Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AER252C5.426ON1459145977740.0
Ecym_55255.426ON1459145969940.0
SAKL0G02354g5.426ON1458145968330.0
KLTH0F16236g5.426ON1460146067680.0
NDAI0C016205.426ON1460146066080.0
NCAS0H020405.426ON1460146166020.0
KLLA0E21253g5.426ON1457145166010.0
TDEL0E019905.426ON1460146165660.0
KAFR0D050305.426ON1462146265320.0
Kpol_1016.95.426ON1460146065190.0
YOR116C (RPO31)5.426ON1460146065140.0
Smik_15.2945.426ON1460146065080.0
ZYRO0F09856g5.426ON1458145965070.0
TBLA0A037205.426ON1458145964910.0
Skud_15.2795.426ON1460146064860.0
Suva_8.1695.426ON1460146064730.0
CAGL0L11660g5.426ON1459145664250.0
KNAG0B042405.426ON1455146363760.0
TPHA0H017605.426ON1459145563520.0
Kwal_55.214595.426ON1148114453350.0
ZYRO0F05918g7.314ON1744149618290.0
SAKL0F10472g7.314ON1730149418130.0
Kwal_56.244897.314ON1728151817990.0
KLTH0H02046g7.314ON1740150217970.0
Ecym_80657.314ON1743150516940.0
TPHA0A030707.314ON1719150816640.0
Kwal_55.21464singletonOFF32031813721e-177
Kpol_162.1singletonON1311116014571e-177
KAFR0B010607.314ON168592714471e-172
KNAG0C039707.314ON172192914341e-170
YDL140C (RPO21)7.314ON173392614261e-169
CAGL0I03828g7.314ON171592314251e-169
KLLA0F05071g7.314ON172093614251e-169
ADR086C7.314ON174592914251e-169
Smik_4.957.314ON171992614221e-168
Suva_4.1047.314ON173392614201e-168
Skud_4.1147.314ON172692614101e-167
TDEL0C023207.314ON172792514101e-167
TBLA0F021707.314ON172693214071e-166
NDAI0A021307.314ON172992514071e-166
NCAS0A139007.314ON171692514021e-166
CAGL0E05500g7.51ON164397511331e-129
Kpol_1040.37.51ON165697611241e-128
TDEL0H040007.51ON166599111151e-126
KLTH0D01628g7.51ON165498810951e-124
ZYRO0D04532g7.51ON166798010951e-124
Kwal_26.69797.51ON165498010911e-123
TPHA0H028007.51ON1648110310911e-123
YOR341W (RPA190)7.51ON166497610871e-123
KLLA0F23243g7.51ON165397610821e-122
KAFR0K005407.51ON166297410781e-121
TBLA0E019307.51ON165998710781e-121
Skud_15.5067.51ON166597910781e-121
NDAI0H012007.51ON166998010771e-121
NCAS0F007307.51ON167492110691e-120
Smik_15.5197.51ON166598810641e-119
ADR374C7.51ON164097510611e-119
Suva_8.3917.51ON166597610581e-119
SAKL0B10736g7.51ON165097510461e-117
KNAG0D049707.51ON16717159231e-101
Kpol_1019.277.314ON3641111959e-15
KNAG0M023602.610ON91093830.59
KLTH0F19338g3.22ON129073830.63
Kwal_55.220763.22ON128683820.82
Kpol_1038.203.22ON131357791.9
Kpol_1041.262.395ON467113772.4
TPHA0H014405.359ON87555773.2
KLLA0E14477gsingletonON716133763.3
Kwal_27.112328.331ON333657764.2
NCAS0E018507.192ON38029754.8
YAL034C (FUN19)7.55ON41371737.3
SAKL0B04466gna 1ON373657210.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AER252C
         (1459 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AER252C Chr5 complement(1101343..1105722) [4380 bp, 1459 aa] {ON...  2999   0.0  
Ecym_5525 Chr5 complement(1063773..1068152) [4380 bp, 1459 aa] {...  2698   0.0  
SAKL0G02354g Chr7 complement(193623..197999) [4377 bp, 1458 aa] ...  2636   0.0  
KLTH0F16236g Chr6 (1316542..1320924) [4383 bp, 1460 aa] {ON} hig...  2611   0.0  
NDAI0C01620 Chr3 (346478..350860) [4383 bp, 1460 aa] {ON} Anc_5....  2550   0.0  
NCAS0H02040 Chr8 complement(393711..398093) [4383 bp, 1460 aa] {...  2547   0.0  
KLLA0E21253g Chr5 (1896457..1900830) [4374 bp, 1457 aa] {ON} hig...  2547   0.0  
TDEL0E01990 Chr5 (373218..377600) [4383 bp, 1460 aa] {ON} Anc_5....  2533   0.0  
KAFR0D05030 Chr4 complement(988159..992547) [4389 bp, 1462 aa] {...  2520   0.0  
Kpol_1016.9 s1016 (19972..24354) [4383 bp, 1460 aa] {ON} (19972....  2515   0.0  
YOR116C Chr15 complement(539763..544145) [4383 bp, 1460 aa] {ON}...  2513   0.0  
Smik_15.294 Chr15 complement(500962..505344) [4383 bp, 1460 aa] ...  2511   0.0  
ZYRO0F09856g Chr6 complement(798821..803197) [4377 bp, 1458 aa] ...  2511   0.0  
TBLA0A03720 Chr1 complement(929751..934127) [4377 bp, 1458 aa] {...  2504   0.0  
Skud_15.279 Chr15 complement(496216..500598) [4383 bp, 1460 aa] ...  2503   0.0  
Suva_8.169 Chr8 complement(297556..301938) [4383 bp, 1460 aa] {O...  2498   0.0  
CAGL0L11660g Chr12 (1245685..1250064) [4380 bp, 1459 aa] {ON} hi...  2479   0.0  
KNAG0B04240 Chr2 (806212..810579) [4368 bp, 1455 aa] {ON} Anc_5....  2460   0.0  
TPHA0H01760 Chr8 complement(402254..406633) [4380 bp, 1459 aa] {...  2451   0.0  
Kwal_55.21459 s55 (846902..850348) [3447 bp, 1148 aa] {ON} YOR11...  2059   0.0  
ZYRO0F05918g Chr6 (487056..492290) [5235 bp, 1744 aa] {ON} highl...   709   0.0  
SAKL0F10472g Chr6 (808869..814061) [5193 bp, 1730 aa] {ON} highl...   702   0.0  
Kwal_56.24489 s56 (1018237..1023423) [5187 bp, 1728 aa] {ON} YDL...   697   0.0  
KLTH0H02046g Chr8 complement(182788..188010) [5223 bp, 1740 aa] ...   696   0.0  
Ecym_8065 Chr8 (139544..144775) [5232 bp, 1743 aa] {ON} similar ...   657   0.0  
TPHA0A03070 Chr1 complement(671766..676925) [5160 bp, 1719 aa] {...   645   0.0  
Kwal_55.21464 s55 (850323..851285) [963 bp, 320 aa] {OFF} YOR116...   533   e-177
Kpol_162.1 s162 complement(211..4146) [3936 bp, 1311 aa] {ON} co...   565   e-177
KAFR0B01060 Chr2 complement(197351..202408) [5058 bp, 1685 aa] {...   561   e-172
KNAG0C03970 Chr3 complement(778936..784101) [5166 bp, 1721 aa] {...   556   e-170
YDL140C Chr4 complement(205360..210561) [5202 bp, 1733 aa] {ON} ...   553   e-169
CAGL0I03828g Chr9 complement(328922..334069) [5148 bp, 1715 aa] ...   553   e-169
KLLA0F05071g Chr6 complement(496371..501533) [5163 bp, 1720 aa] ...   553   e-169
ADR086C Chr4 complement(860406..865643) [5238 bp, 1745 aa] {ON} ...   553   e-169
Smik_4.95 Chr4 complement(182198..187357) [5160 bp, 1719 aa] {ON...   552   e-168
Suva_4.104 Chr4 complement(193257..193711,193754..193782,194161....   551   e-168
Skud_4.114 Chr4 complement(201053..206233) [5181 bp, 1726 aa] {O...   547   e-167
TDEL0C02320 Chr3 complement(403851..409034) [5184 bp, 1727 aa] {...   547   e-167
TBLA0F02170 Chr6 (535350..540530) [5181 bp, 1726 aa] {ON} Anc_7....   546   e-166
NDAI0A02130 Chr1 complement(477808..482997) [5190 bp, 1729 aa] {...   546   e-166
NCAS0A13900 Chr1 (2728572..2733722) [5151 bp, 1716 aa] {ON} Anc_...   544   e-166
CAGL0E05500g Chr5 (539213..544144) [4932 bp, 1643 aa] {ON} highl...   441   e-129
Kpol_1040.3 s1040 complement(6642..11612) [4971 bp, 1656 aa] {ON...   437   e-128
TDEL0H04000 Chr8 (680730..685727) [4998 bp, 1665 aa] {ON} Anc_7....   434   e-126
KLTH0D01628g Chr4 complement(157597..162561) [4965 bp, 1654 aa] ...   426   e-124
ZYRO0D04532g Chr4 (374177..379180) [5004 bp, 1667 aa] {ON} highl...   426   e-124
Kwal_26.6979 s26 complement(150350..155314) [4965 bp, 1654 aa] {...   424   e-123
TPHA0H02800 Chr8 (659254..664200) [4947 bp, 1648 aa] {ON} Anc_7....   424   e-123
YOR341W Chr15 (960987..965981) [4995 bp, 1664 aa] {ON}  RPA190RN...   423   e-123
KLLA0F23243g Chr6 (2165407..2170368) [4962 bp, 1653 aa] {ON} hig...   421   e-122
KAFR0K00540 Chr11 complement(114196..119184) [4989 bp, 1662 aa] ...   419   e-121
TBLA0E01930 Chr5 (468692..473671) [4980 bp, 1659 aa] {ON} Anc_7....   419   e-121
Skud_15.506 Chr15 (901437..906434) [4998 bp, 1665 aa] {ON} YOR34...   419   e-121
NDAI0H01200 Chr8 complement(280165..285174) [5010 bp, 1669 aa] {...   419   e-121
NCAS0F00730 Chr6 complement(143500..148524) [5025 bp, 1674 aa] {...   416   e-120
Smik_15.519 Chr15 (910592..915589) [4998 bp, 1665 aa] {ON} YOR34...   414   e-119
ADR374C Chr4 complement(1372609..1377531) [4923 bp, 1640 aa] {ON...   413   e-119
Suva_8.391 Chr8 (702691..707688) [4998 bp, 1665 aa] {ON} YOR341W...   412   e-119
SAKL0B10736g Chr2 (925889..930841) [4953 bp, 1650 aa] {ON} highl...   407   e-117
KNAG0D04970 Chr4 (905179..910194) [5016 bp, 1671 aa] {ON} Anc_7....   360   e-101
Kpol_1019.27 s1019 complement(51067..52161) [1095 bp, 364 aa] {O...    80   9e-15
KNAG0M02360 Chr13 complement(436455..439187) [2733 bp, 910 aa] {...    37   0.59 
KLTH0F19338g Chr6 (1564555..1568427) [3873 bp, 1290 aa] {ON} sim...    37   0.63 
Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON} YOL...    36   0.82 
Kpol_1038.20 s1038 complement(43719..47660) [3942 bp, 1313 aa] {...    35   1.9  
Kpol_1041.26 s1041 (68074..69477) [1404 bp, 467 aa] {ON} (68074....    34   2.4  
TPHA0H01440 Chr8 complement(322547..325174) [2628 bp, 875 aa] {O...    34   3.2  
KLLA0E14477g Chr5 complement(1281791..1283941) [2151 bp, 716 aa]...    34   3.3  
Kwal_27.11232 s27 (697964..707974) [10011 bp, 3336 aa] {ON} YDR1...    34   4.2  
NCAS0E01850 Chr5 (360472..361614) [1143 bp, 380 aa] {ON} Anc_7.1...    33   4.8  
YAL034C Chr1 complement(80710..81951) [1242 bp, 413 aa] {ON}  FU...    33   7.3  
SAKL0B04466g Chr2 complement(393589..394710) [1122 bp, 373 aa] {...    32   10.0 

>AER252C Chr5 complement(1101343..1105722) [4380 bp, 1459 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YOR116C
            (RPO31)
          Length = 1459

 Score = 2999 bits (7774), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1445/1459 (99%), Positives = 1445/1459 (99%)

Query: 1    MKEVVVDILPKRISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGV 60
            MKEVVVDILPKRISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGV
Sbjct: 1    MKEVVVDILPKRISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGV 60

Query: 61   SSSQAECSTCHGTLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNEEDK 120
            SSSQAECSTCHGTLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNEEDK
Sbjct: 61   SSSQAECSTCHGTLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNEEDK 120

Query: 121  RQFLSELRRPGIDNLRRMATLKKVLDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXLKIIH 180
            RQFLSELRRPGIDNLRRMATLKKVLDQCKKQRRCLHCGMLN              LKIIH
Sbjct: 121  RQFLSELRRPGIDNLRRMATLKKVLDQCKKQRRCLHCGMLNGVVKKAAAGSGSAALKIIH 180

Query: 181  DTFRWVGKKSAPEKDKWIGDWNQVLQHSPELERYMKRTMENLNPLKTLNLFKQISPQDCE 240
            DTFRWVGKKSAPEKDKWIGDWNQVLQHSPELERYMKRTMENLNPLKTLNLFKQISPQDCE
Sbjct: 181  DTFRWVGKKSAPEKDKWIGDWNQVLQHSPELERYMKRTMENLNPLKTLNLFKQISPQDCE 240

Query: 241  LLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQMAVAMYINSDSVNPALMPGGNGGGKTKPIRGFCQRLKGKQ 360
            AGLEKGISINNMMEQWDYLQMAVAMYINSDSVNPALMPGGNGGGKTKPIRGFCQRLKGKQ
Sbjct: 301  AGLEKGISINNMMEQWDYLQMAVAMYINSDSVNPALMPGGNGGGKTKPIRGFCQRLKGKQ 360

Query: 361  GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKHKLQQLIV 420
            GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKHKLQQLIV
Sbjct: 361  GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKHKLQQLIV 420

Query: 421  NGANVHPGANYLLKKNEEARRNLRYGDRIKLAKNLQIGDVVERHLEDGDVVLFNRQPSLH 480
            NGANVHPGANYLLKKNEEARRNLRYGDRIKLAKNLQIGDVVERHLEDGDVVLFNRQPSLH
Sbjct: 421  NGANVHPGANYLLKKNEEARRNLRYGDRIKLAKNLQIGDVVERHLEDGDVVLFNRQPSLH 480

Query: 481  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 540
            RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL
Sbjct: 481  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 540

Query: 541  LTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFVQMLSMMSDGNLQFDIPPPAIMRPH 600
            LTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFVQMLSMMSDGNLQFDIPPPAIMRPH
Sbjct: 541  LTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFVQMLSMMSDGNLQFDIPPPAIMRPH 600

Query: 601  YLWTGKQLFSLLIKPNKKSPVIINLDAKNKVYIAPKNKAYPNEMSANDGYVVIRGSNILS 660
            YLWTGKQLFSLLIKPNKKSPVIINLDAKNKVYIAPKNKAYPNEMSANDGYVVIRGSNILS
Sbjct: 601  YLWTGKQLFSLLIKPNKKSPVIINLDAKNKVYIAPKNKAYPNEMSANDGYVVIRGSNILS 660

Query: 661  GVMDKSVLGDGKKHSVFYTILRDFGPQEATQAMNRMAKLCARYLGNRGFSIGISDVTPGV 720
            GVMDKSVLGDGKKHSVFYTILRDFGPQEATQAMNRMAKLCARYLGNRGFSIGISDVTPGV
Sbjct: 661  GVMDKSVLGDGKKHSVFYTILRDFGPQEATQAMNRMAKLCARYLGNRGFSIGISDVTPGV 720

Query: 721  ELKATKEEMVEIAYAKCDELIDLYKRGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVC 780
            ELKATKEEMVEIAYAKCDELIDLYKRGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVC
Sbjct: 721  ELKATKEEMVEIAYAKCDELIDLYKRGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVC 780

Query: 781  IRELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKT 840
            IRELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKT
Sbjct: 781  IRELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKT 840

Query: 841  PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 900
            PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD
Sbjct: 841  PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 900

Query: 901  NTVRTSSNGIVQFTYGGDGLDPLNMEGNAKPVNFNRSWDHANNITYNHDDKGMLPYQILE 960
            NTVRTSSNGIVQFTYGGDGLDPLNMEGNAKPVNFNRSWDHANNITYNHDDKGMLPYQILE
Sbjct: 901  NTVRTSSNGIVQFTYGGDGLDPLNMEGNAKPVNFNRSWDHANNITYNHDDKGMLPYQILE 960

Query: 961  ETNAILHPLEQQLSRYDNVGNPLAPGLENEELYIDQHDAEREFYQSLRTYMSEKARKLAD 1020
            ETNAILHPLEQQLSRYDNVGNPLAPGLENEELYIDQHDAEREFYQSLRTYMSEKARKLAD
Sbjct: 961  ETNAILHPLEQQLSRYDNVGNPLAPGLENEELYIDQHDAEREFYQSLRTYMSEKARKLAD 1020

Query: 1021 ITKSRGLKELYHAPALELQLMDLDASCPEVDVKSVNQLCKISSKLVRTFLDIAISKYRKA 1080
            ITKSRGLKELYHAPALELQLMDLDASCPEVDVKSVNQLCKISSKLVRTFLDIAISKYRKA
Sbjct: 1021 ITKSRGLKELYHAPALELQLMDLDASCPEVDVKSVNQLCKISSKLVRTFLDIAISKYRKA 1080

Query: 1081 KVEPGTAVGAIGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1140
            KVEPGTAVGAIGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII
Sbjct: 1081 KVEPGTAVGAIGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1140

Query: 1141 NATLVNDDDERAARVVKGRVEKTLLSDVIFYIQDVYRDNMSFLQVKVDLATIEKLQLELT 1200
            NATLVNDDDERAARVVKGRVEKTLLSDVIFYIQDVYRDNMSFLQVKVDLATIEKLQLELT
Sbjct: 1141 NATLVNDDDERAARVVKGRVEKTLLSDVIFYIQDVYRDNMSFLQVKVDLATIEKLQLELT 1200

Query: 1201 VEDIAIAITSAPKLKISTGDVSIVGRNKININVCNDLDKAKSISTLASEPHENDVFFKMQ 1260
            VEDIAIAITSAPKLKISTGDVSIVGRNKININVCNDLDKAKSISTLASEPHENDVFFKMQ
Sbjct: 1201 VEDIAIAITSAPKLKISTGDVSIVGRNKININVCNDLDKAKSISTLASEPHENDVFFKMQ 1260

Query: 1261 HLRRALPGIVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVVGYKTKTNHFLE 1320
            HLRRALPGIVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVVGYKTKTNHFLE
Sbjct: 1261 HLRRALPGIVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVVGYKTKTNHFLE 1320

Query: 1321 VYDVLGIEAARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRD 1380
            VYDVLGIEAARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRD
Sbjct: 1321 VYDVLGIEAARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRD 1380

Query: 1381 SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMTIGTGSFKVVKGTNISPDDL 1440
            SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMTIGTGSFKVVKGTNISPDDL
Sbjct: 1381 SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMTIGTGSFKVVKGTNISPDDL 1440

Query: 1441 KPKPTLFENLCSLNTLKVN 1459
            KPKPTLFENLCSLNTLKVN
Sbjct: 1441 KPKPTLFENLCSLNTLKVN 1459

>Ecym_5525 Chr5 complement(1063773..1068152) [4380 bp, 1459 aa] {ON}
            similar to Ashbya gossypii AER252C
          Length = 1459

 Score = 2698 bits (6994), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1291/1459 (88%), Positives = 1382/1459 (94%)

Query: 1    MKEVVVDILPKRISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGV 60
            MKEVVVD+ PK+I GL FSALSASDIVAQSEVEIFTRDLFDLE+GRAPK+GGALDS+MGV
Sbjct: 1    MKEVVVDVAPKKIKGLHFSALSASDIVAQSEVEIFTRDLFDLENGRAPKQGGALDSKMGV 60

Query: 61   SSSQAECSTCHGTLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNEEDK 120
            SSSQAECSTCHG LASCHGHFGHIKLALPVFH+GYFKATIQILQSICKNCA +LL+EE+K
Sbjct: 61   SSSQAECSTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQSICKNCAAILLSEEEK 120

Query: 121  RQFLSELRRPGIDNLRRMATLKKVLDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXLKIIH 180
            RQFL+ELRRPGIDNLRRMATL+KVLDQCKKQRRCLHCG LN              LKIIH
Sbjct: 121  RQFLAELRRPGIDNLRRMATLRKVLDQCKKQRRCLHCGALNGVVKKAATGSGSAALKIIH 180

Query: 181  DTFRWVGKKSAPEKDKWIGDWNQVLQHSPELERYMKRTMENLNPLKTLNLFKQISPQDCE 240
            DTFRWVGKKSAPEK+KWIGDWNQVLQH+PELERYMKR+M+NLNPLKTLNLFKQ+  QDCE
Sbjct: 181  DTFRWVGKKSAPEKEKWIGDWNQVLQHNPELERYMKRSMDNLNPLKTLNLFKQVRAQDCE 240

Query: 241  LLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQMAVAMYINSDSVNPALMPGGNGGGKTKPIRGFCQRLKGKQ 360
            AGLEKGISINNMMEQWDYLQMAVAMYINSDSVNPALMPGG GGGKTKPIRGFCQRLKGKQ
Sbjct: 301  AGLEKGISINNMMEQWDYLQMAVAMYINSDSVNPALMPGGTGGGKTKPIRGFCQRLKGKQ 360

Query: 361  GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKHKLQQLIV 420
            GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLT+PE+VTRYNKHKLQQLI+
Sbjct: 361  GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPERVTRYNKHKLQQLII 420

