAKELNRRNNSLASQSASQGYEYTMTMLFTVLTLAVRFYFNFILAAF 181

Query: 194 VQRMFQHNKFAAGCDDVEQDLKHKSVAYRAYAKMQRWCYFLCRRYL 239
           VQ+M +H K+    DDVEQDLK+KS+  R   K ++WCY  C+R L
Sbjct: 182 VQQMLRHPKYIVDKDDVEQDLKNKSLFRRLCIKSEKWCYNACQRAL 227

>Suva_2.539 Chr2 (963328..963357,963470..964123) [684 bp, 227 aa]
           {ON} YDR367W (REAL)
          Length = 227

 Score =  203 bits (517), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 104/225 (46%), Positives = 138/225 (61%), Gaps = 8/225 (3%)

Query: 23  HSNMNHLPKSFFG-LPLYIGVELSLGIAIFNKFCGLFGLLALFTGHPLDILQWLFYLWSF 81
            S++  LPKSF G +PLY+ VE+ LGI+I NK  G +G+LALFTGHPLD +QW+ YLWS 
Sbjct: 2   RSSLVALPKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVAYLWSV 61

Query: 82  VTLLVYLHGLMQIYQPRLAAYCLVLVVYSTDTILTCLYTLWFTRGWF-------IDGDVG 134
            TL+V+  GL  I++P L  +  + V+Y+ DTI TC +TLWFT  WF       I  D  
Sbjct: 62  FTLIVFAQGLYLIHKPNLLVFSQICVLYTVDTICTCFFTLWFTTQWFTLEGNASIVADAS 121

Query: 135 VXXXXXXXXXXXXQGSVTVENEPVSHQSASKSYEYAFTMAFTLFALSLRFYSNFLIASFV 194
                         G +T  +   S Q AS+SYEY+ T+  TL +L  RFY NF++ASFV
Sbjct: 122 STATQTINYNPIATGKLTARSTDTSGQGASESYEYSITILITLVSLIFRFYFNFILASFV 181

Query: 195 QRMFQHNKFAAGCDDVEQDLKHKSVAYRAYAKMQRWCYFLCRRYL 239
           Q +  H K+    DDVEQDLK+K +  R +AK Q+ CY LC+  L
Sbjct: 182 QELLHHPKYLVDRDDVEQDLKNKPIWKRLWAKSQKGCYKLCKNLL 226

>Smik_4.633 Chr4 (1132870..1132899,1133000..1133635) [666 bp, 221
           aa] {ON} YDR367W (REAL)
          Length = 221

 Score =  201 bits (512), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 99/213 (46%), Positives = 137/213 (64%), Gaps = 2/213 (0%)

Query: 29  LPKSFFG-LPLYIGVELSLGIAIFNKFCGLFGLLALFTGHPLDILQWLFYLWSFVTLLVY 87
           LPKSF G +PLY+ VE+ LGI+I NK  G++G+LALFTGHPLD +QW+ YLWS  TL+++
Sbjct: 8   LPKSFLGFMPLYLAVEIVLGISILNKCSGVYGILALFTGHPLDFMQWVAYLWSVFTLIIF 67

Query: 88  LHGLMQIYQPRLAAYCLVLVVYSTDTILTCLYTLWFTRGWF-IDGDVGVXXXXXXXXXXX 146
             GL  I++P L  +  +  +Y+ DT+ TC +TLWFT  WF ++   G            
Sbjct: 68  SQGLYLIHKPNLLLFSQICALYTLDTLFTCFFTLWFTTQWFTLEDTAGGVASQSNNSNLI 127

Query: 147 XQGSVTVENEPVSHQSASKSYEYAFTMAFTLFALSLRFYSNFLIASFVQRMFQHNKFAAG 206
               +TV N  +S QSA++SYEY+ T+  TL +L  RFY N ++ASFVQ +  H K+   
Sbjct: 128 STERLTVRNTDISKQSATESYEYSITILITLVSLIFRFYFNLILASFVQELLHHPKYLVD 187

Query: 207 CDDVEQDLKHKSVAYRAYAKMQRWCYFLCRRYL 239
            DDVEQ+LK+K +  R YAK Q+ CY LC+  L
Sbjct: 188 RDDVEQNLKNKPIWKRLYAKSQKGCYKLCKNLL 220

>YDR367W Chr4 (1212848..1212877,1212979..1213614) [666 bp, 221 aa]
           {ON}  KEI1Component of inositol phosphorylceramide (IPC)
           synthase; forms a complex with Aur1p and regulates its
           activity; required for IPC synthase complex localization
           to the Golgi; post-translationally processed by Kex2p;
           KEI1 is an essential gene
          Length = 221