Query: 421  NGANVHPGANYLLKKNEEARRNLRYGDRIKLAKNLQIGDVVERHLEDGDVVLFNRQPSLH 480
            NG NVHPGANY+LKKNE+ARRNLRYGDRIKLAKN+QIGDVVERH+EDGDVVLFNRQPSLH
Sbjct: 421  NGPNVHPGANYMLKKNEDARRNLRYGDRIKLAKNIQIGDVVERHIEDGDVVLFNRQPSLH 480

Query: 481  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 540
            RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL
Sbjct: 481  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 540

Query: 541  LTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFVQMLSMMSDGNLQFDIPPPAIMRPH 600
            LTPKSGEPII+ATQDFITGSYLISHKDSFFDRATF Q+LSMM+D N+QFD+PPPAI++P 
Sbjct: 541  LTPKSGEPIISATQDFITGSYLISHKDSFFDRATFTQLLSMMADANMQFDLPPPAIIKPC 600

Query: 601  YLWTGKQLFSLLIKPNKKSPVIINLDAKNKVYIAPKNKAYPNEMSANDGYVVIRGSNILS 660
            YLWTGKQ+FSLLI+PNKKSPVIINLDAKNKVY+ PKNK++PNEMS+NDGYV+IRGS IL 
Sbjct: 601  YLWTGKQVFSLLIRPNKKSPVIINLDAKNKVYLPPKNKSFPNEMSSNDGYVIIRGSEILC 660

Query: 661  GVMDKSVLGDGKKHSVFYTILRDFGPQEATQAMNRMAKLCARYLGNRGFSIGISDVTPGV 720
            GVMDKSVLGDGKKHSVFYTILRDFGP EA +AMNRMAKLCARYLGNRGFSIGI+DVTPG 
Sbjct: 661  GVMDKSVLGDGKKHSVFYTILRDFGPYEAAKAMNRMAKLCARYLGNRGFSIGINDVTPGK 720

Query: 721  ELKATKEEMVEIAYAKCDELIDLYKRGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVC 780
            ELKA KEEMVEIAYAKCDELIDL+KRG+LETQPGCNEEQTLEAKIGGLLSKVREEVG+VC
Sbjct: 721  ELKAKKEEMVEIAYAKCDELIDLFKRGELETQPGCNEEQTLEAKIGGLLSKVREEVGEVC 780

Query: 781  IRELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKT 840
            IRELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSKT
Sbjct: 781  IRELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFAKNSKT 840

Query: 841  PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 900
            PQSKGFVR+SFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD
Sbjct: 841  PQSKGFVRSSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 900

Query: 901  NTVRTSSNGIVQFTYGGDGLDPLNMEGNAKPVNFNRSWDHANNITYNHDDKGMLPYQILE 960
            NTVRTSSNG+VQFTYGGDGLDPLNMEGNA+PVNFNRSWDHANNIT+N+++ G+LPYQI+E
Sbjct: 901  NTVRTSSNGVVQFTYGGDGLDPLNMEGNAQPVNFNRSWDHANNITFNNEEPGLLPYQIME 960

Query: 961  ETNAILHPLEQQLSRYDNVGNPLAPGLENEELYIDQHDAEREFYQSLRTYMSEKARKLAD 1020
             +N+IL PLE+QL R DNVGN ++  L + + YIDQ+DAER+FYQSLRTYM+ KA +LA 
Sbjct: 961  TSNSILVPLERQLLRLDNVGNAISADLGSNDEYIDQNDAERDFYQSLRTYMTAKAHRLAQ 1020

Query: 1021 ITKSRGLKELYHAPALELQLMDLDASCPEVDVKSVNQLCKISSKLVRTFLDIAISKYRKA 1080
            I KS+GLK L   PA EL+ MDLDAS    D+ S+NQLCKIS  LV TFL+IAISKY KA
Sbjct: 1021 IRKSKGLKSLLEEPAQELKYMDLDASASTADLNSINQLCKISYNLVTTFLNIAISKYHKA 1080

Query: 1081 KVEPGTAVGAIGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1140
            KVEPGTAVGAIGAHSIGEPGTQMTLKTFHFAGVASMN+TLGVPRIKEIINASKVISTPII
Sbjct: 1081 KVEPGTAVGAIGAHSIGEPGTQMTLKTFHFAGVASMNITLGVPRIKEIINASKVISTPII 1140

Query: 1141 NATLVNDDDERAARVVKGRVEKTLLSDVIFYIQDVYRDNMSFLQVKVDLATIEKLQLELT 1200
            NA LVND+DERAARVVKGR+EKTLLSDV+FYIQDVYRDNMSF+QVKVDL+TIEKLQLELT
Sbjct: 1141 NALLVNDNDERAARVVKGRIEKTLLSDVVFYIQDVYRDNMSFIQVKVDLSTIEKLQLELT 1200

Query: 1201 VEDIAIAITSAPKLKISTGDVSIVGRNKININVCNDLDKAKSISTLASEPHENDVFFKMQ 1260
            +EDIAIAI+ APKLKISTGDVSI+G+NKINI+V NDL+K KSISTL SEP+ENDVF++MQ
Sbjct: 1201 IEDIAIAISRAPKLKISTGDVSIIGKNKINISVGNDLEKGKSISTLVSEPNENDVFYRMQ 1260

Query: 1261 HLRRALPGIVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVVGYKTKTNHFLE 1320
            HLRRALP IVVKGLPDISRAVINI +DGKRELLVEGYGLRDVMTTDGV+GYKTKTNHFLE
Sbjct: 1261 HLRRALPNIVVKGLPDISRAVINILEDGKRELLVEGYGLRDVMTTDGVIGYKTKTNHFLE 1320

Query: 1321 VYDVLGIEAARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRD 1380
            V++VLGIEAARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRD
Sbjct: 1321 VFEVLGIEAARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRD 1380

Query: 1381 SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMTIGTGSFKVVKGTNISPDDL 1440
            SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTM+IGTGSFKVV+GTNIS D+L
Sbjct: 1381 SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVRGTNISMDEL 1440

Query: 1441 KPKPTLFENLCSLNTLKVN 1459
            KP PTLFENLC+   LKV+
Sbjct: 1441 KPNPTLFENLCNNTALKVS 1459

>SAKL0G02354g Chr7 complement(193623..197999) [4377 bp, 1458 aa] {ON}
            highly similar to uniprot|P04051 Saccharomyces cerevisiae
            YOR116C
          Length = 1458

 Score = 2636 bits (6833), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1256/1459 (86%), Positives = 1349/1459 (92%), Gaps = 1/1459 (0%)

Query: 1    MKEVVVDILPKRISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGV 60
            MKEVVVDI PK+I GLEFSALSASDIVAQSEVEI TRDLFDLE+GR PK GGALD++MGV
Sbjct: 1    MKEVVVDIAPKKIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGV 60

Query: 61   SSSQAECSTCHGTLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNEEDK 120
            SSS AECSTCHG LASCHGHFGHIKLALPVFHVGYFKATIQILQ +CKNCA +LL+++DK
Sbjct: 61   SSSHAECSTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDK 120

Query: 121  RQFLSELRRPGIDNLRRMATLKKVLDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXLKIIH 180
            RQFL+ELRRPG+DNLRRM TLKK+LDQCKKQRRCLHCGMLN              LKIIH
Sbjct: 121  RQFLAELRRPGVDNLRRMGTLKKILDQCKKQRRCLHCGMLNGVVKKAAAGSGSASLKIIH 180

Query: 181  DTFRWVGKKSAPEKDKWIGDWNQVLQHSPELERYMKRTMENLNPLKTLNLFKQISPQDCE 240
            DTFRWVGKKSAPEK+KW+GDW QVL+H+PELERYMKR M++LNPLKTLNLFKQ+ P+DCE
Sbjct: 181  DTFRWVGKKSAPEKEKWVGDWKQVLEHNPELERYMKRCMDDLNPLKTLNLFKQVKPEDCE 240

Query: 241  LLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDS VK+GRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSAVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQMAVAMYINSDSVNPALMPGGNGGGKTKPIRGFCQRLKGKQ 360
            AGLEKGISINNMMEQWDYLQ+AVAMYINSDSVNPA+MPG +GG KTKPIRGFCQRLKGKQ
Sbjct: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGASGG-KTKPIRGFCQRLKGKQ 359

Query: 361  GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKHKLQQLIV 420
            GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLT+PEKVTRYNKHKLQQL++
Sbjct: 360  GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQLVI 419

Query: 421  NGANVHPGANYLLKKNEEARRNLRYGDRIKLAKNLQIGDVVERHLEDGDVVLFNRQPSLH 480
            NG N+HPGANYLLKKN++ARRNLRYGDR+KLAKNLQ GDVVERH+EDGDVVLFNRQPSLH
Sbjct: 420  NGPNIHPGANYLLKKNDDARRNLRYGDRMKLAKNLQYGDVVERHIEDGDVVLFNRQPSLH 479

Query: 481  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 540
            RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL
Sbjct: 480  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 539

Query: 541  LTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFVQMLSMMSDGNLQFDIPPPAIMRPH 600
            LTPKSGEPIIAATQDFITGSYLISHKDSFFDRAT  Q+LSMMSDGN+QFD+PPPA+M+PH
Sbjct: 540  LTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSDGNMQFDLPPPAVMKPH 599

Query: 601  YLWTGKQLFSLLIKPNKKSPVIINLDAKNKVYIAPKNKAYPNEMSANDGYVVIRGSNILS 660
            YLWTGKQ+FSLLI+PNKKSPVIIN+DAKNKV++ PK+K  PNEMS NDG+VVIRGS ILS
Sbjct: 600  YLWTGKQVFSLLIRPNKKSPVIINVDAKNKVFMPPKHKGLPNEMSVNDGFVVIRGSEILS 659

Query: 661  GVMDKSVLGDGKKHSVFYTILRDFGPQEATQAMNRMAKLCARYLGNRGFSIGISDVTPGV 720
            GVMDKSVLGDGKKHSVFYTILRD+GPQEA  AMNRMAKLCARYLGNRGFSIGISDVTPG 
Sbjct: 660  GVMDKSVLGDGKKHSVFYTILRDYGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPGA 719

Query: 721  ELKATKEEMVEIAYAKCDELIDLYKRGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVC 780
            +LK  KE+ VE AYAKCDELID + +GKLETQPGCNEEQTLEAKIGGLLSKVREEVG+VC
Sbjct: 720  DLKQKKEDKVEEAYAKCDELIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC 779

Query: 781  IRELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKT 840
            IRELDNLNAPLIMATCGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKT
Sbjct: 780  IRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKT 839

Query: 841  PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 900
            PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD
Sbjct: 840  PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 899

Query: 901  NTVRTSSNGIVQFTYGGDGLDPLNMEGNAKPVNFNRSWDHANNITYNHDDKGMLPYQILE 960
            NTVRTSSNGIVQFTYGGDGLDPL+MEGNA+PVNFNRSWDHANNIT+ H D G+LPYQI+E
Sbjct: 900  NTVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWDHANNITFTHKDFGLLPYQIIE 959

Query: 961  ETNAILHPLEQQLSRYDNVGNPLAPGLENEELYIDQHDAEREFYQSLRTYMSEKARKLAD 1020
             TN+IL PLEQ+L R+DN+GN L    E +  YIDQHDAER FYQSLR YM+EKA  LA 
Sbjct: 960  NTNSILKPLEQKLVRFDNLGNKLNKEDEEKIEYIDQHDAERNFYQSLRDYMTEKATHLAK 1019

Query: 1021 ITKSRGLKELYHAPALELQLMDLDASCPEVDVKSVNQLCKISSKLVRTFLDIAISKYRKA 1080
            I K++GLK L   PA EL++++LD   PE  + +VNQLCKIS  LV TFL IAISKY +A
Sbjct: 1020 IRKAKGLKTLLDEPAPELKILNLDEQYPEYILTAVNQLCKISKNLVETFLGIAISKYHRA 1079

Query: 1081 KVEPGTAVGAIGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1140
            KVEPGTAVGAIGA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII
Sbjct: 1080 KVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1139

Query: 1141 NATLVNDDDERAARVVKGRVEKTLLSDVIFYIQDVYRDNMSFLQVKVDLATIEKLQLELT 1200
            NA LVND DERAARVVKGR+EKT+LSDV++YIQDVY+DN+SF+Q KVDL TIEKLQLELT
Sbjct: 1140 NAVLVNDGDERAARVVKGRIEKTILSDVVYYIQDVYKDNLSFIQAKVDLGTIEKLQLELT 1199

Query: 1201 VEDIAIAITSAPKLKISTGDVSIVGRNKININVCNDLDKAKSISTLASEPHENDVFFKMQ 1260
            +EDIA+AIT A KLKIST DVSIVGRNKININV  +  KAKSIST A EP EN VF++MQ
Sbjct: 1200 IEDIAVAITRASKLKISTADVSIVGRNKININVFPEGYKAKSISTSAKEPSENAVFYRMQ 1259

Query: 1261 HLRRALPGIVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVVGYKTKTNHFLE 1320
            HLRRALPGIVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGV+G KTKTNH LE
Sbjct: 1260 HLRRALPGIVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKTNHILE 1319

Query: 1321 VYDVLGIEAARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRD 1380
            +++VLGIEAARTSI+ EIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRD
Sbjct: 1320 IFNVLGIEAARTSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRD 1379

Query: 1381 SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMTIGTGSFKVVKGTNISPDDL 1440
            SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTM+IGTGSFKVVKGT+IS +DL
Sbjct: 1380 SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTSISEEDL 1439

Query: 1441 KPKPTLFENLCSLNTLKVN 1459
            KPK TLFE+LC+   LK +
Sbjct: 1440 KPKHTLFESLCNDVALKTH 1458

>KLTH0F16236g Chr6 (1316542..1320924) [4383 bp, 1460 aa] {ON} highly
            similar to uniprot|P04051 Saccharomyces cerevisiae
            YOR116C
          Length = 1460

 Score = 2611 bits (6768), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1242/1460 (85%), Positives = 1342/1460 (91%), Gaps = 1/1460 (0%)

Query: 1    MKEVVVDILPKRISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGV 60
            MKEVVVDI PKRI GLEFSALSASDIVAQS+VEI TRDLFDLE+GR PK GGALD+RMGV
Sbjct: 1    MKEVVVDIAPKRIKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGV 60

Query: 61   SSSQAECSTCHGTLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNEEDK 120
            SSSQAECSTCHG LASCHGHFGHIKL+LPVFHVGYFKATIQ+LQSICK CA LLL+EEDK
Sbjct: 61   SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDK 120

Query: 121  RQFLSELRRPGIDNLRRMATLKKVLDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXLKIIH 180
             QFLSELRRPGIDNLRRM  LKKV+DQCKKQRRCL CG LN              LKI+H
Sbjct: 121  HQFLSELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNGVVKKAAAGSGSASLKILH 180

Query: 181  DTFRWVGKKSAPEKDKWIGDWNQVLQHSPELERYMKRTMENLNPLKTLNLFKQISPQDCE 240
            DTFRWVGKKSAPEKDKW+GDW  VL H+PELERY+K+ M++LNPLKTLNLFKQ++P+DCE
Sbjct: 181  DTFRWVGKKSAPEKDKWVGDWKTVLAHNPELERYVKKCMDDLNPLKTLNLFKQVAPEDCE 240

Query: 241  LLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDSTVK+GRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQMAVAMYINSDSVNPALMPGGNGGGKTKPIRGFCQRLKGKQ 360
            AGLEKGISINNMMEQWDYLQ+AVAMYINSDSVNPA+MPGG+ GGKTKPIRGFCQRLKGKQ
Sbjct: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRLKGKQ 360

Query: 361  GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKHKLQQLIV 420
            GRFRGNLSGKRVDFSGRTV+SPDPNLSIDEVAVPDRVAKVLT+PE VTRYNK KLQQL++
Sbjct: 361  GRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKQKLQQLVI 420

Query: 421  NGANVHPGANYLLKKNEEARRNLRYGDRIKLAKNLQIGDVVERHLEDGDVVLFNRQPSLH 480
            NG N HPGANYLLKK+EEARRNLRYGDR+KLA+NLQ GDVVERHLEDGDVVLFNRQPSLH
Sbjct: 421  NGPNEHPGANYLLKKDEEARRNLRYGDRMKLARNLQYGDVVERHLEDGDVVLFNRQPSLH 480

Query: 481  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 540
            RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL
Sbjct: 481  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 540

Query: 541  LTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFVQMLSMMSDGNLQFDIPPPAIMRPH 600
            LTPKSGEPIIAATQDFITGSYLISHKDSFF RA FVQ+LSMMSDGNLQFDIPPP+IM+P+
Sbjct: 541  LTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMMSDGNLQFDIPPPSIMKPY 600

Query: 601  YLWTGKQLFSLLIKPNKKSPVIINLDAKNKVYIAPKNKAYPNEMSANDGYVVIRGSNILS 660
            Y+WTGKQ+FSLLI+PNK+SPV+INLDAKNKVYI PK+K+ PNEMS NDGYVVIRGS ILS
Sbjct: 601  YMWTGKQVFSLLIRPNKESPVVINLDAKNKVYIPPKDKSLPNEMSINDGYVVIRGSKILS 660

Query: 661  GVMDKSVLGDGKKHSVFYTILRDFGPQEATQAMNRMAKLCARYLGNRGFSIGISDVTPGV 720
            GVMDKSVLGDGKKHSVFYTILRDFGPQEA  AMNRMAKLCAR+LGNRGFSIGI+DVTPG 
Sbjct: 661  GVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMNRMAKLCARFLGNRGFSIGINDVTPGF 720

Query: 721  ELKATKEEMVEIAYAKCDELIDLYKRGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVC 780
            ELK  KE MVE AYAKCD LIDL+ +GKLETQPGCNEEQTLEAKIGGLLSKVREEVG+VC
Sbjct: 721  ELKNKKEIMVEDAYAKCDALIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC 780

Query: 781  IRELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKT 840
            I+ELDNLN+ LIMA CGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSKT
Sbjct: 781  IKELDNLNSCLIMANCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKT 840

Query: 841  PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 900
            PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD
Sbjct: 841  PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 900

Query: 901  NTVRTSSNGIVQFTYGGDGLDPLNMEGNAKPVNFNRSWDHANNITYNHDDKGMLPYQILE 960
            NT+RTSSNGIVQFTYGGDGLDP++MEGNA+PVNF+RSW+HANN+T+NH DK +LPYQI++
Sbjct: 901  NTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFSRSWEHANNVTFNHVDKPLLPYQIMQ 960

Query: 961  ETNAILHPLEQQLSRYDNVGNPLAPGLENEELYIDQHDAEREFYQSLRTYMSEKARKLAD 1020
            +TN +L PLE++L RYDN+GN L P L++   YIDQ DAER FY+SLR YM EKA  LA+
Sbjct: 961  QTNGVLKPLEEKLVRYDNLGNELDPSLQDRVEYIDQDDAERNFYKSLRDYMYEKASHLAN 1020

Query: 1021 ITKSRGLKELYHAPALELQLMDLDASCPEVDVKSVNQLCKISSKLVRTFLDIAISKYRKA 1080
            I   +GLKE    PA ELQ MDLD   P   + SV+QLCKISSKLV  FL+IAI KY KA
Sbjct: 1021 IRAHKGLKEFLDEPAAELQAMDLDEGAPASALASVDQLCKISSKLVLKFLEIAIFKYHKA 1080

Query: 1081 KVEPGTAVGAIGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1140
            KVEPGTAVGA+GAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII
Sbjct: 1081 KVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1140

Query: 1141 NATLVNDDDERAARVVKGRVEKTLLSDVIFYIQDVYRDNMSFLQVKVDLATIEKLQLELT 1200
            NA LVN++DERAARVVKGR+EKTLLSDV FYIQDVY+DNMSFLQVKVDL TIEKLQLELT
Sbjct: 1141 NAVLVNNNDERAARVVKGRIEKTLLSDVAFYIQDVYKDNMSFLQVKVDLGTIEKLQLELT 1200

Query: 1201 VEDIAIAITSAPKLKISTGDVSIVGRNKININVCNDLDKAKSISTLASEPHENDVFFKMQ 1260
            VEDIA+AIT A KLKI+  DVSI+G++K+NINV  ++ K KSIST A EP EN++F++MQ
Sbjct: 1201 VEDIAVAITRAAKLKIAASDVSIMGKDKVNINVYPEMAKLKSISTSAKEPVENELFYRMQ 1260

Query: 1261 HLRRALPGIVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVVGYKTKTNHFLE 1320
            HLRRALPGIVVKGLPDI+RAVINI+DDG RELLVEGYGLR+VMTTDGV+G KTKTNH LE
Sbjct: 1261 HLRRALPGIVVKGLPDIARAVINIKDDGSRELLVEGYGLREVMTTDGVIGMKTKTNHILE 1320

Query: 1321 VYDVLGIEAARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRD 1380
            V+ VLGIEAARTSI+ EIDYTMSNHGMSVDPRH+QLLGDVMTYKGE+LGITRFGLSKMRD
Sbjct: 1321 VFSVLGIEAARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEILGITRFGLSKMRD 1380

Query: 1381 SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMTIGTGSFKVVKGTNISPDDL 1440
            SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTM+IGTG+FKVVKGT+IS  DL
Sbjct: 1381 SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVVKGTDISESDL 1440

Query: 1441 KPKPTLFENLC-SLNTLKVN 1459
             PKPTLFE+LC S+  LKVN
Sbjct: 1441 APKPTLFESLCDSVTALKVN 1460

>NDAI0C01620 Chr3 (346478..350860) [4383 bp, 1460 aa] {ON} Anc_5.426
          Length = 1460

 Score = 2550 bits (6608), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1222/1460 (83%), Positives = 1315/1460 (90%), Gaps = 1/1460 (0%)

Query: 1    MKEVVVDILPKRISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGV 60
            MKEVVV   PKRISGLEFSALSA+DIVAQSEVEI +RDLFDLE GR PK GGALD RMGV
Sbjct: 1    MKEVVVSENPKRISGLEFSALSAADIVAQSEVEISSRDLFDLEKGREPKTGGALDKRMGV 60

Query: 61   SSSQAECSTCHGTLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNEEDK 120
            SSS  EC TCHG LASCHGHFGHIKLALPVFHVGYFKATIQILQ ICK C+ +LL+++D+
Sbjct: 61   SSSSLECETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSDKDR 120

Query: 121  RQFLSELRRPGIDNLRRMATLKKVLDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXLKIIH 180
            RQFL+ELRRPG+DNLRRM  LKKVLDQCKKQRRCL CG LN              LKIIH
Sbjct: 121  RQFLNELRRPGVDNLRRMGILKKVLDQCKKQRRCLQCGALNGVVKKAAAGAGSASLKIIH 180

Query: 181  DTFRWVGKKSAPEKDKWIGDWNQVLQHSPELERYMKRTMENLNPLKTLNLFKQISPQDCE 240
            D FRWVGKKSAPEKDKW+GDW +VL H PELER++KR  ++LNPLKTLNLFKQI P+DCE
Sbjct: 181  DNFRWVGKKSAPEKDKWVGDWKEVLSHHPELERFVKRCSDDLNPLKTLNLFKQIKPEDCE 240

Query: 241  LLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLG++STVK+GRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGVNSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQMAVAMYINSDSVNPALMPGGN-GGGKTKPIRGFCQRLKGK 359
            AGLEKGISINNMME WDYLQ+ VAMYINSDSVNPA++PG + GGGK KPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGK 360

Query: 360  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKHKLQQLI 419
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYN+ KLQQLI
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNRQKLQQLI 420

Query: 420  VNGANVHPGANYLLKKNEEARRNLRYGDRIKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 479
            +NG NVHPGANYLLK NE+ARRNLRYGDR+KLAKNLQ GDVVERHLEDGDVVLFNRQPSL
Sbjct: 421  INGPNVHPGANYLLKNNEDARRNLRYGDRVKLAKNLQFGDVVERHLEDGDVVLFNRQPSL 480

Query: 480  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 539
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 540  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFVQMLSMMSDGNLQFDIPPPAIMRP 599
            LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRAT  Q+LSMM D NLQFDIPPPAIM+P
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMCDANLQFDIPPPAIMKP 600

Query: 600  HYLWTGKQLFSLLIKPNKKSPVIINLDAKNKVYIAPKNKAYPNEMSANDGYVVIRGSNIL 659
            HYLWTGKQLFSLLIKPNK SPV+INLDAKNKVYI PK KAYPNEMS NDGYV+IRGS IL
Sbjct: 601  HYLWTGKQLFSLLIKPNKDSPVVINLDAKNKVYIPPKTKAYPNEMSRNDGYVIIRGSQIL 660

Query: 660  SGVMDKSVLGDGKKHSVFYTILRDFGPQEATQAMNRMAKLCARYLGNRGFSIGISDVTPG 719
            SGVMDKSVLGDGKKHSVFYTILRD+GPQEA  AMNRMAKLCAR+LGNRGFSIGISDVTP 
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAATAMNRMAKLCARFLGNRGFSIGISDVTPA 720

Query: 720  VELKATKEEMVEIAYAKCDELIDLYKRGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 779
             +LK  KEE+VEIAYAKCDELID + +GKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV
Sbjct: 721  DDLKQKKEELVEIAYAKCDELIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 780  CIRELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 839
            CI ELDNLNAPLIMATCGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSK 840

Query: 840  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899
            TPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 900  DNTVRTSSNGIVQFTYGGDGLDPLNMEGNAKPVNFNRSWDHANNITYNHDDKGMLPYQIL 959
            DNTVRTSSNGIVQFTYGGDGLDP+ MEGNAKPVNFNRSWDHA NIT++ D  G+LPYQI+
Sbjct: 901  DNTVRTSSNGIVQFTYGGDGLDPMEMEGNAKPVNFNRSWDHATNITFSPDQHGLLPYQIM 960

Query: 960  EETNAILHPLEQQLSRYDNVGNPLAPGLENEELYIDQHDAEREFYQSLRTYMSEKARKLA 1019
            E TNAIL PLE +L RYDN+G  +      +  Y+DQ DAER+FY+SLR YM EKA+ L 
Sbjct: 961  ETTNAILKPLEDRLIRYDNLGEIVPNEDSTKAEYVDQFDAERDFYKSLRDYMDEKAKVLG 1020

Query: 1020 DITKSRGLKELYHAPALELQLMDLDASCPEVDVKSVNQLCKISSKLVRTFLDIAISKYRK 1079
             + KSRG+  +   PA EL+ M+ D   PE    SV+QL KI+  LV+ FL+IA+ KYRK
Sbjct: 1021 SVRKSRGMLPMVDEPAEELKKMNPDEQVPETIRYSVDQLYKITEDLVKKFLEIALYKYRK 1080

Query: 1080 AKVEPGTAVGAIGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1139
            A+VEPGTAVGAIGA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1081 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1140 INATLVNDDDERAARVVKGRVEKTLLSDVIFYIQDVYRDNMSFLQVKVDLATIEKLQLEL 1199
            INA LVN++DERAARVVKGR+EKTLLSDV +YIQDVY+DN+SF+QV++DL TIEKLQLEL
Sbjct: 1141 INAVLVNENDERAARVVKGRIEKTLLSDVAYYIQDVYKDNLSFIQVRIDLNTIEKLQLEL 1200

Query: 1200 TVEDIAIAITSAPKLKISTGDVSIVGRNKININVCNDLDKAKSISTLASEPHENDVFFKM 1259
            T+EDIA+A+T APKLKI T DV+I+G++KI INV  +  KAKSIST A EP EN VF++M
Sbjct: 1201 TIEDIAVALTRAPKLKILTSDVNIIGKDKIAINVFPEGYKAKSISTAAKEPTENAVFYRM 1260

Query: 1260 QHLRRALPGIVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVVGYKTKTNHFL 1319
            QHLRRALP IVVKGLP+I+RAVINIRDDGKRELLVEGYGLRDVM TDGV+G KT TNH L
Sbjct: 1261 QHLRRALPSIVVKGLPEIARAVINIRDDGKRELLVEGYGLRDVMCTDGVIGMKTTTNHIL 1320

Query: 1320 EVYDVLGIEAARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1379
            EV  VLGIEAAR+SI+ EIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR
Sbjct: 1321 EVNTVLGIEAARSSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380

Query: 1380 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMTIGTGSFKVVKGTNISPDD 1439
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTM+IGTGSFKVVKGT I+ + 
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTEIAKES 1440

Query: 1440 LKPKPTLFENLCSLNTLKVN 1459
            LKPKPTLFENL S  ++K+N
Sbjct: 1441 LKPKPTLFENLTSSRSIKMN 1460

>NCAS0H02040 Chr8 complement(393711..398093) [4383 bp, 1460 aa] {ON}
            Anc_5.426
          Length = 1460

 Score = 2547 bits (6602), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1225/1461 (83%), Positives = 1323/1461 (90%), Gaps = 3/1461 (0%)

Query: 1    MKEVVVDILPKRISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGV 60
            MKEVVV   PKRISGLEFSALSA+DIVAQSE+E+ +RDLFDLE GR PK GGALD +MGV
Sbjct: 1    MKEVVVSENPKRISGLEFSALSAADIVAQSEIEVSSRDLFDLEKGREPKIGGALDRKMGV 60

Query: 61   SSSQAECSTCHGTLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNEEDK 120
            SSS  EC TCHG LASCHGHFGHIKLALPVFHVGYFKATIQILQ +CK C+ +LLN++DK
Sbjct: 61   SSSSLECETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKTCSAILLNDQDK 120

Query: 121  RQFLSELRRPGIDNLRRMATLKKVLDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXLKIIH 180
            RQFL+ELRRPG+DNLRRM  LKKVLDQCKKQRRCL CG LN              LKIIH
Sbjct: 121  RQFLTELRRPGVDNLRRMGILKKVLDQCKKQRRCLQCGALNGVVKKAAAGAGPASLKIIH 180

Query: 181  DTFRWVGKKSAPEKDKWIGDWNQVLQHSPELERYMKRTMENLNPLKTLNLFKQISPQDCE 240
            DTFRWVGKKSAPEKDKW+GDW +VL H PELER+MKR  ++LNPLKTLNLFKQI P+DCE
Sbjct: 181  DTFRWVGKKSAPEKDKWVGDWKEVLSHHPELERFMKRCSDDLNPLKTLNLFKQIKPEDCE 240

Query: 241  LLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDSTVK+GRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQMAVAMYINSDSVNPALMPGGN-GGGKTKPIRGFCQRLKGK 359
            AGLEKGISINNMME WDYLQ+ VAMYINSDSVNPA++PG + GGGK KPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGK 360

Query: 360  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKHKLQQLI 419
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNK KLQQLI
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKQKLQQLI 420

Query: 420  VNGANVHPGANYLLKKNEEARRNLRYGDRIKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 479
            +NG NVHPGANYLLKKNE+ARRNLRYGDRIKLAKNLQ GDVVERHLEDGDVVLFNRQPSL
Sbjct: 421  INGPNVHPGANYLLKKNEDARRNLRYGDRIKLAKNLQHGDVVERHLEDGDVVLFNRQPSL 480

Query: 480  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 539
            HRLSILSH+AKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 540  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFVQMLSMMSDGNLQFDIPPPAIMRP 599
            LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRAT  Q+LSMMS+G L+FDIPPPAIM+P
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSNGTLRFDIPPPAIMKP 600

Query: 600  HYLWTGKQLFSLLIKPNKKSPVIINLDAKNKVYIAPKNKAYPNEMSANDGYVVIRGSNIL 659
            +Y+WTGKQ+FSLLI+PNK+SPV+INLDAKNKV++ PK K YPNEMS NDGYVVIRGSNIL
Sbjct: 601  YYMWTGKQVFSLLIRPNKESPVVINLDAKNKVFMPPKYKDYPNEMSRNDGYVVIRGSNIL 660

Query: 660  SGVMDKSVLGDGKKHSVFYTILRDFGPQEATQAMNRMAKLCARYLGNRGFSIGISDVTPG 719
            SGVMDKSVLGDGKKHSVFYTILRD+GPQEA  AMNRM+KLCARYLGNRGFSIGISDVTP 
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARYLGNRGFSIGISDVTPA 720

Query: 720  VELKATKEEMVEIAYAKCDELIDLYKRGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 779
             +LK  KEE+VEIAYAKCDELID + +GKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV
Sbjct: 721  DDLKQKKEELVEIAYAKCDELIDQFHKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 780  CIRELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 839
            CI ELDNLNAPLIMATCGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSK 840

Query: 840  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899
            TPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 900  DNTVRTSSNGIVQFTYGGDGLDPLNMEGNAKPVNFNRSWDHANNITYNHDDKGMLPYQIL 959
            DNTVRTSSNGIVQFTYGGDGLDP+ MEGNAKPVNFNRSWDHA NIT+++ +KG+LPY+I+
Sbjct: 901  DNTVRTSSNGIVQFTYGGDGLDPMEMEGNAKPVNFNRSWDHAINITFSNLEKGLLPYEIM 960

Query: 960  EETNAILHPLEQQLSRYDNVGNPLAPGLENEEL-YIDQHDAEREFYQSLRTYMSEKARKL 1018
            E+TN IL PLE++L RYDNVG  L P  +NE+  Y+DQ DAER+FY+SLR Y+ EKA  L
Sbjct: 961  EKTNEILKPLEERLIRYDNVGE-LVPKKDNEKAEYVDQFDAERDFYRSLRDYIQEKADIL 1019

Query: 1019 ADITKSRGLKELYHAPALELQLMDLDASCPEVDVKSVNQLCKISSKLVRTFLDIAISKYR 1078
            A + KSRG+ E+   P  EL+ +D D    E    SV+QL KI+ K V+TFL+IA+ KYR
Sbjct: 1020 ARVRKSRGMLEMSSEPGEELRKLDPDERITESIKHSVDQLYKITEKSVQTFLEIALYKYR 1079

Query: 1079 KAKVEPGTAVGAIGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1138
            KA+VEPGTAVGAIGA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP
Sbjct: 1080 KARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1139

Query: 1139 IINATLVNDDDERAARVVKGRVEKTLLSDVIFYIQDVYRDNMSFLQVKVDLATIEKLQLE 1198
            IINA LVN++DERAARVVKGR+EKTLLSD+ +YIQDVY+DN+SF+QV+VDL TIEKLQLE
Sbjct: 1140 IINAVLVNENDERAARVVKGRIEKTLLSDIAYYIQDVYKDNLSFIQVRVDLGTIEKLQLE 1199

Query: 1199 LTVEDIAIAITSAPKLKISTGDVSIVGRNKININVCNDLDKAKSISTLASEPHENDVFFK 1258
            LT+EDIA+AIT APKLKI T DV+I+G++KI INV  D  KAKSIST+A EP  N VF++
Sbjct: 1200 LTIEDIAVAITKAPKLKIQTSDVNILGKDKIAINVYPDGYKAKSISTMAKEPSNNAVFYR 1259

Query: 1259 MQHLRRALPGIVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVVGYKTKTNHF 1318
            MQHLRR LP IVVKG  DISRAVINIRDDGKRELLVEGYGLRDVM TDGV+G KT TNH 
Sbjct: 1260 MQHLRRVLPSIVVKGFGDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGMKTTTNHI 1319

Query: 1319 LEVYDVLGIEAARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1378
            LEV +VLGIEAAR+SII EIDYTMSNHGMSVDPRHIQLLGDVMTYKGE+LGITRFGLSKM
Sbjct: 1320 LEVNNVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKM 1379

Query: 1379 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMTIGTGSFKVVKGTNISPD 1438
            RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTM+IGTGSFKVVKGTNIS  
Sbjct: 1380 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEA 1439

Query: 1439 DLKPKPTLFENLCSLNTLKVN 1459
            DLKPKPTLFE L +  T K+N
Sbjct: 1440 DLKPKPTLFEKLSNCGTHKLN 1460

>KLLA0E21253g Chr5 (1896457..1900830) [4374 bp, 1457 aa] {ON} highly
            similar to uniprot|P04051 Saccharomyces cerevisiae
            YOR116C
          Length = 1457

 Score = 2547 bits (6601), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1211/1451 (83%), Positives = 1311/1451 (90%), Gaps = 1/1451 (0%)

Query: 1    MKEVVVDILPKRISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGV 60
            MKE V+DI PK+I G+ FSALSA+DIV+QSEVEI TRDLFDL++GR+ K+GGALD RMGV
Sbjct: 1    MKETVIDIAPKKIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGV 60

Query: 61   SSSQAECSTCHGTLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNEEDK 120
            SSSQAEC+TCHG LASCHGHFGHIKLALPVFHVGYFKATIQILQS+CK C  LLL+EEDK
Sbjct: 61   SSSQAECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDK 120

Query: 121  RQFLSELRRPGIDNLRRMATLKKVLDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXLKIIH 180
            R+FL+ELRRPG+DNLRRM  LKK+LDQCKKQRRC  CG LN              LKIIH
Sbjct: 121  RKFLTELRRPGMDNLRRMNILKKILDQCKKQRRCFECGELNGVVKKAAAGSGSAALKIIH 180

Query: 181  DTFRWVGKKSAPEKDKWIGDWNQVLQHSPELERYMKRTMENLNPLKTLNLFKQISPQDCE 240
            DTFRWVGKKSAPEK++WIGDW QVL+++PELERY+KR M++LNPLK LNLFKQI P DCE
Sbjct: 181  DTFRWVGKKSAPEKEQWIGDWKQVLENNPELERYVKRCMDDLNPLKVLNLFKQIKPNDCE 240

Query: 241  LLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDST K+GRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTSKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQMAVAMYINSDSVNPALMPGGNGGGKTKPIRGFCQRLKGKQ 360
            AGLEKGISINNMMEQWDYLQ+AVAMYINSDSVNP+++PG +G  K+KPIRGFCQRLKGKQ
Sbjct: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPSMLPGSSGT-KSKPIRGFCQRLKGKQ 359

Query: 361  GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKHKLQQLIV 420
            GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAK+LT+PEKVTRYNKHKLQQL++
Sbjct: 360  GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHKLQQLVI 419

Query: 421  NGANVHPGANYLLKKNEEARRNLRYGDRIKLAKNLQIGDVVERHLEDGDVVLFNRQPSLH 480
            NG  VHPGANYLLKKNE+ARRNLRYGDR+KLAK LQ GDVVERH+EDGDVVLFNRQPSLH
Sbjct: 420  NGPKVHPGANYLLKKNEDARRNLRYGDRVKLAKQLQYGDVVERHIEDGDVVLFNRQPSLH 479

Query: 481  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 540
            RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL
Sbjct: 480  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 539

Query: 541  LTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFVQMLSMMSDGNLQFDIPPPAIMRPH 600
            LTPKSGEPIIAATQDFITGSYLISHKDSFFDRA   Q+LSMMSD NLQFDIPPP+IM+PH
Sbjct: 540  LTPKSGEPIIAATQDFITGSYLISHKDSFFDRAQLTQLLSMMSDSNLQFDIPPPSIMKPH 599

Query: 601  YLWTGKQLFSLLIKPNKKSPVIINLDAKNKVYIAPKNKAYPNEMSANDGYVVIRGSNILS 660
            YLWTGKQ+FSLLIKP++KSPV+INLDAKNKVY+ P  K YPNEMS NDG+V+IRGSNILS
Sbjct: 600  YLWTGKQVFSLLIKPSRKSPVVINLDAKNKVYLPPPKKEYPNEMSQNDGFVLIRGSNILS 659

Query: 661  GVMDKSVLGDGKKHSVFYTILRDFGPQEATQAMNRMAKLCARYLGNRGFSIGISDVTPGV 720
            GVMDKSVLGDGKKHSVFYTILRD+GP EA QAMNRMAKLCARYLGNRGFSIGI+DVTPG 
Sbjct: 660  GVMDKSVLGDGKKHSVFYTILRDYGPNEAAQAMNRMAKLCARYLGNRGFSIGINDVTPGS 719

Query: 721  ELKATKEEMVEIAYAKCDELIDLYKRGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVC 780
            +LK  KE+MVE AYAKCDELIDL+ +GKLETQPGCNEEQTLEAKIGGLLSKVREEVG+VC
Sbjct: 720  DLKQKKEQMVESAYAKCDELIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC 779

Query: 781  IRELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKT 840
            IRELDNLNAPLIMATCGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKT
Sbjct: 780  IRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKT 839

Query: 841  PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 900
            PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD
Sbjct: 840  PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 899

Query: 901  NTVRTSSNGIVQFTYGGDGLDPLNMEGNAKPVNFNRSWDHANNITYNHDDKGMLPYQILE 960
            NTVRTSSNGIVQFTYGGDGLDPL+MEGNA+PVNFNRSW HANN+T N +  G+LPYQI+ 
Sbjct: 900  NTVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWTHANNLTLNDNSPGLLPYQIIA 959

Query: 961  ETNAILHPLEQQLSRYDNVGNPLAPGLENEELYIDQHDAEREFYQSLRTYMSEKARKLAD 1020
            ETN IL PLE +L RYDN+G  L    E+++ YIDQ DAER FYQSLR +M+EKA  LA 
Sbjct: 960  ETNVILQPLENKLKRYDNIGQELRKEDEHKDEYIDQFDAERSFYQSLREFMTEKALTLAS 1019

Query: 1021 ITKSRGLKELYHAPALELQLMDLDASCPEVDVKSVNQLCKISSKLVRTFLDIAISKYRKA 1080
            +   RGLKEL   PA EL+  + D + P     ++NQLCKIS  LV+ FL IAISKY +A
Sbjct: 1020 LRGERGLKELVDEPAEELREFNWDENVPASITIALNQLCKISKILVQKFLSIAISKYHRA 1079

Query: 1081 KVEPGTAVGAIGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1140
            +VEPGTAVGAIGA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII
Sbjct: 1080 RVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1139

Query: 1141 NATLVNDDDERAARVVKGRVEKTLLSDVIFYIQDVYRDNMSFLQVKVDLATIEKLQLELT 1200
            NA LVND+DERAARVVKGRVEKTLLSDV FY+QD+YRDNM+FLQ+K+D  TIEKLQLELT
Sbjct: 1140 NAVLVNDNDERAARVVKGRVEKTLLSDVSFYVQDIYRDNMAFLQIKIDSETIEKLQLELT 1199

Query: 1201 VEDIAIAITSAPKLKISTGDVSIVGRNKININVCNDLDKAKSISTLASEPHENDVFFKMQ 1260
            +EDI +AI  APKLKI T D+SI+G++KINI V +D    KSIST   EP  N+VF++MQ
Sbjct: 1200 LEDIVVAIAKAPKLKIGTNDISIIGKDKINIAVSSDGKSMKSISTAMKEPEPNEVFYRMQ 1259

Query: 1261 HLRRALPGIVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVVGYKTKTNHFLE 1320
             LRRALP IVVKG  DISRAVINIRDDGKRELLVEGYGLRDVMTTDGV+G KTKTNH LE
Sbjct: 1260 QLRRALPHIVVKGFSDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKTNHILE 1319

Query: 1321 VYDVLGIEAARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRD 1380
            VYDVLGIEAAR+ II+EIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGL+KMRD
Sbjct: 1320 VYDVLGIEAARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLAKMRD 1379

Query: 1381 SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMTIGTGSFKVVKGTNISPDDL 1440
            SVLQLASFEKTTDHLFDAAFYMK DAVEGVSECIILGQTM+IGTGSFKVVK T +  +DL
Sbjct: 1380 SVLQLASFEKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVVKNTVVGENDL 1439

Query: 1441 KPKPTLFENLC 1451
             PKPTLFE LC
Sbjct: 1440 TPKPTLFETLC 1450

>TDEL0E01990 Chr5 (373218..377600) [4383 bp, 1460 aa] {ON} Anc_5.426
            YOR116C
          Length = 1460

 Score = 2533 bits (6566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1208/1461 (82%), Positives = 1317/1461 (90%), Gaps = 3/1461 (0%)

Query: 1    MKEVVVDILPKRISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGV 60
            MKEVVV   PKRISGLEFSALSA+DIVAQSEVEI TRDLFDLE+GRAP+ GGALD +MGV
Sbjct: 1    MKEVVVSATPKRISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGV 60

Query: 61   SSSQAECSTCHGTLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNEEDK 120
            SSS  EC+TCHG LASCHGHFGHIKLALPVFHVGYFKATIQILQ ICKNC+ +LL++ D+
Sbjct: 61   SSSSLECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDR 120

Query: 121  RQFLSELRRPGIDNLRRMATLKKVLDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXLKIIH 180
            R FLSELRRPG+DNLRRM  L KVLDQCKKQRRCL CG LN              LKIIH
Sbjct: 121  RHFLSELRRPGVDNLRRMGILSKVLDQCKKQRRCLQCGALNGVVKKAAAGSGSASLKIIH 180

Query: 181  DTFRWVGKKSAPEKDKWIGDWNQVLQHSPELERYMKRTMENLNPLKTLNLFKQISPQDCE 240
            DTFRW GKKS PEKDKW+GDW++VL H+PELERY+KR M++LNPLKTLNLFKQ+ P+DCE
Sbjct: 181  DTFRWAGKKSVPEKDKWVGDWDEVLSHNPELERYVKRCMDDLNPLKTLNLFKQLKPEDCE 240

Query: 241  LLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDS+ K+GRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSSNKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQMAVAMYINSDSVNPALMPGGN-GGGKTKPIRGFCQRLKGK 359
            +GLEKGISINNMME WDYLQ++VAMYINSDSVNPA+MPG + GGGK KPIRGFCQRLKGK
Sbjct: 301  SGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIRGFCQRLKGK 360

Query: 360  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKHKLQQLI 419
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLT+PEKVTRYN+ KLQQL+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRQKLQQLL 420

Query: 420  VNGANVHPGANYLLKKNEEARRNLRYGDRIKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 479
            +NG NVHPGANYLLKK+E+ARRNLRYGDR+KLAKNL++GDVVERHLEDGDVVLFNRQPSL
Sbjct: 421  INGPNVHPGANYLLKKDEDARRNLRYGDRVKLAKNLRVGDVVERHLEDGDVVLFNRQPSL 480

Query: 480  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 539
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 540  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFVQMLSMMSDGNLQFDIPPPAIMRP 599
            LLTPKSGEPIIAATQDFITGSYLISHKDSFFDR +  Q+LSMMSDGNLQFDIP PAIM+P
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQLLSMMSDGNLQFDIPAPAIMKP 600

Query: 600  HYLWTGKQLFSLLIKPNKKSPVIINLDAKNKVYIAPKNKAYPNEMSANDGYVVIRGSNIL 659
             YLWTGKQ+FSLLIKPNKKSPV+INLDAKNKV+I PK+K+ P+EMS NDGYV+IRGS IL
Sbjct: 601  CYLWTGKQVFSLLIKPNKKSPVVINLDAKNKVFIPPKSKSLPSEMSQNDGYVIIRGSEIL 660

Query: 660  SGVMDKSVLGDGKKHSVFYTILRDFGPQEATQAMNRMAKLCARYLGNRGFSIGISDVTPG 719
            SGVMDKSVLGDGKKHSVFYTILRD+GPQEA  AMNRMAKLCARYLGNRGFSIGISDVTP 
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGNRGFSIGISDVTPA 720

Query: 720  VELKATKEEMVEIAYAKCDELIDLYKRGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 779
             +LK  KE+MVE AYAKCDELID Y +GKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV
Sbjct: 721  DDLKKKKEDMVEFAYAKCDELIDSYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 780  CIRELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 839
            CI ELDNLNAPLIMATCGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 840  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899
            TPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 900  DNTVRTSSNGIVQFTYGGDGLDPLNMEGNAKPVNFNRSWDHANNITYNHDDKGMLPYQIL 959
            DNTVRTSSNGIVQFTYGGDGLDP+ MEGNA+PVNF RSW+HA N+T+N+ ++G+ PYQI 
Sbjct: 901  DNTVRTSSNGIVQFTYGGDGLDPMEMEGNAQPVNFVRSWNHAFNVTFNNTERGLFPYQIE 960

Query: 960  EETNAILHPLEQQLSRYDNVGNPLAPGLENEEL-YIDQHDAEREFYQSLRTYMSEKARKL 1018
            EET+ IL PL  +L RYDNVG  L P  ++  + YIDQ+DAER FY SL+++M  KA  L
Sbjct: 961  EETDKILAPLMNRLIRYDNVGK-LVPKEKDALIEYIDQNDAERNFYLSLKSFMRGKAELL 1019

Query: 1019 ADITKSRGLKELYHAPALELQLMDLDASCPEVDVKSVNQLCKISSKLVRTFLDIAISKYR 1078
            A + K RG+KEL   P  E + +D D   PE    SV+QLC+I+   VR FL IAISKYR
Sbjct: 1020 ASVRKQRGMKELLDEPGPEFKNIDFDEDVPENIRHSVDQLCRITGDSVREFLKIAISKYR 1079

Query: 1079 KAKVEPGTAVGAIGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1138
            +A+VEPGTAVGAIGA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP
Sbjct: 1080 RARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1139

Query: 1139 IINATLVNDDDERAARVVKGRVEKTLLSDVIFYIQDVYRDNMSFLQVKVDLATIEKLQLE 1198
            IINA LVND+DERAARVVKGR+EKTLLSDV FYIQDVY+DN+SF+QV++DL TI+KLQLE
Sbjct: 1140 IINAVLVNDNDERAARVVKGRIEKTLLSDVAFYIQDVYQDNLSFMQVRIDLNTIDKLQLE 1199

Query: 1199 LTVEDIAIAITSAPKLKISTGDVSIVGRNKININVCNDLDKAKSISTLASEPHENDVFFK 1258
            LT+EDIA+AIT APKLKI   DV+I+ ++KI INV  +  KAKSIST A EPHENDVFF+
Sbjct: 1200 LTIEDIAVAITRAPKLKIQASDVTILDKDKIAINVFPEGYKAKSISTSAKEPHENDVFFR 1259

Query: 1259 MQHLRRALPGIVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVVGYKTKTNHF 1318
            MQ LRR+LPGIVVKGLPDISRAVIN+RDD KRELLVEGYGLRDVM+TDGVVG+KT TNH 
Sbjct: 1260 MQQLRRSLPGIVVKGLPDISRAVINVRDDTKRELLVEGYGLRDVMSTDGVVGHKTATNHI 1319

Query: 1319 LEVYDVLGIEAARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1378
            LEV+ VLGIEAAR SII EIDYTMSNHGMSVDPRHIQLLGDVMTYKGE+LGITRFGLSKM
Sbjct: 1320 LEVFSVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKM 1379

Query: 1379 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMTIGTGSFKVVKGTNISPD 1438
            RDSVLQLASFEKTTDHLFDAAFYMK+DAVEGVSECIILGQTM+IGTG+FKV+KGT++   
Sbjct: 1380 RDSVLQLASFEKTTDHLFDAAFYMKRDAVEGVSECIILGQTMSIGTGAFKVIKGTDLHEQ 1439

Query: 1439 DLKPKPTLFENLCSLNTLKVN 1459
            DL+PKPTLFE+L     +K N
Sbjct: 1440 DLRPKPTLFESLSKETAIKAN 1460

>KAFR0D05030 Chr4 complement(988159..992547) [4389 bp, 1462 aa] {ON}
            Anc_5.426 YOR116C
          Length = 1462

 Score = 2520 bits (6532), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1199/1462 (82%), Positives = 1322/1462 (90%), Gaps = 3/1462 (0%)

Query: 1    MKEVVVDILPKRISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGV 60
            MKEVV+   PK+ISG+EFSALSASDIVAQSEVEI +RDLFDLE  R  K+ GALD RMGV
Sbjct: 1    MKEVVISEAPKKISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGALDPRMGV 60

Query: 61   SSSQAECSTCHGTLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNEEDK 120
            SSS   C TCHG LASCHGHFGHIKLALPVFHVGYFKATIQILQ+ICKNC+ +LL++EDK
Sbjct: 61   SSSSLTCETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDEDK 120

Query: 121  RQFLSELRRPG-IDNLRRMATLKKVLDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXLKII 179
            +++L ELR  G IDNL++M  LKKV+DQCKKQRRCLHCG LN              LKII
Sbjct: 121  KKYLHELRTSGRIDNLKKMGILKKVMDQCKKQRRCLHCGALNGVVKKAAAGSGTASLKII 180

Query: 180  HDTFRWVGKKSAPEKDKWIGDWNQVLQHSPELERYMKRTMENLNPLKTLNLFKQISPQDC 239
            HDTFRWVGKKS PEKD WIGDWN+VL H PELER++KR  ++LNPLKTLNLFKQ+ P+DC
Sbjct: 181  HDTFRWVGKKSTPEKDNWIGDWNEVLSHHPELERFVKRCTDDLNPLKTLNLFKQVRPEDC 240

Query: 240  ELLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLI 299
            ELLGIDSTVK+GRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLT+KLTEIVWTSSLI
Sbjct: 241  ELLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTIKLTEIVWTSSLI 300

Query: 300  KAGLEKGISINNMMEQWDYLQMAVAMYINSDSVNPALMPGGN-GGGKTKPIRGFCQRLKG 358
            KAGLEKGISINNMME WDYLQ+ VAMYIN+DSVNPA++PG + GGGK KPIRGFCQRLKG
Sbjct: 301  KAGLEKGISINNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGFCQRLKG 360

Query: 359  KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKHKLQQL 418
            KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLT+PEKVTRYN+ KLQ+L
Sbjct: 361  KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKLQEL 420

Query: 419  IVNGANVHPGANYLLKKNEEARRNLRYGDRIKLAKNLQIGDVVERHLEDGDVVLFNRQPS 478
            ++NG N+HPGANYLLKKNEEARRNLRYGDR+KLAKNLQ GD+VERHLEDGDVVLFNRQPS
Sbjct: 421  VMNGPNIHPGANYLLKKNEEARRNLRYGDRLKLAKNLQYGDIVERHLEDGDVVLFNRQPS 480

Query: 479  LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 538
            LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN
Sbjct: 481  LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 540

Query: 539  NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFVQMLSMMSDGNLQFDIPPPAIMR 598
            NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATF Q+LSMMSDGNLQFDIPPPAIM+
Sbjct: 541  NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMMSDGNLQFDIPPPAIMK 600

Query: 599  PHYLWTGKQLFSLLIKPNKKSPVIINLDAKNKVYIAPKNKAYPNEMSANDGYVVIRGSNI 658
            P+YLWTGKQLFSLLIKPN KSPV+INLDAKNKVYI PK+K+ PNEMS NDG+V+IRGSNI
Sbjct: 601  PYYLWTGKQLFSLLIKPNHKSPVVINLDAKNKVYIPPKSKSLPNEMSRNDGFVIIRGSNI 660

Query: 659  LSGVMDKSVLGDGKKHSVFYTILRDFGPQEATQAMNRMAKLCARYLGNRGFSIGISDVTP 718
            LSGVMDKSVLGDGKKHSVFYTILRD+GPQEA  AMNRM+KLCAR+LGNRGFSIGISDVTP
Sbjct: 661  LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARFLGNRGFSIGISDVTP 720

Query: 719  GVELKATKEEMVEIAYAKCDELIDLYKRGKLETQPGCNEEQTLEAKIGGLLSKVREEVGD 778
              +LK  KEE+VEIAYAKCD+LID Y +GKLETQPGCNEE+TLEAKIGGLLSKVREEVGD
Sbjct: 721  ADDLKIKKEELVEIAYAKCDDLIDSYNKGKLETQPGCNEEETLEAKIGGLLSKVREEVGD 780

Query: 779  VCIRELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS 838
            VCI ELDNLNAPLIMATCGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS
Sbjct: 781  VCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS 840

Query: 839  KTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 898
            KTPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ
Sbjct: 841  KTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 900

Query: 899  YDNTVRTSSNGIVQFTYGGDGLDPLNMEGNAKPVNFNRSWDHANNITYNHDDKGMLPYQI 958
            YDNTVRTSSNGIVQFTYGGDGLDP+ MEG+A+PVNFNRSWDHA NIT+N++++G+LPYQ+
Sbjct: 901  YDNTVRTSSNGIVQFTYGGDGLDPMEMEGSAQPVNFNRSWDHALNITFNNNERGLLPYQV 960

Query: 959  LEETNAILHPLEQQLSRYDNVGNPLAPGLENEELYIDQHDAEREFYQSLRTYMSEKARKL 1018
            +++TN +L+PLE++L RYDN+GN +     ++  Y DQ DAER+FY++LR+Y+  K+  L
Sbjct: 961  MKKTNEVLNPLEERLVRYDNLGNEVMKEDLDKLEYADQFDAERDFYKTLRSYIQSKSDHL 1020

Query: 1019 ADITKSRGLKELYHAPALELQLMDLDASCPEVDVKSVNQLCKISSKLVRTFLDIAISKYR 1078
            A + KSRGL EL   P  ELQ +  D    +V   SV+QLCKI+ K V  FL+IA+SKYR
Sbjct: 1021 AHVRKSRGLLELLSEPGEELQSLHPDERATDVSRSSVDQLCKITEKAVLKFLEIALSKYR 1080

Query: 1079 KAKVEPGTAVGAIGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1138
            KA+VEPGTAVGAIGA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASK ISTP
Sbjct: 1081 KARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKTISTP 1140

Query: 1139 IINATLVNDDDERAARVVKGRVEKTLLSDVIFYIQDVYRDNMSFLQVKVDLATIEKLQLE 1198
            IINA LVN++DERAARVVKGRVEKT+LSDV +YIQDVY+DN+SFLQ+++DL TIEKLQLE
Sbjct: 1141 IINAVLVNNNDERAARVVKGRVEKTMLSDVAYYIQDVYKDNLSFLQIRIDLNTIEKLQLE 1200

Query: 1199 LTVEDIAIAITSAPKLKISTGDVSIVGRNKININVCNDLDKAKSISTLASEPHENDVFFK 1258
            LT+EDIA+A+T APKLKI   DVSI G +K+ +NV  +  K+KSIST A +P ENDVF++
Sbjct: 1201 LTIEDIAVALTKAPKLKIQASDVSIAGDDKVIVNVFPEGSKSKSISTSAKDPSENDVFYR 1260

Query: 1259 MQHLRRALPGIVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVVGYKTKTNHF 1318
            MQ LRRALP IVVKGLP+I+RAVINIRDDGKRELLVEGYGLR+VM TDGV+G KT TNH 
Sbjct: 1261 MQQLRRALPHIVVKGLPEIARAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTVTNHV 1320

Query: 1319 LEVYDVLGIEAARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1378
            LEV  VLGIEAAR+SII EIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM
Sbjct: 1321 LEVSSVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1380

Query: 1379 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMTIGTGSFKVVKGTNISPD 1438
            RDSVLQLASFEKTTDHLFDAAFYMKKD VEGVSECIILGQTM+IGTGSFKVVKGT+I P+
Sbjct: 1381 RDSVLQLASFEKTTDHLFDAAFYMKKDNVEGVSECIILGQTMSIGTGSFKVVKGTDIKPE 1440

Query: 1439 DLKPKPTLFENLCSLNT-LKVN 1459
            DLKPKPTLFE+L S ++ +K+N
Sbjct: 1441 DLKPKPTLFESLSSASSNIKLN 1462

>Kpol_1016.9 s1016 (19972..24354) [4383 bp, 1460 aa] {ON}
            (19972..24354) [4383 nt, 1461 aa]
          Length = 1460

 Score = 2515 bits (6519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1198/1460 (82%), Positives = 1311/1460 (89%), Gaps = 1/1460 (0%)

Query: 1    MKEVVVDILPKRISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGV 60
            MKEVVV   PK+ISGLEFSALSASDIVAQSEVE+ TRDLFDLE+GRAPK GGALD +MGV
Sbjct: 1    MKEVVVSETPKKISGLEFSALSASDIVAQSEVEVSTRDLFDLENGRAPKIGGALDPKMGV 60

Query: 61   SSSQAECSTCHGTLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNEEDK 120
            SSS  EC+TCHG LASCHGHFGHIKLALPVFHVGYFKATIQILQ ICKNC+ +LLN+ D+
Sbjct: 61   SSSSMECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSSILLNDTDR 120

Query: 121  RQFLSELRRPGIDNLRRMATLKKVLDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXLKIIH 180
            R FL ELRRPGIDNL+RMA +KK+LDQCKKQRRCL CG LN              LKIIH
Sbjct: 121  RDFLHELRRPGIDNLKRMAIIKKILDQCKKQRRCLTCGALNGVVKRAAAGSGSASLKIIH 180

Query: 181  DTFRWVGKKSAPEKDKWIGDWNQVLQHSPELERYMKRTMENLNPLKTLNLFKQISPQDCE 240
            DTFRWVGKKS+PEKD+W+GDW +VL ++PELER+ KR+M++LNPLKTLNLFKQI P+DCE
Sbjct: 181  DTFRWVGKKSSPEKDEWVGDWEKVLANNPELERFAKRSMDDLNPLKTLNLFKQIRPEDCE 240

Query: 241  LLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQMAVAMYINSDSVNPALMPGGN-GGGKTKPIRGFCQRLKGK 359
            AGLEKGISINNMME WDYLQ++VAMYINSDSVNP++MPG + GG K KPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPSMMPGASSGGAKAKPIRGFCQRLKGK 360

Query: 360  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKHKLQQLI 419
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLT+PEKVTRYN+ KLQ L+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNREKLQALV 420

Query: 420  VNGANVHPGANYLLKKNEEARRNLRYGDRIKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 479
            +NG NVHPGANY+LK NEEARRNLRYGDR+K+AK L++GD+VERHLEDGD+VLFNRQPSL
Sbjct: 421  INGPNVHPGANYILKANEEARRNLRYGDRLKIAKQLRVGDIVERHLEDGDIVLFNRQPSL 480

Query: 480  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 539
            HRLSILSH+AKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEA+NLMGVKNN
Sbjct: 481  HRLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAMNLMGVKNN 540

Query: 540  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFVQMLSMMSDGNLQFDIPPPAIMRP 599
            LLTPKSGEPIIAATQDFITGSYLISHKD+F DRATF Q+LSMMSD NLQFDIPPP I++P
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDTFLDRATFTQLLSMMSDSNLQFDIPPPTIIKP 600

Query: 600  HYLWTGKQLFSLLIKPNKKSPVIINLDAKNKVYIAPKNKAYPNEMSANDGYVVIRGSNIL 659
            + LWTGKQLFSLLIKPNK SPV+INLDAKNKV+I PK+K+ PNEMS NDG+VVIRGS IL
Sbjct: 601  YCLWTGKQLFSLLIKPNKDSPVVINLDAKNKVFIPPKSKSLPNEMSQNDGFVVIRGSQIL 660

Query: 660  SGVMDKSVLGDGKKHSVFYTILRDFGPQEATQAMNRMAKLCARYLGNRGFSIGISDVTPG 719
            SGVMDKSVLGDGKKHSVFYTILRD+GPQEA  AMNRMAKLCARYLGNRGFSIGISDVTP 
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGNRGFSIGISDVTPD 720

Query: 720  VELKATKEEMVEIAYAKCDELIDLYKRGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 779
              LK  KEE+VEIAYAKCDELIDL+ +GKLETQPGCNEEQTLEAKIGGLLSKVREEVGD+
Sbjct: 721  NALKQKKEELVEIAYAKCDELIDLFTKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDI 780

Query: 780  CIRELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 839
            CI ELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFRKNSK 840

Query: 840  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 900  DNTVRTSSNGIVQFTYGGDGLDPLNMEGNAKPVNFNRSWDHANNITYNHDDKGMLPYQIL 959
            DNTVRTSSNGIVQFTYGGDGLDPL MEGNA+PVNF RSWDHA NIT+++  +G+LPY I+
Sbjct: 901  DNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFKRSWDHAINITFDNSAQGLLPYAII 960

Query: 960  EETNAILHPLEQQLSRYDNVGNPLAPGLENEELYIDQHDAEREFYQSLRTYMSEKARKLA 1019
             +TN IL P E++L RYDN+G  +    + ++ ++DQ D+ER FY SLR YM EKA  LA
Sbjct: 961  NKTNDILAPFEERLIRYDNIGTLVKANDQAKDEFVDQLDSERNFYCSLRKYMQEKASILA 1020

Query: 1020 DITKSRGLKELYHAPALELQLMDLDASCPEVDVKSVNQLCKISSKLVRTFLDIAISKYRK 1079
             I K +GLKEL   P  E + MDLD         +V +LCKI+ K V  FL+IA+SKYR+
Sbjct: 1021 SIRKDKGLKELSSEPGNEFKEMDLDEGESSEARFAVEKLCKITEKTVEKFLEIAMSKYRR 1080

Query: 1080 AKVEPGTAVGAIGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1139
            A+VEPGTAVGAIGA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1081 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1140 INATLVNDDDERAARVVKGRVEKTLLSDVIFYIQDVYRDNMSFLQVKVDLATIEKLQLEL 1199
            INA LVND+D+RAARVVKGR+EKTLLSDV +Y+QDVY+DN+SFL+VK+DL+TI+KLQLEL
Sbjct: 1141 INAVLVNDNDKRAARVVKGRIEKTLLSDVAYYVQDVYKDNLSFLEVKIDLSTIDKLQLEL 1200

Query: 1200 TVEDIAIAITSAPKLKISTGDVSIVGRNKININVCNDLDKAKSISTLASEPHENDVFFKM 1259
            T+EDIA+A+T APKLKI T DV IV ++KI I+V  +  KAKSIST   EP ENDVF++M
Sbjct: 1201 TIEDIAVALTRAPKLKIQTTDVQIVSKDKITISVYPEGSKAKSISTSMKEPSENDVFYRM 1260

Query: 1260 QHLRRALPGIVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVVGYKTKTNHFL 1319
            Q LRRALP IVV GLPDI+RAVINIRDDGKRELLVEGYGLR+VM TDGV+G KT TNH L
Sbjct: 1261 QTLRRALPQIVVNGLPDIARAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTTTNHVL 1320

Query: 1320 EVYDVLGIEAARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1379
            EV+ VLGIEAAR+SII EIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR
Sbjct: 1321 EVFSVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380