 Score =  201 bits (511), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 101/219 (46%), Positives = 139/219 (63%), Gaps = 2/219 (0%)

Query: 23  HSNMNHLPKSFFG-LPLYIGVELSLGIAIFNKFCGLFGLLALFTGHPLDILQWLFYLWSF 81
            S++  LPKSF G +PLY+ VE+ LGI+I NK  G +G+LALFTGHPLD +QW+ YLWS 
Sbjct: 2   RSSLLTLPKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWIAYLWSV 61

Query: 82  VTLLVYLHGLMQIYQPRLAAYCLVLVVYSTDTILTCLYTLWFTRGWF-IDGDVGVXXXXX 140
            TL+V+  GL  I++P L  +  + V+Y+ DTI TC +TLWFT  WF ++    +     
Sbjct: 62  FTLIVFSQGLYLIHKPNLLVFSQICVLYTIDTISTCFFTLWFTTQWFTLEDTANIDGNNA 121

Query: 141 XXXXXXXQGSVTVENEPVSHQSASKSYEYAFTMAFTLFALSLRFYSNFLIASFVQRMFQH 200
                   G +T     +S QSA++SYEY  T+  TL +L  RFY NF++ASFVQ +  H
Sbjct: 122 LQSNPISTGKLTERGIDISKQSATESYEYTMTILITLVSLIFRFYFNFILASFVQELLHH 181

Query: 201 NKFAAGCDDVEQDLKHKSVAYRAYAKMQRWCYFLCRRYL 239
            K+    DDVEQ+LK+K +  R +AK Q+ CY LC+  L
Sbjct: 182 PKYLVDRDDVEQNLKNKPIWKRLWAKSQKGCYKLCKNLL 220

>KAFR0E03930 Chr5 (777060..777089,777170..777775) [636 bp, 211 aa]
           {ON} Anc_5.433 YDR367W
          Length = 211

 Score =  198 bits (503), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 102/217 (47%), Positives = 135/217 (62%), Gaps = 20/217 (9%)

Query: 29  LPKSFFG-LPLYIGVELSLGIAIFNKFCGLFGLLALFTGHPLDILQWLFYLWSFVTLLVY 87
           LPKSF G LPLY+ VE+ LGI  FNK  G FG+LALFTGHPL  +QW+FYLWS VTL V+
Sbjct: 8   LPKSFLGVLPLYLAVEIVLGITAFNKVSGAFGILALFTGHPLAFMQWVFYLWSTVTLFVF 67

Query: 88  LHGLMQIYQPRLAAYCLVLVVYSTDTILTCLYTLWFTRGWF-----IDGDVGVXXXXXXX 142
             GL +I++P +  +  + V YS DT+  C +TLWFT  WF      +  VG        
Sbjct: 68  AQGLFEIHKPNILTFSQIFVFYSIDTLCNCFFTLWFTGDWFNVESQTEAAVG-------- 119

Query: 143 XXXXXQGSVTVENEPVSHQSASKSYEYAFTMAFTLFALSLRFYSNFLIASFVQRMFQHNK 202
                  ++T   E +S Q AS+ YEY+ T+  TL +L  RFY NF++ASFVQ + +H K
Sbjct: 120 ------STITKRTEDISSQGASQGYEYSMTIFITLTSLVFRFYFNFILASFVQELLRHPK 173

Query: 203 FAAGCDDVEQDLKHKSVAYRAYAKMQRWCYFLCRRYL 239
           +    DD+EQDLK+KS+  R + K Q+ CY LC+  L
Sbjct: 174 YMFDQDDIEQDLKNKSIWKRWWLKCQKSCYKLCKNLL 210

>CAGL0A02794g Chr1 (295534..295563,295751..296371) [651 bp, 216 aa]
           {ON} highly similar to uniprot|Q06346 Saccharomyces
           cerevisiae YDR367w
          Length = 216

 Score =  197 bits (502), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 102/216 (47%), Positives = 133/216 (61%), Gaps = 5/216 (2%)

Query: 25  NMNHLPKSFFG-LPLYIGVELSLGIAIFNKFCGLFGLLALFTGHPLDILQWLFYLWSFVT 83
           N    PKSFFG LPLY+GVE+ LGI I NK  G +G+LALFTGHPLD +QW+ YLWS  T
Sbjct: 4   NKISFPKSFFGFLPLYLGVEIVLGITILNKCSGAYGILALFTGHPLDYMQWISYLWSVFT 63

Query: 84  LLVYLHGLMQIYQPRLAAYCLVLVVYSTDTILTCLYTLWFTRGWFIDGDVGVXXXXXXXX 143
           L+V+  GL  I++P+L  +  +LV ++ DT+LTC +TLWF+  WF   +           
Sbjct: 64  LIVFSQGLFMIHKPKLIVFSQILVYFTADTVLTCFFTLWFSAQWFQSANEEKHETSAPVG 123

Query: 144 XXXXQGSVTVENEPVSHQSASKSYEYAFTMAFTLFALSLRFYSNFLIASFVQRMFQHNKF 203
                   T     ++ Q AS+ YEY  TM FTL  L  R Y NF++ASFVQ + +H K+
Sbjct: 124 VSQNYRRST----DLASQGASERYEYTVTMLFTLVTLMFRMYFNFILASFVQELLRHPKY 179

Query: 204 AAGCDDVEQDLKHKSVAYRAYAKMQRWCYFLCRRYL 239
               DDVEQDLK+KS   R + K Q++CY LCR  L
Sbjct: 180 MVDQDDVEQDLKNKSAIKRWWIKSQKFCYKLCRHTL 215

>KNAG0C04920 Chr3 complement(950839..951462,951584..951613) [654 bp,
           217 aa] {ON} Anc_5.433 YDR367W
          Length = 217

 Score =  197 bits (501), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 99/217 (45%), Positives = 138/217 (63%), Gaps = 10/217 (4%)

Query: 27  NHLPKSFFGL-PLYIGVELSLGIAIFNKFCGLFGLLALFTGHPLDILQWLFYLWSFVTLL 85
           + LPK+FFG+ PLYIGVE+ LG+ + NK  G FG+LALFTGHPLD++QW  YLWS  TL+
Sbjct: 6   SSLPKTFFGIFPLYIGVEIVLGVTLLNKCSGAFGILALFTGHPLDLMQWASYLWSVFTLV 65

Query: 86  VYLHGLMQIYQPRLAAYCLVLVVYSTDTILTCLYTLWFTRGWFID---GDVGVXXXXXXX 142
           VY  GL QI++P+L  +  ++VV+S DT+LTCL+TLWFT  WF +    D  +       
Sbjct: 66  VYAQGLYQIHKPKLLTFSQIVVVFSIDTVLTCLFTLWFTGVWFAEESNTDAAMGTAASAV 125

Query: 143 XXXXXQGSVTVENEPVSHQSASKSYEYAFTMAFTLFALSLRFYSNFLIASFVQRMFQHNK 202
                +G+       +  Q A++SYEY FT+  T+ +L  R Y NFL+ASFVQ + +H +
Sbjct: 126 ARLVKRGA------EIDTQGATESYEYVFTIIITMVSLVFRLYFNFLLASFVQELLRHPQ 179

Query: 203 FAAGCDDVEQDLKHKSVAYRAYAKMQRWCYFLCRRYL 239
           +    DD+EQDLK+K    R +   Q+  Y +CR  L
Sbjct: 180 YLVDQDDIEQDLKNKFFLRRWWVVSQKSSYSICRHVL 216

>TPHA0E01770 Chr5 complement(356743..357396) [654 bp, 217 aa] {ON}
           Anc_5.433 YDR367W
          Length = 217

 Score =  196 bits (499), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 105/216 (48%), Positives = 138/216 (63%), Gaps = 21/216 (9%)

Query: 29  LPKSFFG-LPLYIGVELSLGIAIFNKFCGLFGLLALFTGHPLDILQWLFYLWSFVTLLVY 87
           LPKSFFG LPLYIGVE  LGI IFNK  G++G+LALFTGHPL  +QW+ YLWS  TLL+Y
Sbjct: 17  LPKSFFGFLPLYIGVETVLGITIFNKCSGIYGILALFTGHPLTAIQWVSYLWSSFTLLIY 76

Query: 88  LHGLMQIYQPRLAAYCLVLVVYSTDTILTCLYTLWFTRGWFID----GDVGVXXXXXXXX 143
             GL Q++ P L  YC +L+ YS DTI TC +T++F   WF +    GD           
Sbjct: 77  AQGLFQVHHPNLLTYCQILITYSFDTICTCFFTIYFCSHWFTEESNAGD----------- 125