Query: 1380 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMTIGTGSFKVVKGTNISPDD 1439
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTM+IGTG+FK++K T I PDD
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKILKSTEIKPDD 1440

Query: 1440 LKPKPTLFENLCSLNTLKVN 1459
            LKPK TLFENL +   LKVN
Sbjct: 1441 LKPKRTLFENLVAEPALKVN 1460

>YOR116C Chr15 complement(539763..544145) [4383 bp, 1460 aa] {ON}
            RPO31RNA polymerase III largest subunit C160, part of
            core enzyme; similar to bacterial beta-prime subunit and
            to RPA190 and RPO21
          Length = 1460

 Score = 2513 bits (6514), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1205/1460 (82%), Positives = 1309/1460 (89%), Gaps = 1/1460 (0%)

Query: 1    MKEVVVDILPKRISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGV 60
            MKEVVV   PKRI GLEFSALSA+DIVAQSEVE+ TRDLFDLE  RAPK  GALD +MGV
Sbjct: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60

Query: 61   SSSQAECSTCHGTLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNEEDK 120
            SSS  EC+TCHG LASCHGHFGH+KLALPVFH+GYFKATIQILQ ICKNC+ +LL+E DK
Sbjct: 61   SSSSLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120

Query: 121  RQFLSELRRPGIDNLRRMATLKKVLDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXLKIIH 180
            RQFL ELRRPG+DNLRRM  LKK+LDQCKKQRRCLHCG LN              LKIIH
Sbjct: 121  RQFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCGALNGVVKKAAAGAGSAALKIIH 180

Query: 181  DTFRWVGKKSAPEKDKWIGDWNQVLQHSPELERYMKRTMENLNPLKTLNLFKQISPQDCE 240
            DTFRWVGKKSAPEKD W+G+W +VL H+PELERY+KR M++LNPLKTLNLFKQI   DCE
Sbjct: 181  DTFRWVGKKSAPEKDIWVGEWKEVLAHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240

Query: 241  LLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID+TV +GRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQMAVAMYINSDSVNPALMPGG-NGGGKTKPIRGFCQRLKGK 359
            AGL+KGISINNMME WDYLQ+ VAMYINSDSVNPA++PG  NGGGK KPIRGFCQRLKGK
Sbjct: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360

Query: 360  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKHKLQQLI 419
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLT+PEKVTRYN+HKLQ+LI
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELI 420

Query: 420  VNGANVHPGANYLLKKNEEARRNLRYGDRIKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 479
            VNG NVHPGANYLLK+NE+ARRNLRYGDR+KLAKNLQIGDVVERHLEDGDVVLFNRQPSL
Sbjct: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480

Query: 480  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 539
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 540  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFVQMLSMMSDGNLQFDIPPPAIMRP 599
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+DRAT  Q+LSMMSDG   FDIPPPAIM+P
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEHFDIPPPAIMKP 600

Query: 600  HYLWTGKQLFSLLIKPNKKSPVIINLDAKNKVYIAPKNKAYPNEMSANDGYVVIRGSNIL 659
            +YLWTGKQ+FSLLIKPN  SPV+INLDAKNKV++ PK+K+ PNEMS NDG+V+IRGS IL
Sbjct: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPNEMSQNDGFVIIRGSQIL 660

Query: 660  SGVMDKSVLGDGKKHSVFYTILRDFGPQEATQAMNRMAKLCARYLGNRGFSIGISDVTPG 719
            SGVMDKSVLGDGKKHSVFYTILRD+GPQEA  AMNRMAKLCAR+LGNRGFSIGI+DVTP 
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720

Query: 720  VELKATKEEMVEIAYAKCDELIDLYKRGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 779
             +LK  KEE+VEIAY KCDELI L+ +G+LETQPGCNEEQTLEAKIGGLLSKVREEVGDV
Sbjct: 721  DDLKQKKEELVEIAYHKCDELITLFNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 780  CIRELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 839
            CI ELDN NAPLIMATCGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK
Sbjct: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 840  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 900  DNTVRTSSNGIVQFTYGGDGLDPLNMEGNAKPVNFNRSWDHANNITYNHDDKGMLPYQIL 959
            DNTVRTS+NGIVQFTYGGDGLDPL MEGNA+PVNFNRSWDHA NIT+N+ DKG+LPY I+
Sbjct: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNQDKGLLPYAIM 960

Query: 960  EETNAILHPLEQQLSRYDNVGNPLAPGLENEELYIDQHDAEREFYQSLRTYMSEKARKLA 1019
            E  N IL PLE++L RYDN G  +     N+  Y+DQ+DAER+FY SLR Y++ KA  LA
Sbjct: 961  ETANEILGPLEERLVRYDNSGCLVKREDLNKAEYVDQYDAERDFYHSLREYINGKATALA 1020

Query: 1020 DITKSRGLKELYHAPALELQLMDLDASCPEVDVKSVNQLCKISSKLVRTFLDIAISKYRK 1079
            ++ KSRG+  L   PA ELQ +D D + P+    SV+QL +IS K VR FL+IA+ KYRK
Sbjct: 1021 NLRKSRGMLGLLEPPAKELQGIDPDETVPDNVKTSVSQLYRISEKSVRKFLEIALFKYRK 1080

Query: 1080 AKVEPGTAVGAIGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1139
            A++EPGTA+GAIGA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1140 INATLVNDDDERAARVVKGRVEKTLLSDVIFYIQDVYRDNMSFLQVKVDLATIEKLQLEL 1199
            INA LVND+DERAARVVKGRVEKTLLSDV FY+QDVY+DN+SF+QV++DL TI+KLQLEL
Sbjct: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAFYVQDVYKDNLSFIQVRIDLGTIDKLQLEL 1200

Query: 1200 TVEDIAIAITSAPKLKISTGDVSIVGRNKININVCNDLDKAKSISTLASEPHENDVFFKM 1259
            T+EDIA+AIT A KLKI   DV+I+G+++I INV  +  KAKSIST A EP ENDVF++M
Sbjct: 1201 TIEDIAVAITRASKLKIQASDVNIIGKDRIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260

Query: 1260 QHLRRALPGIVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVVGYKTKTNHFL 1319
            Q LRRALP +VVKGLPDISRAVINIRDDGKRELLVEGYGLRDVM TDGV+G +T TNH L
Sbjct: 1261 QQLRRALPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSRTTTNHVL 1320

Query: 1320 EVYDVLGIEAARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1379
            EV+ VLGIEAAR SII EI+YTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR
Sbjct: 1321 EVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380

Query: 1380 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMTIGTGSFKVVKGTNISPDD 1439
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTM+IGTGSFKVVKGTNIS  D
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEKD 1440

Query: 1440 LKPKPTLFENLCSLNTLKVN 1459
            L PK  LFE+L +   LK N
Sbjct: 1441 LVPKRCLFESLSNEAALKAN 1460

>Smik_15.294 Chr15 complement(500962..505344) [4383 bp, 1460 aa] {ON}
            YOR116C (REAL)
          Length = 1460

 Score = 2511 bits (6508), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1200/1460 (82%), Positives = 1311/1460 (89%), Gaps = 1/1460 (0%)

Query: 1    MKEVVVDILPKRISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGV 60
            MKEVVV   PKRI GLEFSALSA+DIVAQSEVE+ TRDLFDLE  RAPK  GALD +MGV
Sbjct: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60

Query: 61   SSSQAECSTCHGTLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNEEDK 120
            SSS  EC+TCHG LASCHGHFGH+KLALPVFH+GYFKATIQILQ ICKNC+ +LL+E DK
Sbjct: 61   SSSSLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120

Query: 121  RQFLSELRRPGIDNLRRMATLKKVLDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXLKIIH 180
            R FL ELRRPG+DNLRRM  LKK+LDQCKKQRRCLHCG LN              LKIIH
Sbjct: 121  RHFLQELRRPGVDNLRRMGILKKILDQCKKQRRCLHCGALNGVVKKAAAGAGSAALKIIH 180

Query: 181  DTFRWVGKKSAPEKDKWIGDWNQVLQHSPELERYMKRTMENLNPLKTLNLFKQISPQDCE 240
            DTFRWVGKKSAPEKD W+G+W +VL H+PELERY+KR M++LNPLKTLNLFKQI   DCE
Sbjct: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240

Query: 241  LLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID+TV +GRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQMAVAMYINSDSVNPALMPGG-NGGGKTKPIRGFCQRLKGK 359
            AGL+KGISINNMME WDYLQ+ VAMYINSDSVNPA++PG  NGGGK KPIRGFCQRLKGK
Sbjct: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360

Query: 360  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKHKLQQLI 419
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLT+PEKVTRYN+HKLQ+LI
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELI 420

Query: 420  VNGANVHPGANYLLKKNEEARRNLRYGDRIKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 479
            VNG NVHPGANYLLK+NE+ARRNLRYGDR+KLAKNLQIGDVVERHLEDGDVVLFNRQPSL
Sbjct: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRLKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480

Query: 480  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 539
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 540  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFVQMLSMMSDGNLQFDIPPPAIMRP 599
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+DRAT  Q+LSMMSDG  QFDIPPPAIM+P
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEQFDIPPPAIMKP 600

Query: 600  HYLWTGKQLFSLLIKPNKKSPVIINLDAKNKVYIAPKNKAYPNEMSANDGYVVIRGSNIL 659
            +YLWTGKQ+FSLLIKPN  SPV+INLDAKNKV++ PK+K+ PNEMS NDG+V+IRGS IL
Sbjct: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPNEMSQNDGFVIIRGSKIL 660

Query: 660  SGVMDKSVLGDGKKHSVFYTILRDFGPQEATQAMNRMAKLCARYLGNRGFSIGISDVTPG 719
            SGVMDKSVLGDGKKHSVFYTILRD+GPQEA  AMNRMAKLCAR+LGNRGFSIGI+DVTP 
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720

Query: 720  VELKATKEEMVEIAYAKCDELIDLYKRGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 779
             +LK  KEE+VEIAY+KCDELI L+ +G+LETQPGCNEEQTLEAKIGGLLSKVREEVGDV
Sbjct: 721  DDLKQKKEELVEIAYSKCDELITLFNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 780  CIRELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 839
            CI ELDN NAPLIMATCGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK
Sbjct: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 840  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 900  DNTVRTSSNGIVQFTYGGDGLDPLNMEGNAKPVNFNRSWDHANNITYNHDDKGMLPYQIL 959
            DNTVRTS+NGIVQFTYGGDGLDPL MEGNA+PVNFNRSWDHA NIT+N+ D+G+LPY I+
Sbjct: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNQDEGLLPYAIM 960

Query: 960  EETNAILHPLEQQLSRYDNVGNPLAPGLENEELYIDQHDAEREFYQSLRTYMSEKARKLA 1019
            + TN IL PLE++L RYDN G  +     N+  Y+DQ+DAER+FY+SL+ Y++ KA  LA
Sbjct: 961  QTTNEILRPLEERLVRYDNSGCLVKEENLNKAEYVDQYDAERDFYRSLKEYINLKATALA 1020

Query: 1020 DITKSRGLKELYHAPALELQLMDLDASCPEVDVKSVNQLCKISSKLVRTFLDIAISKYRK 1079
            ++ KSRG+ EL   P  E + +D D   P+    SV+QL +IS K VR FL+IA+ KYRK
Sbjct: 1021 NLRKSRGMLELLEPPTKESEKVDPDKLVPDNVKTSVSQLYRISEKSVRKFLEIALYKYRK 1080

Query: 1080 AKVEPGTAVGAIGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1139
            A++EPGTA+GAIGA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1140 INATLVNDDDERAARVVKGRVEKTLLSDVIFYIQDVYRDNMSFLQVKVDLATIEKLQLEL 1199
            INA LVND+DERAARVVKGRVEKTLLSDV +Y+QDVY+DN+SF+QV++DL TI+KLQLEL
Sbjct: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLGTIDKLQLEL 1200

Query: 1200 TVEDIAIAITSAPKLKISTGDVSIVGRNKININVCNDLDKAKSISTLASEPHENDVFFKM 1259
            T+EDIA+AIT A KLKI   DV+I+G+++I INV  +  KA+SIST A EP ENDVF++M
Sbjct: 1201 TIEDIAVAITRAAKLKIQASDVNIIGKDRIAINVFPEGYKARSISTSAKEPSENDVFYRM 1260

Query: 1260 QHLRRALPGIVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVVGYKTKTNHFL 1319
            Q LRRALP +VVKGLPDISRAVINIRDDGKRELLVEGYGLRDVM TDGV+G +T TNH L
Sbjct: 1261 QQLRRALPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSRTTTNHVL 1320

Query: 1320 EVYDVLGIEAARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1379
            EV+ VLGIEAAR SII EI+YTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR
Sbjct: 1321 EVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380

Query: 1380 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMTIGTGSFKVVKGTNISPDD 1439
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTM+IGTGSFKVVKGTNIS  D
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISERD 1440

Query: 1440 LKPKPTLFENLCSLNTLKVN 1459
            L PKP LFE+L +   LK N
Sbjct: 1441 LVPKPCLFESLSNEAALKAN 1460

>ZYRO0F09856g Chr6 complement(798821..803197) [4377 bp, 1458 aa] {ON}
            highly similar to uniprot|P04051 Saccharomyces cerevisiae
            YOR116C
          Length = 1458

 Score = 2511 bits (6507), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1203/1459 (82%), Positives = 1314/1459 (90%), Gaps = 1/1459 (0%)

Query: 1    MKEVVVDILPKRISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGV 60
            MKEVV    PK+ISGLEFSALSA+DIVAQSEVEI TRDLFDLE+GRAPK GGALD +MGV
Sbjct: 1    MKEVVSSEAPKKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGV 60

Query: 61   SSSQAECSTCHGTLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNEEDK 120
            SSS  EC TCHG LASCHGHFGHIKLALPVFH+GYFKATIQILQ ICK C+ +LL + DK
Sbjct: 61   SSSSMECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTDK 120

Query: 121  RQFLSELRRPGIDNLRRMATLKKVLDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXLKIIH 180
            + FLSELRRPG+DNLRRM  LKKVLDQCKKQRRCL CG LN              LKIIH
Sbjct: 121  KHFLSELRRPGVDNLRRMGILKKVLDQCKKQRRCLQCGALNGVVKKAAAGGGSASLKIIH 180

Query: 181  DTFRWVGKKSAPEKDKWIGDWNQVLQHSPELERYMKRTMENLNPLKTLNLFKQISPQDCE 240
            DTFRW GKKS PEK+KWIGDW+ VL HSPELERY+KR M++LNPLKTLNLFKQ+ P+DCE
Sbjct: 181  DTFRWAGKKSVPEKEKWIGDWDSVLAHSPELERYVKRCMDDLNPLKTLNLFKQVKPEDCE 240

Query: 241  LLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDST+K+GRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTE+VWTSSLIK
Sbjct: 241  LLGIDSTIKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEVVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQMAVAMYINSDSVNPALMPGGNGGGKTKPIRGFCQRLKGKQ 360
            AGLEKGISINNMME WDYLQ+AVAMYINSDSVNPA++ GG GG K KPIRGFCQRLKGKQ
Sbjct: 301  AGLEKGISINNMMEHWDYLQLAVAMYINSDSVNPAILSGGTGG-KVKPIRGFCQRLKGKQ 359

Query: 361  GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKHKLQQLIV 420
            GRFRGNLSGKRVDFSGRTVISPDPNLS+DEVAVPDRVAKVLT+PE+VTRYNK KLQQL+V
Sbjct: 360  GRFRGNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQLVV 419

Query: 421  NGANVHPGANYLLKKNEEARRNLRYGDRIKLAKNLQIGDVVERHLEDGDVVLFNRQPSLH 480
            NG N +PGANYLLKK+E+ARRNLR+GDR+KLAKNL+IGD+VERHLEDGDVVLFNRQPSLH
Sbjct: 420  NGPNEYPGANYLLKKDEDARRNLRFGDRVKLAKNLRIGDLVERHLEDGDVVLFNRQPSLH 479

Query: 481  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 540
            RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQ+EEARAEAINLMGVK+NL
Sbjct: 480  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQSEEARAEAINLMGVKSNL 539

Query: 541  LTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFVQMLSMMSDGNLQFDIPPPAIMRPH 600
            LTPKSGEPIIAATQDFITGSYLISHKDSFFD+    Q+LSMMSDG LQFDIPPP I +P 
Sbjct: 540  LTPKSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMMSDGALQFDIPPPTIWKPC 599

Query: 601  YLWTGKQLFSLLIKPNKKSPVIINLDAKNKVYIAPKNKAYPNEMSANDGYVVIRGSNILS 660
            YLWTGKQ+FSLLI+PNKKSPV++NLDAKNKVYI PK+K+ PNEMS NDG+V+IRGS ILS
Sbjct: 600  YLWTGKQIFSLLIRPNKKSPVVLNLDAKNKVYIPPKSKSLPNEMSQNDGFVLIRGSQILS 659

Query: 661  GVMDKSVLGDGKKHSVFYTILRDFGPQEATQAMNRMAKLCARYLGNRGFSIGISDVTPGV 720
            GVMDKSVLGDGKKHSVFYTILRD+G QEA +AMNRMAKLCARY+GNRGFSIGISDVTP  
Sbjct: 660  GVMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNRMAKLCARYVGNRGFSIGISDVTPAE 719

Query: 721  ELKATKEEMVEIAYAKCDELIDLYKRGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVC 780
            ELK  KEEMVE AYAKCDELIDL+ +GKLETQPGCNEEQTLEAKIGGLLSKVREEVG+VC
Sbjct: 720  ELKEKKEEMVESAYAKCDELIDLFSKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC 779

Query: 781  IRELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKT 840
            I ELDN+NAPLIMATCGSKGS LNVSQMVAVVGQQIISG+RVPDGFQDRSLPHFPKNSKT
Sbjct: 780  INELDNMNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGSRVPDGFQDRSLPHFPKNSKT 839

Query: 841  PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 900
            PQSKGFVRNSFFSGL+PPEFL+HAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSC YD
Sbjct: 840  PQSKGFVRNSFFSGLTPPEFLYHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCLYD 899

Query: 901  NTVRTSSNGIVQFTYGGDGLDPLNMEGNAKPVNFNRSWDHANNITYNHDDKGMLPYQILE 960
            NTVRTSSNGIVQFTYGGDGLDPL MEGNA+PVNFNR+WDHA N+T+N+ D+G+LPYQI++
Sbjct: 900  NTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRTWDHATNVTFNNMDRGLLPYQIMQ 959

Query: 961  ETNAILHPLEQQLSRYDNVGNPLAPGLENEELYIDQHDAEREFYQSLRTYMSEKARKLAD 1020
             T  IL PLE +L RYDN+GN +     +   YIDQ+DAER FY SLR ++  KA+ LA 
Sbjct: 960  VTEEILQPLENRLVRYDNLGNEITKENRDRIEYIDQNDAERGFYHSLRDFIWAKAQLLAK 1019

Query: 1021 ITKSRGLKELYHAPALELQLMDLDASCPEVDVKSVNQLCKISSKLVRTFLDIAISKYRKA 1080
               S+ +KEL   PALELQ +DLD + PE    SV+Q+ +I+ K+VR FL +AI KYR+A
Sbjct: 1020 FRGSKDMKELMDEPALELQSVDLDENVPEDIRHSVDQVYRITDKMVREFLRVAILKYRRA 1079

Query: 1081 KVEPGTAVGAIGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1140
            KVEPGTAVGAIGA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII
Sbjct: 1080 KVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1139

Query: 1141 NATLVNDDDERAARVVKGRVEKTLLSDVIFYIQDVYRDNMSFLQVKVDLATIEKLQLELT 1200
            NA LVN+ DERAARVVKGR+EKTLLSDV FYIQDVYRDN+S+LQV+VDL+TI+KLQLELT
Sbjct: 1140 NAVLVNESDERAARVVKGRIEKTLLSDVAFYIQDVYRDNLSYLQVRVDLSTIDKLQLELT 1199

Query: 1201 VEDIAIAITSAPKLKISTGDVSIVGRNKININVCNDLDKAKSISTLASEPHENDVFFKMQ 1260
            +EDIA+A+T APKLKI   DV IVG++KI INV  D  KAKSISTLA EP EN+VF++MQ
Sbjct: 1200 IEDIAVAMTRAPKLKIQASDVHIVGKDKIAINVFPDGAKAKSISTLAKEPSENEVFYRMQ 1259

Query: 1261 HLRRALPGIVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVVGYKTKTNHFLE 1320
             LRRALPGIVVKGL DISRAVINIRDDGKRELLVEGYGLRDVM+TDGVVG+KT TNH LE
Sbjct: 1260 QLRRALPGIVVKGLSDISRAVINIRDDGKRELLVEGYGLRDVMSTDGVVGHKTVTNHILE 1319

Query: 1321 VYDVLGIEAARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRD 1380
            VY VLGIEAAR SI+ EIDYTMSNHGMSVDPRHIQLLGDVMTYKGE+LGITRFGLSKMRD
Sbjct: 1320 VYSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMRD 1379

Query: 1381 SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMTIGTGSFKVVKGTNISPDDL 1440
            SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTM IGTG+FKVVKGTN+S + L
Sbjct: 1380 SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMAIGTGAFKVVKGTNVSEEQL 1439

Query: 1441 KPKPTLFENLCSLNTLKVN 1459
            KPKPTLFE+L +  ++KVN
Sbjct: 1440 KPKPTLFESLVNETSVKVN 1458

>TBLA0A03720 Chr1 complement(929751..934127) [4377 bp, 1458 aa] {ON}
            Anc_5.426 YOR116C
          Length = 1458

 Score = 2504 bits (6491), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1201/1459 (82%), Positives = 1301/1459 (89%), Gaps = 1/1459 (0%)

Query: 1    MKEVVVDILPKRISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGV 60
            MKEVV   +PK+ISGLEFSALSA+DIVAQSEV I TRDL+DLE GRAPKK GALD RMGV
Sbjct: 1    MKEVVTSEIPKKISGLEFSALSAADIVAQSEVAITTRDLYDLEHGRAPKKSGALDQRMGV 60

Query: 61   SSSQAECSTCHGTLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNEEDK 120
            SSS  EC TCHG LASCHGHFGHIKLALPVFHVGYFKATIQILQ+ICK+CA +LL++EDK
Sbjct: 61   SSSNLECETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKSCAAVLLSDEDK 120

Query: 121  RQFLSELRRPGIDNLRRMATLKKVLDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXLKIIH 180
            R FLSELRRPGIDNL+RM  LKK+LDQCKKQRRCLHCG LN              LKIIH
Sbjct: 121  RNFLSELRRPGIDNLKRMGILKKILDQCKKQRRCLHCGGLNGVVKKAAAGGGSASLKIIH 180

Query: 181  DTFRWVGKKSAPEKDKWIGDWNQVLQHSPELERYMKRTMENLNPLKTLNLFKQISPQDCE 240
            DTFRWVGKK  PEKD W+GDW +VL H+PELER++KR M++LNPLKTLNLFKQI P+DCE
Sbjct: 181  DTFRWVGKKQTPEKDSWVGDWQEVLSHNPELERFVKRAMDDLNPLKTLNLFKQIKPEDCE 240

Query: 241  LLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDST K+GRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTE+VWTSSLIK
Sbjct: 241  LLGIDSTSKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEVVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQMAVAMYINSDSVNPALMPGGNGGGKTKPIRGFCQRLKGKQ 360
            AGLEKGISINNMME WDYLQ++VAMYINSDSVNP LMPG + G K KPIRGFCQRLKGKQ
Sbjct: 301  AGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPLLMPGASTGNKVKPIRGFCQRLKGKQ 360

Query: 361  GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKHKLQQLIV 420
            GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPE+VTRYNK KLQ L++
Sbjct: 361  GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPERVTRYNKRKLQALVL 420

Query: 421  NGANVHPGANYLLKKNEEARRNLRYGDRIKLAKNLQIGDVVERHLEDGDVVLFNRQPSLH 480
            NG NVHPGANYLLKK+EEARRNLRYGD++KLAKNLQIGDVVERHLEDGDVVLFNRQPSLH
Sbjct: 421  NGPNVHPGANYLLKKDEEARRNLRYGDKVKLAKNLQIGDVVERHLEDGDVVLFNRQPSLH 480

Query: 481  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 540
            RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL
Sbjct: 481  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 540

Query: 541  LTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFVQMLSMMSDGNLQFDIPPPAIMRPH 600
            LTPKSGEPIIAATQDFITGSYLISHKDSFFDRATF Q+LSMM DGNLQFDIPPPAIM+P 
Sbjct: 541  LTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMMCDGNLQFDIPPPAIMKPC 600

Query: 601  YLWTGKQLFSLLIKPNKKSPVIINLDAKNKVYIAPKNKAYPNEMSANDGYVVIRGSNILS 660
            YLWTGKQLFSLLIKPN  SPV+IN+DAKNKV+  PK+K+ P+EMS NDG+VVIRGS ILS
Sbjct: 601  YLWTGKQLFSLLIKPNSNSPVVINVDAKNKVFKPPKDKSLPSEMSPNDGFVVIRGSQILS 660

Query: 661  GVMDKSVLGDGKKHSVFYTILRDFGPQEATQAMNRMAKLCARYLGNRGFSIGISDVTPGV 720
            GVMDKSVLGDGKKHSVFYTILRD+GPQEA  AMNRMAKLCAR+LGNRGFSIGI+DVTP  
Sbjct: 661  GVMDKSVLGDGKKHSVFYTILRDYGPQEAATAMNRMAKLCARFLGNRGFSIGINDVTPDD 720

Query: 721  ELKATKEEMVEIAYAKCDELIDLYKRGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVC 780
            +LK  KE +VEIAYAKCDELI LY +GKLETQPGCNEEQTLEAKI G+LSKVREEVGD+C
Sbjct: 721  KLKNLKENLVEIAYAKCDELIGLYNQGKLETQPGCNEEQTLEAKISGILSKVREEVGDIC 780

Query: 781  IRELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKT 840
            I ELDN NAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSKT
Sbjct: 781  INELDNWNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSKT 840

Query: 841  PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 900
            PQSKGFVRNSF+SGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD
Sbjct: 841  PQSKGFVRNSFYSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 900

Query: 901  NTVRTSSNGIVQFTYGGDGLDPLNMEGNAKPVNFNRSWDHANNITYNHDDKGMLPYQILE 960
            NTVRTSSNGIVQFTYGGDGLDP +MEGNA+PVNFNRSWDHA NI ++++DK + PYQILE
Sbjct: 901  NTVRTSSNGIVQFTYGGDGLDPFDMEGNAQPVNFNRSWDHAYNIKFDNNDKTIYPYQILE 960

Query: 961  ETNAILHPLEQQLSRYDNVGNPLAPGLENEELYIDQHDAEREFYQSLRTYMSEKARKLAD 1020
             TN ILHPLE++L RYDN+G  + P    ++ ++DQ DAER FY SLR YM++KA +LAD
Sbjct: 961  ITNDILHPLEEKLIRYDNIGKVVTPENSGKDEFVDQLDAERNFYNSLRDYMTKKANELAD 1020

Query: 1021 ITKSRGLKELYHAPALELQLMDLDASCPEVDVKSVNQLCKISSKLVRTFLDIAISKYRKA 1080
            + KSRG+KEL  AP  E +LMDLD   P+    SV Q+C+I+   VR FL IAI+KYR+A
Sbjct: 1021 VRKSRGMKELLSAPGDEFKLMDLDEQTPDSIRHSVEQICRITENTVREFLKIAITKYRRA 1080

Query: 1081 KVEPGTAVGAIGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1140
            +VEPGTAVGAIGA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII
Sbjct: 1081 RVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1140

Query: 1141 NATLVNDDDERAARVVKGRVEKTLLSDVIFYIQDVYRDNMSFLQVKVDLATIEKLQLELT 1200
            NA LVN++DERAARVVKGR+EKTLLSDV +YIQD Y+DN S+L+VK+DL TIEKLQLELT
Sbjct: 1141 NAVLVNENDERAARVVKGRIEKTLLSDVAYYIQDCYKDNNSYLEVKIDLGTIEKLQLELT 1200

Query: 1201 VEDIAIAITSAPKLKISTGDVSIVGRNKININVCNDLDKAKSISTLASEPHENDVFFKMQ 1260
            + DIA AI  APKLKI  GDV     +KI I+V  +   +K IS  A EP EN+VF++MQ
Sbjct: 1201 MSDIADAIARAPKLKIQFGDVVPESNSKIRISVRPEASVSK-ISASAKEPLENNVFYRMQ 1259

Query: 1261 HLRRALPGIVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVVGYKTKTNHFLE 1320
            HLRRALP IVVKGLPDI+RAVINIRD+GKRELLVEGYGLRDVM TDGV+G KT TNH LE
Sbjct: 1260 HLRRALPSIVVKGLPDIARAVINIRDNGKRELLVEGYGLRDVMCTDGVIGSKTTTNHVLE 1319

Query: 1321 VYDVLGIEAARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRD 1380
            V  VLGIEAAR SII EIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRD
Sbjct: 1320 VNSVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRD 1379

Query: 1381 SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMTIGTGSFKVVKGTNISPDDL 1440
            SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTM+IGTGSFKVVK T+I    L
Sbjct: 1380 SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKDTHIRNGTL 1439

Query: 1441 KPKPTLFENLCSLNTLKVN 1459
            KPK TLFE+LC    +K+N
Sbjct: 1440 KPKRTLFESLCKETNIKIN 1458

>Skud_15.279 Chr15 complement(496216..500598) [4383 bp, 1460 aa] {ON}
            YOR116C (REAL)
          Length = 1460

 Score = 2503 bits (6486), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1196/1460 (81%), Positives = 1310/1460 (89%), Gaps = 1/1460 (0%)

Query: 1    MKEVVVDILPKRISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGV 60
            MKEVVV   PKRI GLEFSALSA+DIVAQSEVE+ TRDLFDLE  RAPK  GALD +MGV
Sbjct: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60

Query: 61   SSSQAECSTCHGTLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNEEDK 120
            SSS  EC+TCHG LASCHGHFGH+KLALPVFH+GYFKATIQILQ ICKNC+ +LL+E DK
Sbjct: 61   SSSTLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETDK 120

Query: 121  RQFLSELRRPGIDNLRRMATLKKVLDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXLKIIH 180
            R FL ELRRPG+DNLRRM  LKK+LDQCKKQRRCLHCG LN              LKIIH
Sbjct: 121  RHFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCGALNGVVKKAAAGAGSAALKIIH 180

Query: 181  DTFRWVGKKSAPEKDKWIGDWNQVLQHSPELERYMKRTMENLNPLKTLNLFKQISPQDCE 240
            DTFRWVGKKSAPEKD W+G+W +VL H+PELERY+KR M++LNPLKTLNLFKQI   DCE
Sbjct: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240

Query: 241  LLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID+T+ +GRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDATIPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQMAVAMYINSDSVNPALMPGG-NGGGKTKPIRGFCQRLKGK 359
            AGL+KGISINNMME WDYLQ+ VAMYINSDSVNPA++PG  NGGGK KPIRGFCQRLKGK
Sbjct: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360

Query: 360  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKHKLQQLI 419
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLT+PEKVTRYN+ KLQ+LI
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLKLQELI 420

Query: 420  VNGANVHPGANYLLKKNEEARRNLRYGDRIKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 479
            VNG NVHPGANYLLK+NE+ARRNLRYGDR+KLAKNLQIGDVVERHLEDGDVVLFNRQPSL
Sbjct: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480

Query: 480  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 539
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 540  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFVQMLSMMSDGNLQFDIPPPAIMRP 599
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+DRAT  Q+LSMMSDG  QFD+PPPAIM+P
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEQFDVPPPAIMKP 600

Query: 600  HYLWTGKQLFSLLIKPNKKSPVIINLDAKNKVYIAPKNKAYPNEMSANDGYVVIRGSNIL 659
            +YLWTGKQ+FSLLIKPN  SPV+INLDAKNKV++ PK+K+ P+EMS NDG+V+IRGS IL
Sbjct: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVIIRGSQIL 660

Query: 660  SGVMDKSVLGDGKKHSVFYTILRDFGPQEATQAMNRMAKLCARYLGNRGFSIGISDVTPG 719
            SGVMDKSVLGDGKKHSVFYTILRD+GPQEA  AMNRMAKLCAR+LGNRGFSIGI+DVTP 
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720

Query: 720  VELKATKEEMVEIAYAKCDELIDLYKRGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 779
             +LK  KEE+VEIAY KCDELI L+ +G+LETQPGCNEEQTLEAKIGG LSKVREEVGDV
Sbjct: 721  DDLKQKKEELVEIAYRKCDELITLFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGDV 780

Query: 780  CIRELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 839
            CI ELDN NAPLIMATCGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK
Sbjct: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 840  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 900  DNTVRTSSNGIVQFTYGGDGLDPLNMEGNAKPVNFNRSWDHANNITYNHDDKGMLPYQIL 959
            DNTVRTS+NGIVQFTYGGDGLDPL MEGNA+PVNFNRSWDHA NIT+N++D+G+LPY I+
Sbjct: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNEDEGLLPYAIM 960

Query: 960  EETNAILHPLEQQLSRYDNVGNPLAPGLENEELYIDQHDAEREFYQSLRTYMSEKARKLA 1019
            +  N IL PLE++L RYDN G+ +    ++   Y+DQ+DAER+FY+SLR Y++ KA  LA
Sbjct: 961  KTANEILRPLEERLVRYDNRGSLVKEEDKDRAEYVDQYDAERDFYRSLREYINLKATALA 1020

Query: 1020 DITKSRGLKELYHAPALELQLMDLDASCPEVDVKSVNQLCKISSKLVRTFLDIAISKYRK 1079
            ++ KSRG+ E    P  EL+ +DLD + P+    SV+QL +IS K VR FL+IA+ KYRK
Sbjct: 1021 NLRKSRGMFEQLEPPEKELEGIDLDEAVPDNVRTSVSQLYRISEKSVRKFLEIALFKYRK 1080

Query: 1080 AKVEPGTAVGAIGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1139
            A++EPGTA+GAIGA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASK ISTPI
Sbjct: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKSISTPI 1140

Query: 1140 INATLVNDDDERAARVVKGRVEKTLLSDVIFYIQDVYRDNMSFLQVKVDLATIEKLQLEL 1199
            INA LVND+DERAARVVKGRVEKTLLSDV +Y+QDVY+DN+SF+QV++DL+TI+KLQLEL
Sbjct: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLSTIDKLQLEL 1200

Query: 1200 TVEDIAIAITSAPKLKISTGDVSIVGRNKININVCNDLDKAKSISTLASEPHENDVFFKM 1259
            T+EDIAIAIT A KLKI   DV+I+G+++I INV  +  KAKSIST A EP ENDVF++M
Sbjct: 1201 TIEDIAIAITRASKLKIQASDVNIIGKDQIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260

Query: 1260 QHLRRALPGIVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVVGYKTKTNHFL 1319
            Q LRRALP +VVKGLPDISRAVINIRDD KRELLVEGYGLRDVM TDGV+G KT TNH L
Sbjct: 1261 QQLRRALPDVVVKGLPDISRAVINIRDDAKRELLVEGYGLRDVMCTDGVIGSKTTTNHVL 1320

Query: 1320 EVYDVLGIEAARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1379
            EV+ VLGIEAAR SII EI+YTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR
Sbjct: 1321 EVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380

Query: 1380 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMTIGTGSFKVVKGTNISPDD 1439
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTM+IGTGSFKVVKGTNIS  D
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEKD 1440

Query: 1440 LKPKPTLFENLCSLNTLKVN 1459
            L PKP LFE+L +   LK N
Sbjct: 1441 LVPKPCLFESLSNEAALKAN 1460

>Suva_8.169 Chr8 complement(297556..301938) [4383 bp, 1460 aa] {ON}
            YOR116C (REAL)
          Length = 1460

 Score = 2498 bits (6473), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1192/1460 (81%), Positives = 1310/1460 (89%), Gaps = 1/1460 (0%)

Query: 1    MKEVVVDILPKRISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGV 60
            MKEVVV   PKRI GLEFSALSA+DIVAQSEVE+ TRDLFDLE  RAP+  GALD +MGV
Sbjct: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMGV 60

Query: 61   SSSQAECSTCHGTLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNEEDK 120
            SSS  EC+TCHG LASCHGHFGH+KLALPVFH+GYFKATIQILQ ICKNC+ +LL+E DK
Sbjct: 61   SSSSLECTTCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120

Query: 121  RQFLSELRRPGIDNLRRMATLKKVLDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXLKIIH 180
            R+FL ELRRPG+DNLRRM  LKK+LDQCKKQRRCLHCG LN              LKIIH
Sbjct: 121  RKFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCGALNGVVKKAAAGAGSAALKIIH 180

Query: 181  DTFRWVGKKSAPEKDKWIGDWNQVLQHSPELERYMKRTMENLNPLKTLNLFKQISPQDCE 240
            DTFRWVGKKSAPEKD W+G+W +VL H+PELERY+KR M++LNPLKTLNLFKQI   DCE
Sbjct: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240

Query: 241  LLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID+TV +GRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQMAVAMYINSDSVNPALMPGG-NGGGKTKPIRGFCQRLKGK 359
            AGL+KGISINNMME WDYLQ+ VAMYINSDSVNPA++PG  NGGGK KPIRGFCQRLKGK
Sbjct: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360

Query: 360  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKHKLQQLI 419
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLT+PEKVTRYN+HKLQ+L+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELV 420

Query: 420  VNGANVHPGANYLLKKNEEARRNLRYGDRIKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 479
            VNG NVHPGANYLLKKNE+ARRNLRYGDR+KLAK+LQIGDV+ERHLEDGDVVLFNRQPSL
Sbjct: 421  VNGPNVHPGANYLLKKNEDARRNLRYGDRMKLAKSLQIGDVIERHLEDGDVVLFNRQPSL 480

Query: 480  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 539
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 540  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFVQMLSMMSDGNLQFDIPPPAIMRP 599
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+DRAT  Q+L MMSDG  QFD+PPPAIM+P
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLCMMSDGVEQFDVPPPAIMKP 600

Query: 600  HYLWTGKQLFSLLIKPNKKSPVIINLDAKNKVYIAPKNKAYPNEMSANDGYVVIRGSNIL 659
            +YLWTGKQ+FSLLIKP+ KSPV+INLDAKNKV++ PK+K+ P+EMS NDG+VVIRGS IL
Sbjct: 601  YYLWTGKQVFSLLIKPSHKSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVVIRGSQIL 660

Query: 660  SGVMDKSVLGDGKKHSVFYTILRDFGPQEATQAMNRMAKLCARYLGNRGFSIGISDVTPG 719
            SGVMDKSVLGDGKKHSVFYTILRD+GPQEA  AMNRMAKLCAR+LGNRGFSIGI+DVTP 
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720

Query: 720  VELKATKEEMVEIAYAKCDELIDLYKRGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 779
             +LK  KEE+VEIAY KCDELI  + +G+LETQPGCNEEQTLEAKIGG LSKVREEVGDV
Sbjct: 721  DDLKQKKEELVEIAYRKCDELITSFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGDV 780

Query: 780  CIRELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 839
            CI ELDN NAPLIMATCGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK
Sbjct: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 840  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 900  DNTVRTSSNGIVQFTYGGDGLDPLNMEGNAKPVNFNRSWDHANNITYNHDDKGMLPYQIL 959
            DNTVRTS+NGIVQFTYGGDGLDPL MEGNA+PVNFNRSWDHA NIT+++ D+G+LPY I+
Sbjct: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFDNQDEGLLPYAIM 960

Query: 960  EETNAILHPLEQQLSRYDNVGNPLAPGLENEELYIDQHDAEREFYQSLRTYMSEKARKLA 1019
            E  N IL PLE +L RYDN G  +    +++  ++DQ+DAER+FY+SLR Y++ KA  LA
Sbjct: 961  ETANKILVPLEDRLVRYDNRGFLVKDEDKDKAEHVDQYDAERDFYRSLREYINLKATTLA 1020

Query: 1020 DITKSRGLKELYHAPALELQLMDLDASCPEVDVKSVNQLCKISSKLVRTFLDIAISKYRK 1079
            ++ KSRG+ EL +AP  ELQ MD D + P     SV+QL +IS + V+ FL+IA+ KYRK
Sbjct: 1021 NLRKSRGMLELVNAPPKELQGMDPDEAVPTNVRTSVSQLYRISEQSVKKFLEIALFKYRK 1080

Query: 1080 AKVEPGTAVGAIGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1139
            A++EPGTA+GAIGA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1140 INATLVNDDDERAARVVKGRVEKTLLSDVIFYIQDVYRDNMSFLQVKVDLATIEKLQLEL 1199
            INA LVND+DERAARVVKGRVEKTLLSDV +Y+QDVY+DN+SF+QV++DL TI+KLQLEL
Sbjct: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLGTIDKLQLEL 1200

Query: 1200 TVEDIAIAITSAPKLKISTGDVSIVGRNKININVCNDLDKAKSISTLASEPHENDVFFKM 1259
            T+EDIA+AIT A KLKI   DV+I+G++KI INV  +  KAKSIST A EP ENDVF++M
Sbjct: 1201 TIEDIAVAITRASKLKIQAPDVTIIGKDKIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260

Query: 1260 QHLRRALPGIVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVVGYKTKTNHFL 1319
            Q LRRALP +VVKGL DISRAVINIRDDGKRELLVEGYGLRDVM TDGV+G KT TNH L
Sbjct: 1261 QQLRRALPDVVVKGLADISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSKTTTNHVL 1320

Query: 1320 EVYDVLGIEAARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1379
            EV+ VLGIEAAR SI+ EI+YTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR
Sbjct: 1321 EVFSVLGIEAARYSIVREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380

Query: 1380 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMTIGTGSFKVVKGTNISPDD 1439
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTM+IGTGSFKV+KGTN+S  D
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVIKGTNVSEKD 1440

Query: 1440 LKPKPTLFENLCSLNTLKVN 1459
            L PKP LFE+L +   LK N
Sbjct: 1441 LIPKPCLFESLSNEAALKAN 1460

>CAGL0L11660g Chr12 (1245685..1250064) [4380 bp, 1459 aa] {ON} highly
            similar to uniprot|P04051 Saccharomyces cerevisiae
            YOR116c RPO31 DNA-directed RNA polymerase III
          Length = 1459

 Score = 2479 bits (6425), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1199/1456 (82%), Positives = 1304/1456 (89%), Gaps = 8/1456 (0%)

Query: 1    MKEVVVDILPKRISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGV 60
            MKEVV+   PKRISGLEFSALS +DIVAQSE+EI +RDLFDLE+ R+PK+GGALD RMGV
Sbjct: 1    MKEVVIGETPKRISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGV 60

Query: 61   SSSQAECSTCHGTLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNEEDK 120
            S+S  EC+TCHG LASCHGHFGHIKLALPVFHVGYFKATIQILQ ICK C+ +LL+E+DK
Sbjct: 61   SASSMECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDK 120

Query: 121  RQFLSELRRPGIDNLRRMATLKKVLDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXLKIIH 180
            R FLSELRRPG+DNLRRMA LKKVLDQCKKQRRCLHCG LN              LKIIH
Sbjct: 121  RHFLSELRRPGVDNLRRMALLKKVLDQCKKQRRCLHCGALNGVVKKAAAGAGTASLKIIH 180

Query: 181  DTFRWVGKKSAPEKDKWIGDWNQVLQHSPELERYMKRTMENLNPLKTLNLFKQISPQDCE 240
            DTFRWVGKKS PEKDKWIGDW +VL H+PELERY+KR  ++LNPLKTLNLFKQI+ +DCE
Sbjct: 181  DTFRWVGKKSTPEKDKWIGDWKEVLSHNPELERYVKRATDDLNPLKTLNLFKQIASEDCE 240