Query: 144 XXXXQGSVTVENEPVSHQSASKSYEYAFTMAFTLFALSLRFYSNFLIASFVQRMFQHNKF 203
                 S TV+     +Q AS+S E+ +TM  TL AL  RFY NF++ASF Q++F H K+
Sbjct: 126 --NINSSTTVDKY---NQGASESKEFFWTMTLTLIALVSRFYFNFILASFTQQLFLHPKY 180

Query: 204 AAGCDDVEQDLKHKSVAYRAYAKMQRWCYFLCRRYL 239
               DDVEQDLK+KS+  + + K ++ CY+  +R+L
Sbjct: 181 MIDQDDVEQDLKNKSIIVQWWIKSKKRCYYTSKRFL 216

>NCAS0F03370 Chr6 (681041..681070,681141..681746) [636 bp, 211 aa]
           {ON} Anc_5.433 YDR367W
          Length = 211

 Score =  195 bits (496), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 101/215 (46%), Positives = 135/215 (62%), Gaps = 16/215 (7%)

Query: 29  LPK---SFFGL-PLYIGVELSLGIAIFNKFCGLFGLLALFTGHPLDILQWLFYLWSFVTL 84
           LPK   SFFG+ PLY+GVE+ LGI IFNK  G +G+LALFTGHPLD +QW+FYLWS  TL
Sbjct: 8   LPKCFQSFFGIIPLYLGVEIVLGITIFNKCSGAYGILALFTGHPLDFVQWVFYLWSIFTL 67

Query: 85  LVYLHGLMQIYQPRLAAYCLVLVVYSTDTILTCLYTLWFTRGWFIDGDVGVXXXXXXXXX 144
           +++  GL +I++P L  +  +LV YS DTI TC++TLWFT  WF     G          
Sbjct: 68  IIFAQGLYEIHKPTLLTFSQILVFYSLDTICTCIFTLWFTSQWFQTEPTGT--------- 118

Query: 145 XXXQGSVTVENEPVSHQSASKSYEYAFTMAFTLFALSLRFYSNFLIASFVQRMFQHNKFA 204
              + ++   NE +  Q A+++YEY  T+  TL  L+ R Y N L+A+FVQ +  H K+ 
Sbjct: 119 ---EEALQRRNESLESQGATEAYEYMMTIFITLVTLTFRLYFNCLLAAFVQELLHHPKYL 175

Query: 205 AGCDDVEQDLKHKSVAYRAYAKMQRWCYFLCRRYL 239
              DDVEQDLK+K V  R + K Q+W Y +C   L
Sbjct: 176 VDQDDVEQDLKNKPVWKRWWIKNQKWSYKVCSHLL 210

>KLLA0E21099g Chr5 complement(1885338..1885976,1886092..1886127)
           [675 bp, 224 aa] {ON} similar to uniprot|Q06999
           Saccharomyces cerevisiae YDR367W Protein of unknown
           function green fluorescent protein (GFP)-fusion protein
           localizes to the cytoplasm in a punctate pattern
          Length = 224

 Score =  195 bits (495), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 91/223 (40%), Positives = 142/223 (63%), Gaps = 4/223 (1%)

Query: 21  KSHSNMNHLPKSFFGLPLYIGVELSLGIAIFNKFCGLFGLLALFTGHPLDILQWLFYLWS 80
           +  SNM HLP++F   PLYIGVE++LG+  FNKF G++G+LALFTGHPLD +QW FY+WS
Sbjct: 2   QQQSNMVHLPQTFLSYPLYIGVEVALGVLTFNKFSGMYGVLALFTGHPLDFVQWTFYIWS 61

Query: 81  FVTLLVYLHGLMQIYQPRLAAYCLVLVVYSTDTILTCLYTLWFTRGWFI---DGDVGVXX 137
              L+V++ G+ Q+Y+P +     V  V+S DTI++C+Y LWFT  WF      DV    
Sbjct: 62  IFCLVVFISGIRQVYKPNILLMSTVTFVFSVDTIVSCIYCLWFTAVWFSQEGSTDVTDLK 121

Query: 138 XXXXXXXXXXQGSV-TVENEPVSHQSASKSYEYAFTMAFTLFALSLRFYSNFLIASFVQR 196
                     +G+  T+  +  + +SAS  YE+   +  TL  L++RFY NF+I +F Q+
Sbjct: 122 SAGTALGPAHEGTTSTISTKVDTSKSASSGYEFFLIILLTLVPLAVRFYFNFIIIAFQQQ 181

Query: 197 MFQHNKFAAGCDDVEQDLKHKSVAYRAYAKMQRWCYFLCRRYL 239
           + +  KF    +D+E +L ++++ ++   K ++WC++LC+RYL
Sbjct: 182 LLRSGKFTFDQNDIEVNLHNRNILFKWRYKFEKWCFYLCKRYL 224

>Skud_4.636 Chr4 (1135660..1135689,1135789..1136463) [705 bp, 234
           aa] {ON} YDR367W (REAL)
          Length = 234

 Score =  187 bits (474), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 96/220 (43%), Positives = 131/220 (59%), Gaps = 11/220 (5%)

Query: 31  KSFFG-LPLYIGVELSLGIAIFNKFCGLFGLLALFTGHPLDILQWLFYLWSFVTLLVYLH 89
           KSF G +PLY+ VE+ LGI+I NK  G +G+LALFTGHPLD +QW+ YLWS  TL+V+  
Sbjct: 14  KSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVAYLWSVFTLIVFSQ 73

Query: 90  GLMQIYQPRLAAYCLVLVVYSTDTILTCLYTLWFTRGWF----------IDGDVGVXXXX 139
           GL  I++P L  +  + ++Y+ DTI TC +TLWFT  WF          I          
Sbjct: 74  GLYLIHKPNLLVFSQICILYTVDTIFTCFFTLWFTTQWFTLENPTDFGSIANSTADTALR 133

Query: 140 XXXXXXXXQGSVTVENEPVSHQSASKSYEYAFTMAFTLFALSLRFYSNFLIASFVQRMFQ 199
                    G +T  +   S QSA+++YEY+ T+  TL +L  RFY N ++ SFVQ +  
Sbjct: 134 TNGLSPIMAGKLTARSADKSGQSATENYEYSITIFITLASLIFRFYFNLILGSFVQELLH 193

Query: 200 HNKFAAGCDDVEQDLKHKSVAYRAYAKMQRWCYFLCRRYL 239
           H K+    DDVEQDLK+K +  R +AK Q+ CY LC+  L
Sbjct: 194 HPKYLVDRDDVEQDLKNKPIWKRLWAKSQKSCYRLCKNLL 233

>Kpol_1062.30 s1062 complement(66657..67301) [645 bp, 214 aa] {ON}
           complement(66657..67301) [645 nt, 215 aa]
          Length = 214

 Score =  184 bits (466), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 98/221 (44%), Positives = 137/221 (61%), Gaps = 16/221 (7%)

Query: 20  TKSHSNMNHLPKSFFG-LPLYIGVELSLGIAIFNKFCGLFGLLALFTGHPLDILQWLFYL 78
           ++  ++ ++LP+SFFG LPLYIGVE  LGI I NK  G +G+LALFTGHPL++ QW+ YL
Sbjct: 8   SRVKTHYSNLPRSFFGFLPLYIGVETVLGITILNKCSGAYGILALFTGHPLNVFQWVSYL 67

Query: 79  WSFVTLLVYLHGLMQIYQPRLAAYCLVLVVYSTDTILTCLYTLWFTRGWFIDGDVGVXXX 138
           WS  TL++Y  GL Q++ P L  Y  + VV+S DT LTC++T+ F+  WF +   G+   
Sbjct: 68  WSVFTLIIYSQGLFQVHTPSLLTYSQIFVVFSFDTFLTCVFTMIFSSQWFTETGSGM--- 124

Query: 139 XXXXXXXXXQGSVTVENEPVSHQSASKSYEYAFTMAFTLFALSLRFYSNFLIASFVQRMF 198
                     GS   E      Q AS++YEY FT+  T+ AL  R Y NF++A+F Q +F
Sbjct: 125 --------SDGSGVDE----YGQGASETYEYTFTILITVVALVSRMYFNFILAAFNQELF 172

Query: 199 QHNKFAAGCDDVEQDLKHKSVAYRAYAKMQRWCYFLCRRYL 239
            H K+    DDVEQDLK+K+   + + K ++ CY L R  L
Sbjct: 173 LHPKYMVDFDDVEQDLKNKNKIVQWWIKSKKSCYNLARHIL 213

>TDEL0E01920 Chr5 complement(363042..363665,363727..363765) [663 bp,
           220 aa] {ON} Anc_5.433 YDR367W
          Length = 220

 Score =  177 bits (448), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 88/213 (41%), Positives = 132/213 (61%), Gaps = 6/213 (2%)

Query: 29  LPKSFFG-LPLYIGVELSLGIAIFNKFCGLFGLLALFTGHPLDILQWLFYLWSFVTLLVY 87
           LPKSF G +PLYIGVE++LGI+I NK  G +G+LALFTGHPLD +QW+ Y+WS  TL++ 
Sbjct: 11  LPKSFLGFVPLYIGVEIALGISIINKCSGAYGILALFTGHPLDSMQWVLYIWSIFTLIIC 70

Query: 88  LHGLMQIYQPRLAAYCLVLVVYSTDTILTCLYTLWFTRGWF-IDGDVGVXXXXXXXXXXX 146
           + GL QI++P +  +  + + +  DT+ T  +TLWFT  W+ ++G+              
Sbjct: 71  VQGLYQIHKPNVLTFSHIFITFIIDTLFTSFFTLWFTAQWYNLEGNSN----NVKDTKSS 126

Query: 147 XQGSVTVENEPVSHQSASKSYEYAFTMAFTLFALSLRFYSNFLIASFVQRMFQHNKFAAG 206
              +    +  ++HQ AS+ +EY  TM  T+ +L+ + Y  F+IASFVQ +  H ++   
Sbjct: 127 YSDAPVDYSSKIAHQGASEGFEYGVTMFITILSLAGKLYFTFIIASFVQELLLHPRYMLD 186

Query: 207 CDDVEQDLKHKSVAYRAYAKMQRWCYFLCRRYL 239
            DDVEQDLKH+S   R + K Q+ CY + +  L
Sbjct: 187 QDDVEQDLKHQSFWKRWWIKSQKSCYKMSKSLL 219

>Kwal_55.21432 s55 complement(834129..834752) [624 bp, 207 aa] {ON}
           YDR367W - Protein required for cell viability [contig
           130] FULL
          Length = 207

 Score =  175 bits (443), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 85/206 (41%), Positives = 127/206 (61%), Gaps = 6/206 (2%)

Query: 40  IGVELSLGIAIFNKFCGLFGLLALFTGHPLDILQWLFYLWSFVTLLVYLHGLMQIYQPRL 99
           +GVE+ LGI + NK  G +G+L L TGH LD +QW+ YL S +T++VY  GL  IY+P +
Sbjct: 1   MGVEIGLGITVLNKCSGFYGILGLLTGHHLDFMQWVLYLTSIITVIVYSVGLSSIYKPSV 60

Query: 100 AAYCLVLVVYSTDTILTCLYTLWFTRGWFIDGDVGVXXXXXXXXXXXXQGS------VTV 153
            +Y L+L+ ++TDT++TC +TLWF+  WF   +  +              +      ++ 
Sbjct: 61  LSYSLILLTFTTDTLVTCFFTLWFSGQWFSAKNSELTDPNSTTLQSSAGNNSPSGNLISK 120

Query: 154 ENEPVSHQSASKSYEYAFTMAFTLFALSLRFYSNFLIASFVQRMFQHNKFAAGCDDVEQD 213
             + +S QSAS+  EY FT+  T+FAL+ RFY NF+I +FVQR+ +H K+    DDVEQD
Sbjct: 121 RGDTLSSQSASQGTEYFFTILVTIFALATRFYFNFIIMAFVQRLLRHPKYVVDQDDVEQD 180

Query: 214 LKHKSVAYRAYAKMQRWCYFLCRRYL 239
           LKH+    R + + +   Y +CRRYL
Sbjct: 181 LKHRGFLRRWWIRAETHSYKICRRYL 206

>ZYRO0F10010g Chr6 (812835..812861,812941..813540) [627 bp, 208 aa]
           {ON} similar to uniprot|Q06999 Saccharomyces cerevisiae
           YDR367W Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 208

 Score =  172 bits (435), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 89/205 (43%), Positives = 122/205 (59%), Gaps = 12/205 (5%)

Query: 28  HLPKSFFG-LPLYIGVELSLGIAIFNKFCGLFGLLALFTGHPLDILQWLFYLWSFVTLLV 86
           +LPK F G LPLYIGVE++LG+ I NK  GLFG+LALFTGHPL+ LQW+ YLWS  + +V
Sbjct: 6   NLPKRFLGFLPLYIGVEVALGVTILNKCSGLFGILALFTGHPLEFLQWVLYLWSIFSFVV 65

Query: 87  YLHGLMQIYQPRLAAYCLVLVVYSTDTILTCLYTLWFTRGWFIDGDVGVXXXXXXXXXXX 146
           Y  GL    +P L  +  + + +S DT LTCL+TLWFT  W+   D              
Sbjct: 66  YAQGLFTYSKPSLLVFSQIFIAFSIDTFLTCLFTLWFTNQWYTLED-----------NTP 114

Query: 147 XQGSVTVENEPVSHQSASKSYEYAFTMAFTLFALSLRFYSNFLIASFVQRMFQHNKFAAG 206
            Q S+        +Q AS+S+E+  T+  TL +L  R Y NF++ASFVQ + QH ++   
Sbjct: 115 TQKSIAAAAMQEPNQGASQSFEFVMTIFITLASLIARLYFNFVLASFVQGLLQHPRYMVD 174

Query: 207 CDDVEQDLKHKSVAYRAYAKMQRWC 231
             DVEQ+L+ + V  R + + Q  C
Sbjct: 175 YVDVEQELRTQPVWKRVWTRTQIRC 199

>TBLA0A06520 Chr1 complement(1599308..1599928) [621 bp, 206 aa] {ON}
           Anc_5.433 YDR367W
          Length = 206

 Score =  165 bits (417), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 85/212 (40%), Positives = 122/212 (57%), Gaps = 22/212 (10%)

Query: 29  LPKSFFGL-PLYIGVELSLGIAIFNKFCGLFGLLALFTGHPLDILQWLFYLWSFVTLLVY 87
           LPK F G+ PLY+GVEL LGI IFNK  G +G+LALF GHPL+  QW+ Y WS V L +Y
Sbjct: 15  LPKRFCGVAPLYLGVELVLGITIFNKCGGAYGILALFNGHPLEFAQWVLYTWSIVCLAIY 74

Query: 88  LHGLMQIYQPRLAAYCLVLVVYSTDTILTCLYTLWFTRGWFIDGDVGVXXXXXXXXXXXX 147
             GL ++++P L  +  V + +S DT+LTC +T++FT  WF                   
Sbjct: 75  AQGLAKVHRPTLYTFSQVFIFFSVDTLLTCAFTVYFTHEWF------------------- 115

Query: 148 QGSVTVENEPVSHQSASKSYEYAFTMAFTLFALSLRFYSNFLIASFVQRMFQHNKFAAGC 207
             +      P + Q AS +YEY+ ++  TL +L  R Y NF++ SF+Q +F    +    
Sbjct: 116 --AANTTTRPPAAQGASDAYEYSVSLLVTLASLVSRLYFNFIVGSFLQELFFRPAYTLDT 173

Query: 208 DDVEQDLKHKSVAYRAYAKMQRWCYFLCRRYL 239
           D+VE +L+H S+  R + + Q +CY L RR L
Sbjct: 174 DEVETELRHSSLLRRLWLQNQHYCYILSRRIL 205

>KLTH0F16082g Chr6 complement(1305673..1306293) [621 bp, 206 aa]
           {ON} similar to uniprot|Q06999 Saccharomyces cerevisiae
           YDR367W Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 206

 Score =  157 bits (397), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 89/205 (43%), Positives = 125/205 (60%), Gaps = 5/205 (2%)

Query: 40  IGVELSLGIAIFNKFCGLFGLLALFTGHPLDILQWLFYLWSFVTLLVYLHGLMQIYQPRL 99
           +GVE+ LGI I NK  G +G+L L TGH LD +QW+ YL S  TL+VY  GL  +Y+P+L
Sbjct: 1   MGVEIGLGITILNKCSGFYGILGLLTGHQLDFMQWVLYLTSVFTLVVYSLGLTTVYKPKL 60

Query: 100 AAYCLVLVVYSTDTILTCLYTLWFTRGWFIDGDVGV---XXXXXXXXXXXXQGS--VTVE 154
             Y  VL+ ++ DT++TC +TLWF+  WF   +  +                GS  +T  
Sbjct: 61  QTYAFVLLTFTADTLITCFFTLWFSGMWFAAKESELSDPSSATQQTSGGISSGSKLLTAR 120

Query: 155 NEPVSHQSASKSYEYAFTMAFTLFALSLRFYSNFLIASFVQRMFQHNKFAAGCDDVEQDL 214
            E +S QSAS++ EY FT+  +L AL  RFY NF+I +FVQR+F+H K+    DDV+QDL
Sbjct: 121 GETLSSQSASQATEYFFTILVSLIALVSRFYFNFIILAFVQRLFRHPKYLVDQDDVDQDL 180

Query: 215 KHKSVAYRAYAKMQRWCYFLCRRYL 239
           KHK +  R + + + W Y +C  YL
Sbjct: 181 KHKKLWQRWWIRAENWSYRVCHHYL 205

>TBLA0G02010 Chr7 (525436..526077) [642 bp, 213 aa] {ON} Anc_5.433
           YDR367W
          Length = 213

 Score =  144 bits (364), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 85/203 (41%), Positives = 114/203 (56%), Gaps = 16/203 (7%)

Query: 20  TKSHSNMNHLPKSFFGL-PLYIGVELSLGIAIFNKFCGLFGLLALFTGHPLDILQWLFYL 78
           T S+S +  LP SFF L PLY+GVEL LGI I NK  G +G+LALFTGHPL I+QWL Y+
Sbjct: 6   TSSYSKV--LPNSFFILFPLYLGVELILGICILNKCSGFYGILALFTGHPLSIVQWLTYI 63

Query: 79  WSFVTLLVYLHGLMQIYQPRLAAYCLVLVVYSTDTILTCLYTLWFTRGWFIDGDVGVXXX 138
           WS  TLL+Y  G+  I +P +  +  +  ++S DTI T   TL+F   WF          
Sbjct: 64  WSIFTLLIYTQGMFHIKKPNVYLFSQIFTIFSLDTIFTLFLTLYFALDWFSSDHSN---- 119

Query: 139 XXXXXXXXXQGSVTVENEPVS---HQSASKSYEYAFTMAFTLFALSLRFYSNFLIASFVQ 195
                    + S+    + +     Q AS +YE    +  TLF L  R Y N ++ASF+ 
Sbjct: 120 ------KQSENSLQRTEKDIELSQKQGASSTYELFLIVIVTLFTLISRCYYNLVLASFLH 173

Query: 196 RMFQHNKFAAGCDDVEQDLKHKS 218
           ++F + KF    DDVE DLK+KS
Sbjct: 174 KLFINPKFIIDQDDVETDLKNKS 196

>NDAI0B05660 Chr2 (1382276..1382761) [486 bp, 161 aa] {ON} Anc_5.433
           YDR367W
          Length = 161

 Score =  125 bits (315), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 68/170 (40%), Positives = 95/170 (55%), Gaps = 12/170 (7%)

Query: 72  LQWLFYLWSFVTLLVYLHGLMQIYQPRLAAYCLVLVVYSTDTILTCLYTLWFTRGWFIDG 131
           +QW+ YLWS   L+++  GL QI++P L  +  + V ++ DT+ TC +TLWFT  WF  G
Sbjct: 1   MQWVAYLWSIFCLIIFAQGLYQIHKPTLLTFSQITVFFTLDTLFTCFFTLWFTAQWF-QG 59

Query: 132 DVGVXXXXXXXXXXXXQGSVTVENEPVS--HQSASKSYEYAFTMAFTLFALSLRFYSNFL 189
             G             Q S  V+    S   Q A+  YEY  TM  T   L+ RFY N +
Sbjct: 60  SEG---------ESAVQTSTGVQKRDTSLASQGATAGYEYFVTMLITFITLTFRFYFNCI 110

Query: 190 IASFVQRMFQHNKFAAGCDDVEQDLKHKSVAYRAYAKMQRWCYFLCRRYL 239
           +ASFVQ +  + KF    DDVEQDLK+KS+  R + K +++CY LC+  L
Sbjct: 111 LASFVQELLSNPKFMIDQDDVEQDLKNKSMVKRWWIKNEKFCYRLCKSVL 160

>TPHA0K01810 Chr11 (384112..385578) [1467 bp, 488 aa] {ON} Anc_4.74
           YGL038C
          Length = 488

 Score = 29.6 bits (65), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 31/60 (51%), Gaps = 5/60 (8%)

Query: 20  TKSHSNMNHLPKSFFGL---PLYIGVELSLGIAIFNKFCGLFGLLALFTGHPLDILQWLF 76
           T+S  N NH+P SFF L   P+ +   + L I  F+   G  G  A  + HPL  ++ +F
Sbjct: 417 TESLLNDNHIPWSFFSLIQIPVLVDDVMVLPITSFSPDVGQMG--ARDSSHPLAYVKHMF 474

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.330    0.141    0.458 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 23,372,856
Number of extensions: 894774
Number of successful extensions: 2768
Number of sequences better than 10.0: 28
Number of HSP's gapped: 2797
Number of HSP's successfully gapped: 28
Length of query: 239
Length of database: 53,481,399
Length adjustment: 106
Effective length of query: 133
Effective length of database: 41,326,803
Effective search space: 5496464799
Effective search space used: 5496464799
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 64 (29.3 bits)