Query: 241  LLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID+T KAGRPETYIWRY+PAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDATNKAGRPETYIWRYIPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQMAVAMYINSDSVNPALMPGGN-GGGKTKPIRGFCQRLKGK 359
            AG+EKGISINNMME WDYLQM VAMYINSDS+NPA++PG + GGGK KPIRGFCQRLKGK
Sbjct: 301  AGIEKGISINNMMEHWDYLQMTVAMYINSDSINPAMLPGSSTGGGKVKPIRGFCQRLKGK 360

Query: 360  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKHKLQQLI 419
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVP  VAKVLTFPEKVTRYN  KL+QL+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNIKKLRQLV 420

Query: 420  VNGANVHPGANYLLKKNEEARRNLRYGDRIKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 479
             NG NVHPGANYLLKKNEEARRNLRYGDR KLA NLQ GDVVERHLEDGDVVLFNRQPSL
Sbjct: 421  QNGPNVHPGANYLLKKNEEARRNLRYGDRQKLANNLQYGDVVERHLEDGDVVLFNRQPSL 480

Query: 480  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 539
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 540  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFVQMLSMMSDGNLQFDIPPPAIMRP 599
            LLTPKSGEPIIAATQDFITGSYLISHKDSFFD+A+  Q+LSMMSDG+LQFDIPPPAIM+P
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDKASLTQLLSMMSDGSLQFDIPPPAIMKP 600

Query: 600  HYLWTGKQLFSLLIKPNKKSPVIINLDAKNKVYIAPKNKAYPNEMSANDGYVVIRGSNIL 659
             YLWTGKQ+FSLLIKPNK SPV INLDAKNKVYI PK K YPNEMS NDG+V++RGS IL
Sbjct: 601  CYLWTGKQVFSLLIKPNKNSPVKINLDAKNKVYIPPKQKHYPNEMSQNDGFVIVRGSQIL 660

Query: 660  SGVMDKSVLGDGKKHSVFYTILRDFGPQEATQAMNRMAKLCARYLGNRGFSIGISDVTPG 719
            SGVMDKSVLGDGKKHSVFYTILRDFGPQEA  AMNRMAKLCARYLGNRGFSIGISDVTP 
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDFGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPA 720

Query: 720  VELKATKEEMVEIAYAKCDELIDLYKRGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 779
             +LK  KE++VEIAYAKCDELIDLY +GKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV
Sbjct: 721  DDLKQKKEDLVEIAYAKCDELIDLYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 780  CIRELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 839
            CI ELDNLNAPLIMATCGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 840  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 900  DNTVRTSSNGIVQFTYGGDGLDPLNMEGNAKPVNFNRSWDHANNITYNHDDKGMLPYQIL 959
            DNTVRTSSNGIVQFTYGGDGLDPL MEGNA+PVNFNRSWDHA NIT+N+ D+G+LPY+I 
Sbjct: 901  DNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNTDRGLLPYEIK 960

Query: 960  EETNAILHPLEQQLSRYDNVGNPLAPGLENEELYIDQHDAEREFYQSLRTYMSEKARKLA 1019
            +  + IL PLE++L RYD +G P++   +  + Y+DQHD+ER FY SLR +M++KA+KLA
Sbjct: 961  KTVDNILKPLEKRLIRYDTLGRPVSAEDDKLDDYVDQHDSERLFYASLREFMTDKAKKLA 1020

Query: 1020 DITKSRGLKELYHAPALELQLMDLDASCPEVDV---KSVNQLCKISSKLVRTFLDIAISK 1076
             + KSRGL +L     LE      D     +D     S+ QL +I+   V+ FL+IAISK
Sbjct: 1021 KLRKSRGLPKLIKKSELE----GYDPENEHIDAIVQHSITQLYRITEDAVQKFLEIAISK 1076

Query: 1077 YRKAKVEPGTAVGAIGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVIS 1136
            Y +AKVEPGTAVGAIGA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVIS
Sbjct: 1077 YHRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVIS 1136

Query: 1137 TPIINATLVNDDDERAARVVKGRVEKTLLSDVIFYIQDVYRDNMSFLQVKVDLATIEKLQ 1196
            TPIINA LVN++DERAARVVKGR+EKTLLSDV +YIQDVY++NM++LQVKVDL TI+KLQ
Sbjct: 1137 TPIINAVLVNNNDERAARVVKGRIEKTLLSDVCYYIQDVYKENMAYLQVKVDLNTIDKLQ 1196

Query: 1197 LELTVEDIAIAITSAPKLKISTGDVSIVGRNKININVCNDLDKAKSISTLASEPHENDVF 1256
            LELT+EDIAIAIT APKLKI T DV+++G++KI INV  +   +K+ ST   EP ENDVF
Sbjct: 1197 LELTIEDIAIAITRAPKLKIQTSDVTVLGKDKIAINVLPEGFGSKTSSTSLKEPTENDVF 1256

Query: 1257 FKMQHLRRALPGIVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVVGYKTKTN 1316
            ++MQ LRRALP I+VKGL DI+RAVINIRDDGKRELLVEGYGLRDVM TDGV+G KT TN
Sbjct: 1257 YRMQTLRRALPSIMVKGLNDIARAVINIRDDGKRELLVEGYGLRDVMCTDGVIGAKTATN 1316

Query: 1317 HFLEVYDVLGIEAARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLS 1376
            H LE+++VLGIEAAR SII EIDYTMSNHGMSVDPRHIQLLGDVMT+KGEVLGITRFGLS
Sbjct: 1317 HVLEIFNVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGITRFGLS 1376

Query: 1377 KMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMTIGTGSFKVVKGTNIS 1436
            KMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTM+IGTGSFKVVK T+I+
Sbjct: 1377 KMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKNTDIA 1436

Query: 1437 PDDLKPKPTLFENLCS 1452
             D+LKPK TLFE+L S
Sbjct: 1437 EDELKPKRTLFESLTS 1452

>KNAG0B04240 Chr2 (806212..810579) [4368 bp, 1455 aa] {ON} Anc_5.426
            YOR116C
          Length = 1455

 Score = 2460 bits (6376), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1181/1463 (80%), Positives = 1297/1463 (88%), Gaps = 12/1463 (0%)

Query: 1    MKEVVVDILPKRISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGV 60
            MKEVVV    K+ISG+EFSAL+A+DIVAQSEVEI TRDLFDLE GR  K GGALD RMGV
Sbjct: 1    MKEVVVGETQKKISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGV 60

Query: 61   SSSQAECSTCHGTLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNEEDK 120
            SSS  EC TCHG LASCHGHFGHIKLALPVFHVGYFK+TIQILQ ICK+C+ +LL+++D+
Sbjct: 61   SSSSQECMTCHGNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDCSAVLLSDKDR 120

Query: 121  RQFLSELRRPGIDNLRRMATLKKVLDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXLKIIH 180
            R FL ELRRPGIDNLR+M+ LKKV+DQCKKQRRCL CG LN              LKIIH
Sbjct: 121  RDFLKELRRPGIDNLRKMSILKKVIDQCKKQRRCLKCGGLNGVVKKAAAGAGTASLKIIH 180

Query: 181  DTFRWVGKKSAPEKDKWIGDWNQVLQHSPELERYMKRTMENLNPLKTLNLFKQISPQDCE 240
            DTFRWVGKK  PEKD+WIG+WN++L H PELER++KR  ++LNPLKTL LFKQ+  +DCE
Sbjct: 181  DTFRWVGKKMVPEKDRWIGEWNEILTHHPELERFVKRCSDDLNPLKTLTLFKQLKSEDCE 240

Query: 241  LLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGI+STV++GRPETYIWRYLPAPPVCIRPSV MQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGINSTVRSGRPETYIWRYLPAPPVCIRPSVTMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQMAVAMYINSDSVNPALMPGGN-GGGKTKPIRGFCQRLKGK 359
            AGL KGISINNMME WDYLQ+ VAMYINSDSVNPA++PG + GGGK KPIRGFCQRLKGK
Sbjct: 301  AGLAKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGK 360

Query: 360  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKHKLQQLI 419
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVP  VAKVLTFPEKVTRYNK KLQQLI
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNKRKLQQLI 420

Query: 420  VNGANVHPGANYLLKKNEEARRNLRYGDRIKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 479
            +NG  VHPGANYLLKKNEEARRNLRYGD++KLAKNLQ GDVVERHLEDGDVVLFNRQPSL
Sbjct: 421  INGPTVHPGANYLLKKNEEARRNLRYGDKLKLAKNLQYGDVVERHLEDGDVVLFNRQPSL 480

Query: 480  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 539
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 540  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFVQMLSMMSDGNLQFDIPPPAIMRP 599
            LLTPKSGEPIIAATQDFITGSYLISHKDSFFD  +  Q+LSMMSD  LQFDIPPPAIM+P
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDLGSLTQLLSMMSDAKLQFDIPPPAIMKP 600

Query: 600  HYLWTGKQLFSLLIKPNKKSPVIINLDAKNKVYIAPKNKAYPNEMSANDGYVVIRGSNIL 659
            +YLWTGKQ+FSLLI+PNKKSPV+INLDAKNKVYI PK+K++PNEMS NDG+V+IRGS IL
Sbjct: 601  YYLWTGKQVFSLLIRPNKKSPVVINLDAKNKVYIPPKDKSFPNEMSINDGFVIIRGSEIL 660

Query: 660  SGVMDKSVLGDGKKHSVFYTILRDFGPQEATQAMNRMAKLCARYLGNRGFSIGISDVTPG 719
            SGVMDKSVLGDGKKHSVFYTILRD+GPQEA   MNRMAKLCARYLGNRGFSIGISDVTP 
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANTMNRMAKLCARYLGNRGFSIGISDVTPS 720

Query: 720  VELKATKEEMVEIAYAKCDELIDLYKRGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 779
             +L+  KEEMV  AYAKCDELID++K GKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV
Sbjct: 721  SDLRDKKEEMVRFAYAKCDELIDMFKNGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 780  CIRELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 839
            CI ELDNLNAPLIMATCGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSK 840

Query: 840  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899
            TPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 900  DNTVRTSSNGIVQFTYGGDGLDPLNMEGNAKPVNFNRSWDHANNITYNHDDKGMLPYQIL 959
            D+TVRTS+NGIVQFTYGGDGLDPL+MEGNAKPVNF RSWDHA NIT+N ++ G+LPY+I+
Sbjct: 901  DDTVRTSANGIVQFTYGGDGLDPLDMEGNAKPVNFIRSWDHACNITFNKNETGLLPYEIV 960

Query: 960  EETNAILHPLEQQLSRYDNVGNPLAPGLENEELYIDQHDAEREFYQSLRTYMSEKARKLA 1019
             ET+ +L PLE++L RYDN+G  +   L ++E Y D+HDAER FY+SLR YM EKA +LA
Sbjct: 961  RETDNVLKPLEEKLIRYDNLGAVVPKELIDDERYADRHDAERAFYKSLRMYMQEKAARLA 1020

Query: 1020 DITKSRGLKELYHA---PALELQLMDLDASCPEVDVKSVNQLCKISSKLVRTFLDIAISK 1076
             I  +RGL E+       ++E+   +L A        SV+Q+ KI+ K V  FL IA+ K
Sbjct: 1021 QIRNTRGLLEMTQNGGDTSMEVVSSELQA--------SVDQVYKITKKNVNAFLTIALHK 1072

Query: 1077 YRKAKVEPGTAVGAIGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVIS 1136
            Y +AKVEPGTAVGAIGA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVIS
Sbjct: 1073 YHRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVIS 1132

Query: 1137 TPIINATLVNDDDERAARVVKGRVEKTLLSDVIFYIQDVYRDNMSFLQVKVDLATIEKLQ 1196
            TPIINA LVN+ DERAARVVKGR+EKTLLSD+ FYIQDVYR NMS+L+++VDLATIEKLQ
Sbjct: 1133 TPIINAVLVNEGDERAARVVKGRIEKTLLSDLAFYIQDVYRGNMSYLEIRVDLATIEKLQ 1192

Query: 1197 LELTVEDIAIAITSAPKLKISTGDVSIVGRNKININVCNDLDKAKSISTLASEPHENDVF 1256
            LELT+EDIA+A++ APKLKI T D+ I+G++KI++NV  +  KAKSIST A EP EN+VF
Sbjct: 1193 LELTMEDIAVALSRAPKLKIQTTDIHILGKDKIHVNVYPEGMKAKSISTSAKEPSENEVF 1252

Query: 1257 FKMQHLRRALPGIVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVVGYKTKTN 1316
            +KMQ LRR+LP +VVKGLPDISRAVINIRDDGKRELLVEGYGLR+VM TDGV+G KT TN
Sbjct: 1253 YKMQTLRRSLPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTITN 1312

Query: 1317 HFLEVYDVLGIEAARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLS 1376
            H LEV  VLGIEAAR SI+ EIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLS
Sbjct: 1313 HVLEVNSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLS 1372

Query: 1377 KMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMTIGTGSFKVVKGTNIS 1436
            KMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTM++GTGSFKVVK  ++S
Sbjct: 1373 KMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSVGTGSFKVVKYNDVS 1432

Query: 1437 PDDLKPKPTLFENLCSLNTLKVN 1459
              DLK +PTLFE+L S   +K N
Sbjct: 1433 ERDLKVRPTLFESLASETAIKAN 1455

>TPHA0H01760 Chr8 complement(402254..406633) [4380 bp, 1459 aa] {ON}
            Anc_5.426 YOR116C
          Length = 1459

 Score = 2451 bits (6352), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1174/1455 (80%), Positives = 1295/1455 (89%), Gaps = 3/1455 (0%)

Query: 1    MKEVVVDILPKRISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGV 60
            MKEVV+   PKRISGLEFSALS SDI+AQSEVEI TRDLFDLE+GRAP +GGALD +MGV
Sbjct: 1    MKEVVISETPKRISGLEFSALSTSDIIAQSEVEISTRDLFDLENGRAPIEGGALDPKMGV 60

Query: 61   SSSQAECSTCHGTLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNEEDK 120
            SSS  ECSTCHG LASCHGHFGHIKL+LPVFHVGYFKATIQILQ +CK+C+ +LLN+ DK
Sbjct: 61   SSSTLECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQILQGVCKSCSAILLNDTDK 120

Query: 121  RQFLSELRRPGIDNLRRMATLKKVLDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXLKIIH 180
            R FL ELR+P IDNL+RM+ LKK+LDQCKKQRRCL CG LN              LKIIH
Sbjct: 121  RHFLHELRKPDIDNLKRMSILKKILDQCKKQRRCLECGDLNGVVKRAATGSGSASLKIIH 180

Query: 181  DTFRWVGKKSAPEKDKWIGDWNQVLQHSPELERYMKRTMENLNPLKTLNLFKQISPQDCE 240
            DTFRWVGKK+ PEKDKWIGDWNQVL ++PELE+++KR  ++LNPLKTLNLFKQI  +DCE
Sbjct: 181  DTFRWVGKKNVPEKDKWIGDWNQVLTNNPELEKFIKRCTDDLNPLKTLNLFKQIKNEDCE 240

Query: 241  LLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDSTV +GRPETYIWRYLPAPPVCIRPSVMMQDS ASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTVASGRPETYIWRYLPAPPVCIRPSVMMQDSSASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQMAVAMYINSDSVNPALMPGGNGGGKTKPIRGFCQRLKGKQ 360
            AGLEKGISINNMME WDYLQ++VAMYINSDSVN  +MPG NGG K KPIRGFCQRLKGKQ
Sbjct: 301  AGLEKGISINNMMEHWDYLQLSVAMYINSDSVNLLVMPGSNGGTKAKPIRGFCQRLKGKQ 360

Query: 361  GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKHKLQQLIV 420
            GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVP+ VAKVLT+PEKVTRYNK KLQ+L++
Sbjct: 361  GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPELVAKVLTYPEKVTRYNKTKLQKLVM 420

Query: 421  NGANVHPGANYLLKKNEEARRNLRYGDRIKLAKNLQIGDVVERHLEDGDVVLFNRQPSLH 480
            NG NVHPGANYLLK NEEARRNLRYG+R KLAK L+IGD+VERHLEDGD+VLFNRQPSLH
Sbjct: 421  NGPNVHPGANYLLKSNEEARRNLRYGNRDKLAKQLRIGDIVERHLEDGDIVLFNRQPSLH 480

Query: 481  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHV-PQTEEARAEAINLMGVKNN 539
            RLSILSH+AKIRPWRTFRLNECVCTPYNADFDGDEMNL    QTEEARAEAINLMGVKNN
Sbjct: 481  RLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLLCYQQTEEARAEAINLMGVKNN 540

Query: 540  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFVQMLSMMSDGNLQFDIPPPAIMRP 599
            LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRAT  Q+LSMMSD NL+FDIPPPAI +P
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSDANLKFDIPPPAIFKP 600

Query: 600  HYLWTGKQLFSLLIKPNKKSPVIINLDAKNKVYIAPKNKAYPNEMSANDGYVVIRGSNIL 659
              LWTGKQ+FSLLIKPNK+SPV+INLDAKNKVYI P+NK++P+EMS NDGYV+IRGS IL
Sbjct: 601  QCLWTGKQIFSLLIKPNKESPVVINLDAKNKVYIPPQNKSWPSEMSPNDGYVIIRGSEIL 660

Query: 660  SGVMDKSVLGDGKKHSVFYTILRDFGPQEATQAMNRMAKLCARYLGNRGFSIGISDVTPG 719
            SGVMDKSVLGDGKKHSVFYTILRD+GPQE+  AMNRMAKLCARYLGNRGFSIGISDVTPG
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQESANAMNRMAKLCARYLGNRGFSIGISDVTPG 720

Query: 720  VELKATKEEMVEIAYAKCDELIDLYKRGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 779
             ELK  KE++VEIAY KCDELI  Y +G+LETQPGCNEEQTLEAKIGGLLSKVREEVGDV
Sbjct: 721  EELKLKKEDLVEIAYKKCDELIIQYNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 780  CIRELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 839
            CI ELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFEKNSK 840

Query: 840  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899
            TPQSKGFVRNSFF+GL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFTGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 900  DNTVRTSSNGIVQFTYGGDGLDPLNMEGNAKPVNFNRSWDHANNITYNHDDKGMLPYQIL 959
            DNT+RTSSNGIVQFTYGGDGLDPL+MEGNAKPVNF R+WDHA+NIT++ + KG+LPYQI+
Sbjct: 901  DNTIRTSSNGIVQFTYGGDGLDPLDMEGNAKPVNFKRTWDHASNITFDFNAKGLLPYQII 960

Query: 960  EETNAILHPLEQQLSRYDNVGNPLAPGLENEELYIDQHDAEREFYQSLRTYMSEKARKLA 1019
            ++TN IL PLE  L RY+NVG PL+    +++ Y+DQ DA+R+FY S+R YM EKA +LA
Sbjct: 961  KQTNLILQPLENALVRYNNVGKPLSKKDYHKDEYVDQLDAKRDFYASIREYMVEKAEQLA 1020

Query: 1020 DITKSRGLKELYHAPALELQLMDLDASCPEVDVKSVNQLCKISSKLVRTFLDIAISKYRK 1079
             I K+R LKEL   PA ELQ +D D + P    + V++LCKIS   V+ FL+IAISKY +
Sbjct: 1021 KIRKARSLKELISEPAEELQHIDFDENIPSNVREVVDKLCKISEANVKKFLEIAISKYHR 1080

Query: 1080 AKVEPGTAVGAIGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1139
            AKVEPGTAVGAIGA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASK ISTPI
Sbjct: 1081 AKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKTISTPI 1140

Query: 1140 INATLVNDDDERAARVVKGRVEKTLLSDVIFYIQDVYRDNMSFLQVKVDLATIEKLQLEL 1199
            I A LVND D RAARVVKGR+EKTLLSDV +YI+DVYRDN +F+++K+DL+TIEKLQLEL
Sbjct: 1141 IKAVLVNDSDRRAARVVKGRIEKTLLSDVAYYIEDVYRDNRTFIRIKIDLSTIEKLQLEL 1200

Query: 1200 TVEDIAIAITSAPKLKISTGDVSIVGRNKININVCNDLDKAKSISTLASEPHENDVFFKM 1259
            T+EDIAIAI+ APKLKI + ++ IVG +KI I+V    + +KSIST   E  EN VF+KM
Sbjct: 1201 TIEDIAIAISKAPKLKIDSSNIHIVGNDKIAIDVFE--EASKSISTSLKESSENTVFYKM 1258

Query: 1260 QHLRRALPGIVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVVGYKTKTNHFL 1319
            Q LRRALP +VVKGL DISRAVINI+DD K ELLVEGYGLRDVM TDGV+G KT TNH L
Sbjct: 1259 QTLRRALPDVVVKGLADISRAVINIKDDSKTELLVEGYGLRDVMCTDGVIGTKTSTNHIL 1318

Query: 1320 EVYDVLGIEAARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1379
            E+++VLGIEAAR+SI+ EIDYTMSNHGMSVDPRHIQLLGDVMT+KGEVLGITRFGLSKMR
Sbjct: 1319 EIFNVLGIEAARSSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGITRFGLSKMR 1378

Query: 1380 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMTIGTGSFKVVKGTNISPDD 1439
            DSVLQLASFEKTTDHLFDAAFYMKKD V+GVSECIILGQTM+IGTGSF VVK T +SP+ 
Sbjct: 1379 DSVLQLASFEKTTDHLFDAAFYMKKDEVKGVSECIILGQTMSIGTGSFNVVKHTVVSPEQ 1438

Query: 1440 LKPKPTLFENLCSLN 1454
            +KPK TLFE+L S N
Sbjct: 1439 VKPKRTLFESLVSSN 1453

>Kwal_55.21459 s55 (846902..850348) [3447 bp, 1148 aa] {ON} YOR116C
            (RPO31) - RNA polymerase III large subunit [contig 130]
            FULL
          Length = 1148

 Score = 2059 bits (5335), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 975/1144 (85%), Positives = 1047/1144 (91%)

Query: 1    MKEVVVDILPKRISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGV 60
            MKEVVVDI PKRI GLEFSALSASDIV QS+VEI TRDLFDLE+GR PK GGALD+RMGV
Sbjct: 1    MKEVVVDIAPKRIKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGV 60

Query: 61   SSSQAECSTCHGTLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNEEDK 120
            SSSQAECSTCHG LASCHGHFGHIKL+LPVFHVGYFKATIQ+LQSICK+CA LLL+EEDK
Sbjct: 61   SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSEEDK 120

Query: 121  RQFLSELRRPGIDNLRRMATLKKVLDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXLKIIH 180
            RQFLSELRRPGIDNLRRM  LKKV+DQCKKQRRCL CG LN              LKI+H
Sbjct: 121  RQFLSELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNGVVKKAAAGSGSASLKILH 180

Query: 181  DTFRWVGKKSAPEKDKWIGDWNQVLQHSPELERYMKRTMENLNPLKTLNLFKQISPQDCE 240
            DTFRWVGKKSAPEKDKW+GDW  VL H+PELERY+K+ M++LNPLKTLNLFKQ+SP+DCE
Sbjct: 181  DTFRWVGKKSAPEKDKWVGDWKTVLSHNPELERYVKKCMDDLNPLKTLNLFKQVSPEDCE 240

Query: 241  LLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            L+GIDSTVK+GRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LMGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQMAVAMYINSDSVNPALMPGGNGGGKTKPIRGFCQRLKGKQ 360
            AGLEKGISINNMMEQWDYLQ+AVAMYINSDSVNPA+MPGG+ GGKTKPIRGFCQRLKGKQ
Sbjct: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRLKGKQ 360

Query: 361  GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKHKLQQLIV 420
            GRFRGNLSGKRVDFSGRTV+SPDPNLSIDEVAVPDRVAKVLT+PE VTRYNK KLQQL++
Sbjct: 361  GRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKAKLQQLVI 420

Query: 421  NGANVHPGANYLLKKNEEARRNLRYGDRIKLAKNLQIGDVVERHLEDGDVVLFNRQPSLH 480
            NG N HPGANYLLKK+EEARRNLRYGDRIKLAKNLQ GD+VERHLEDGDVVLFNRQPSLH
Sbjct: 421  NGPNEHPGANYLLKKDEEARRNLRYGDRIKLAKNLQYGDLVERHLEDGDVVLFNRQPSLH 480

Query: 481  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 540
            RLSILSH+AKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL
Sbjct: 481  RLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 540

Query: 541  LTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFVQMLSMMSDGNLQFDIPPPAIMRPH 600
            LTPKSGEPIIAATQDFITGSYLISHKDSF+ RA FVQ+LSMMSDGN+QFDIPPPAIM+P+
Sbjct: 541  LTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMMSDGNMQFDIPPPAIMKPY 600

Query: 601  YLWTGKQLFSLLIKPNKKSPVIINLDAKNKVYIAPKNKAYPNEMSANDGYVVIRGSNILS 660
            Y+WTGKQ+FSLLI+PNKKS V+INLDAKNKVYI PK+K  PNEMS NDG+VVIRGS ILS
Sbjct: 601  YMWTGKQVFSLLIRPNKKSSVVINLDAKNKVYIPPKHKHLPNEMSINDGFVVIRGSQILS 660

Query: 661  GVMDKSVLGDGKKHSVFYTILRDFGPQEATQAMNRMAKLCARYLGNRGFSIGISDVTPGV 720
            GVMDKSVLGDGKKHSVFYTILRDFGP+EA  AMNRMAKLCARYLGNRGFSIGI+DVTPG 
Sbjct: 661  GVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMNRMAKLCARYLGNRGFSIGINDVTPGF 720

Query: 721  ELKATKEEMVEIAYAKCDELIDLYKRGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVC 780
            ELK  KE MVE AYAKCD+LID + +GKLETQPGCNEEQTLEAKIGGLLSKVREEVG+VC
Sbjct: 721  ELKNKKEVMVEDAYAKCDDLIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC 780

Query: 781  IRELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKT 840
            I+ELDNLN+ LIMA CGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSKT
Sbjct: 781  IKELDNLNSCLIMANCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKT 840

Query: 841  PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 900
            PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD
Sbjct: 841  PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 900

Query: 901  NTVRTSSNGIVQFTYGGDGLDPLNMEGNAKPVNFNRSWDHANNITYNHDDKGMLPYQILE 960
            NT+RTSSNGIVQFTYGGDGLDP++MEGNA+PVNF RSWDHANNIT+NH DK +LPYQI++
Sbjct: 901  NTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFTRSWDHANNITFNHSDKPLLPYQIMQ 960

Query: 961  ETNAILHPLEQQLSRYDNVGNPLAPGLENEELYIDQHDAEREFYQSLRTYMSEKARKLAD 1020
            +TN+IL PLE++L RYDN+G  L P L++   +IDQ DAER FY+SLR Y+  KA  LA 
Sbjct: 961  QTNSILQPLEEKLVRYDNLGRTLDPSLQDRAEFIDQDDAERNFYKSLREYLHTKASHLAK 1020

Query: 1021 ITKSRGLKELYHAPALELQLMDLDASCPEVDVKSVNQLCKISSKLVRTFLDIAISKYRKA 1080
            I   +GLK+    PA ELQ MDLD   P   + SV+QLCKISSKLV  FL+IAI KY KA
Sbjct: 1021 IRSHKGLKQFLDEPAPELQSMDLDEGSPSALLASVDQLCKISSKLVAKFLEIAIFKYHKA 1080

Query: 1081 KVEPGTAVGAIGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1140
            KVEPGTAVGA+GAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII
Sbjct: 1081 KVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1140

Query: 1141 NATL 1144
            NA L
Sbjct: 1141 NAVL 1144

>ZYRO0F05918g Chr6 (487056..492290) [5235 bp, 1744 aa] {ON} highly
            similar to uniprot|P04050 Saccharomyces cerevisiae
            YDL140C
          Length = 1744

 Score =  709 bits (1829), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 512/1496 (34%), Positives = 763/1496 (51%), Gaps = 139/1496 (9%)

Query: 11   KRISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGVSSSQAECSTC 70
            + +  ++F   S  +I A S  +I   +  D    RA K GG  D R+G      +C TC
Sbjct: 12   RTVKEVQFGLFSPEEICAISVAKIKFPETMDETQTRA-KIGGLNDPRLGSIDRSLKCQTC 70

Query: 71   HGTLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNEEDKRQFLSELRRP 130
               +  C GHFGHI+LA PVFH+G+     ++ + +C +C KLLL+E +      E  R 
Sbjct: 71   QEGMNECPGHFGHIELAKPVFHIGFISKIKKVCECVCMHCGKLLLDEHN------EQMRQ 124

Query: 131  GIDNLRRMATLKKVLDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXLK--IIHDTFRWVGK 188
             I           V   CK +  C      +               +  I  D  + VG 
Sbjct: 125  AIKIKDSKKRFNAVWSLCKAKMICDTDVPSDEDPTQLISRGGCGNAQPTIRRDGLKLVGS 184

Query: 189  KSAPEKDKWIGDWNQVLQHSPELERYMKRTMENLNPLKTLNLFKQISPQDCELLGIDSTV 248
                    W  D N      PE           LN  + LN+FK ISP+D   LG +   
Sbjct: 185  --------WKKDKNSGDNEEPE--------QRVLNMEEILNIFKHISPEDSWKLGFNE-- 226

Query: 249  KAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAGLEKGIS 308
            +  RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++     G  
Sbjct: 227  EFARPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETLEHNGAP 285

Query: 309  INNMMEQWDYLQMAVAMYINSDSVNP--ALMPGGNGGGKTKPIRGFCQRLKGKQGRFRGN 366
             + + E    LQ  VA Y+++D      AL   G      +P++    RLKGK+GR RGN
Sbjct: 286  HHTIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARLKGKEGRIRGN 339

Query: 367  LSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKHKLQQLIVNGANVH 426
            L GKRVDFS RTVIS DPNL +D+V VP  +AK LT+PE VT YN  +L  L+ NG N H
Sbjct: 340  LMGKRVDFSARTVISGDPNLDLDQVGVPKSIAKTLTYPEVVTPYNIDRLTMLVRNGPNEH 399

Query: 427  PGANYLLKKNEEARRNLRYGDRIKLAKNLQIGDVVERHLEDGDVVLFNRQPSLHRLSILS 486
            PGA Y+++ N + R +LRY  R    + LQ G  VERH+ D D VLFNRQPSLH++S+++
Sbjct: 400  PGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHVIDNDPVLFNRQPSLHKMSMMA 457

Query: 487  HYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPKSG 546
            H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++P+S 
Sbjct: 458  HKVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPQQIVSPQSN 517

Query: 547  EPIIAATQDFITGSYLISHKDSFFDRATFVQMLSMMSDGNLQFDIPPPAIMRPHYLWTGK 606
            +P +   QD + G   ++ +D+F +    + ML  + D +    IP PAI++P  LWTGK
Sbjct: 518  KPCMGVVQDTLCGIRKLTLRDNFIELGQVLNMLYWVPDWDGV--IPTPAILKPKPLWTGK 575

Query: 607  QLFSLLIKPNKKSPVIINLDA--KNKVYIAPKNKAYPNEMSANDGYVVIRGSNILSGVMD 664
            QL S+ I      P  I+L    +    ++PK+          +G +VI G  I+ GV+D
Sbjct: 576  QLLSVAI------PKGIHLQRFDEGTTLLSPKD----------NGMLVIDG-QIIFGVVD 618

Query: 665  KSVLGDGKKHSVFYTILRDFGPQEATQAMNRMAKLCARYLGNRGFSIGISD-VTPGVELK 723
            K  +G      + + + R+ GPQ      + + K+   +  + GFS GI D +  G  ++
Sbjct: 619  KKTVGSSSG-GLIHVVTREKGPQVCATLFSNIQKVVNYWFLHCGFSTGIGDTIADGQTMR 677

Query: 724  ATKEEMVEIAYAKCDELIDLYKRGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVCIRE 783
               E + E A  K +++    +   L  + G    ++ E  +   L++ R++ G +    
Sbjct: 678  QITEAIAE-AKVKVEDVTKEAQANLLTAKHGMTLRESFEDNVVRYLNEARDKAGRLAEVN 736

Query: 784  LDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQS 843
            L++ N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +P+S
Sbjct: 737  LNDTNFVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPES 796

Query: 844  KGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTV 903
            KGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YD T 
Sbjct: 797  KGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDGTT 856

Query: 904  RTSSNGIVQFTYGGDGLDPLNMEGNAKPV--NFNRSWDHANNITYNHDDKGMLPYQILEE 961
            R S   I+QF YG DG+D  ++E  A       +R+++    I   + D  + P  +LE 
Sbjct: 857  RNSLGNIIQFIYGEDGMDAAHIEKQAVETIGGSDRNFERRYRIDLLNPDYSLDP-SLLES 915

Query: 962  TNAILHPLEQQLSRYDNVGNPLAPGLEN-EELYIDQH-------DAEREFYQSLRTYMSE 1013
             + I+  L+ Q S  D     L    +    +++D         +  R    + +T+  +
Sbjct: 916  GSEIIGDLKLQ-SLLDEEYKQLVEDRKFLRRIFVDGEVNWPLPVNIRRIIQNAQQTFRID 974

Query: 1014 KARKLADITKSR---GLKELYHAPAL---------ELQLMDLDASC----PEVDVKSVNQ 1057
            ++ K +D+T      G+KEL     +         E Q   +   C      +  + V Q
Sbjct: 975  RS-KPSDVTIRDVVWGVKELQERLLVVRGNSRIIKEAQEDAITLFCCLMRSRLASRRVIQ 1033

Query: 1058 LCKISSKLVRTFLDIAISKYRKAKVEPGTAVGAIGAHSIGEPGTQMTLKTFHFAGVASMN 1117
              +++ +     L+    ++ ++ V PG  VG + A SIGEP TQMTL TFHFAGVAS  
Sbjct: 1034 EYRLTKQAFEWVLNNIEVQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKK 1093

Query: 1118 VTLGVPRIKEIINASKVISTPIINATLVND--DDERAARVVKGRVEKTLLSDVIFYIQDV 1175
            VT GVPR+KEI+N +K + TP + A L  D   D+  A++++  +E T L  V    +  
Sbjct: 1094 VTSGVPRLKEILNVAKNMKTPSLTAYLEPDYAADQEKAKLIRSVIEHTTLKSVTVASEIY 1153

Query: 1176 YRDNMSFLQVKVDLATIEKLQLELTVED----IAIAITSAPKLKISTGDVSIVGRN---- 1227
            Y  +     +  D    E +QL  ++ D     ++A  S   L++     ++  ++    
Sbjct: 1154 YDPDPRSTAIPEDE---EIIQLHFSLLDDETEKSLAQQSPWLLRLELDRAAMNDKDLTMG 1210

Query: 1228 ----KININVCNDL------DKAKSI-----------STLASEPHENDVFFKMQHLRRAL 1266
                KI     NDL      D A+ +             L +E  E+ +  K+++    L
Sbjct: 1211 QVGEKIKETFKNDLFVIWSEDNAEQLIIRCRVVRPKSMDLETEAEEDHMLKKIENT--ML 1268

Query: 1267 PGIVVKGLPDISRAVINIRD------DGKRE------LLVEGYGLRDVMTTDGVVGYKTK 1314
              I ++G+ +I R V+   D       G+ +      L  +G  L +VMT  GV   +  
Sbjct: 1269 ENITLRGVENIERVVMMKYDRKVPSETGEYQKIPEWVLETDGVNLSEVMTVPGVDASRIY 1328

Query: 1315 TNHFLEVYDVLGIEAARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFG 1374
            TN F+++ +VLGIEA R ++  E+   +++ G  V+ RH+ LL DVMT +G +  +TR G
Sbjct: 1329 TNSFIDIMEVLGIEAGRAALYKEVFNVIASDGSYVNYRHMALLVDVMTTQGGLTSVTRHG 1388

Query: 1375 LSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMTIGTGSFKVV 1430
             ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTG+F V+
Sbjct: 1389 FNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGAFDVM 1444

>SAKL0F10472g Chr6 (808869..814061) [5193 bp, 1730 aa] {ON} highly
            similar to uniprot|P04050 Saccharomyces cerevisiae
            YDL140C
          Length = 1730

 Score =  702 bits (1813), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 502/1494 (33%), Positives = 764/1494 (51%), Gaps = 134/1494 (8%)

Query: 11   KRISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGVSSSQAECSTC 70
            + I  ++F   S  ++ A S  +I   +  D    RA K GG  D R+G      +C TC
Sbjct: 12   RTIKEVQFGLFSPEEVRAISVAKIEFPETMDETQMRA-KVGGLNDPRLGSIDRNYKCQTC 70

Query: 71   HGTLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNEEDKRQFLSELRRP 130
               +  C GHFGHI+LA PVFH+G+     ++ + +C +C KLLL+E +++   +   + 
Sbjct: 71   GEGMNDCPGHFGHIELAKPVFHIGFLSRIKKVCECVCMHCGKLLLDEHNEQMKQAIKIKD 130

Query: 131  GIDNLRRMATLKKVLDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXLKIIHDTFRWVGKKS 190
                   + TL KV   C+ +         +                I  D    VG   
Sbjct: 131  PKRRFNAVWTLSKVKMICETEVPSED----DPTKYISRGGCGNTQPSIRKDGLSLVGT-- 184

Query: 191  APEKDKWIGDWNQVLQHSPELERYMKRTMENLNPLKTLNLFKQISPQDCELLGIDSTVKA 250
                  W  D N      PE     KR    ++  + LN+FK I P+D   LG +     
Sbjct: 185  ------WKKDKNADDADQPE-----KRI---ISAEEVLNVFKHICPEDSWRLGFNEDF-- 228

Query: 251  GRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAGLEKGISIN 310
             RPE  +   LP PP  +RPS+   ++    EDDLT KL +I+  +  ++     G   +
Sbjct: 229  ARPEWMLLTVLPVPPPPVRPSISFNET-QRGEDDLTYKLGDILKANINVQRLEINGSPQH 287

Query: 311  NMMEQWDYLQMAVAMYINSDSVNP--ALMPGGNGGGKTKPIRGFCQRLKGKQGRFRGNLS 368
             + E    LQ  VA Y+++D      AL   G      +PI+    RLKGK+GR RGNL 
Sbjct: 288  VIQESEALLQFHVATYMDNDIAGQPQALQKSG------RPIKSIRARLKGKEGRIRGNLM 341

Query: 369  GKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKHKLQQLIVNGANVHPG 428
            GKRVDFS RTVIS DPNL +D+V VP  +AK LT+PE VT YN  +L QL+ NG N HPG
Sbjct: 342  GKRVDFSARTVISGDPNLDLDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHPG 401

Query: 429  ANYLLKKNEEARRNLRYGDRIKLAKNLQIGDVVERHLEDGDVVLFNRQPSLHRLSILSHY 488
            A Y+++ N + R +LRY  R    + LQ G  VERH+ D D VLFNRQPSLH++S+++H 
Sbjct: 402  AKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIIDNDPVLFNRQPSLHKMSMMAHR 459

Query: 489  AKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPKSGEP 548
             K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++P+S +P
Sbjct: 460  VKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKP 519

Query: 549  IIAATQDFITGSYLISHKDSFFDRATFVQMLSMMSDGNLQFDIPPPAIMRPHYLWTGKQL 608
             +   QD + G   ++ +D+F +    + ML  + D +    IP P I++P  LW+GKQ+
Sbjct: 520  CMGIVQDTLCGVRKMTLRDTFIELDQVLNMLYWVPDWDGV--IPTPTILKPKPLWSGKQI 577

Query: 609  FSLLIKPNKKSPVIINLDA--KNKVYIAPKNKAYPNEMSANDGYVVIRGSNILSGVMDKS 666
             S+ I      P  I+L    +    ++PK+          +G +++ G  I+ GV+DK 
Sbjct: 578  LSMAI------PKGIHLQRFDEGTTLLSPKD----------NGMLIVDG-QIIFGVVDKK 620

Query: 667  VLGDGKKHSVFYTILRDFGPQEATQAMNRMAKLCARYLGNRGFSIGISDVTPGVELKATK 726
             +G      + + + R+ GPQ   +  + + K+   +L + GFSIGI D     +     
Sbjct: 621  TVG-SSNGGLIHIVTREKGPQICARLFSNIQKVVNYWLLHNGFSIGIGDTIADQKTMREI 679

Query: 727  EEMVEIAYAKCDELIDLYKRGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVCIRELDN 786
             E + +A  K + +    +   L  + G    ++ E  +   L++ R++ G      L +
Sbjct: 680  TEAIAVAKKKVENVTKEAQANLLTAKHGMTLRESFEDNVVRYLNEARDKAGRSAEVNLKD 739

Query: 787  LNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGF 846
            LN    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +P+SKGF
Sbjct: 740  LNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFADRTLPHFSKDDYSPESKGF 799

Query: 847  VRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTS 906
            V NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YD T R S
Sbjct: 800  VENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDGTTRNS 859

Query: 907  SNGIVQFTYGGDGLDPLNMEGNA--KPVNFNRSWDHANNITYNHDDKGMLPYQILEETNA 964
               I+QF YG DG+D  ++E  +       +R+++    I   + D  + P  +LE  + 
Sbjct: 860  LGNIIQFIYGEDGMDAAHIEKQSIDTIAGSDRAFERRYRIDLLNPDNALDP-SLLESGSE 918

Query: 965  ILHPLEQQLSRYDNVGNPLAPGLENEELYIDQHDAE------REFYQSLRTYMSEKARKL 1018
            ++  L+ Q S  +     +       ++++D           R   Q+ +        K 
Sbjct: 919  MMGDLKLQASLDEEYRQLVEDRRFLRKIFVDGEQNWPLPVNIRRIIQNAQQTFRIDHTKP 978

Query: 1019 ADITKSRGLKELYHAPALELQLMDLDASCP---EVDVKSVNQLC---------------- 1059
             D+T       +Y    L+ +L+ L        E    +V   C                
Sbjct: 979  TDLTIH---DVIYGVKDLQEKLLVLRGKSEMLQEAQTNAVTLFCCLLRSRLASRRVIEEY 1035

Query: 1060 KISSKLVRTFLDIAISKYRKAKVEPGTAVGAIGAHSIGEPGTQMTLKTFHFAGVASMNVT 1119
            K++ +  +  L+   +++ ++ V PG  VG + A SIGEP TQMTL TFHFAGVAS  VT
Sbjct: 1036 KLTKQTFQWVLNNVEAQFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVT 1095

Query: 1120 LGVPRIKEIINASKVISTPIINATLVNDD--DERAARVVKGRVEKTLLSDV-----IFYI 1172
             GVPR+KEI+N +K + TP +   L +++  D+  A++++  +E T L  V     I+Y 
Sbjct: 1096 SGVPRLKEILNVAKNMKTPSLTVYLESEESADQEKAKLIRSAIEHTTLKSVTVASEIYYD 1155

Query: 1173 QD----VYRDNMSFLQVKVDLATIEKLQLELTVEDIAIAITSAPKLKISTGDVSI--VGR 1226
             D    V  D+   +Q+   L   E+ +  L  +   +      +  ++  D+++  VG 
Sbjct: 1156 PDPRSTVIEDDEEIIQLHFSLMD-EETEQSLDHQSPWLLRLELDRAAMNDKDLTMGQVGE 1214

Query: 1227 NKININVCNDL------DKAKSI----------STL--ASEPHENDVFFKMQHLRRALPG 1268
             KI     NDL      D A+ +           TL   +E  E+ +  K+++    L  
Sbjct: 1215 -KIKETFKNDLFVIWSEDNAEKLIIRCRVVRDPKTLDAEAEAEEDHMLKKIENT--MLES 1271

Query: 1269 IVVKGLPDISRAVINIRD------DGKRE------LLVEGYGLRDVMTTDGVVGYKTKTN 1316
            I ++G+ DI+R V+   D       G+ +      L  +G  L +VM+  GV   +  TN
Sbjct: 1272 ITLRGVEDITRVVMMKYDRKTPSATGEYQKVPEWVLETDGVNLAEVMSVPGVDSTRIYTN 1331

Query: 1317 HFLEVYDVLGIEAARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLS 1376
             F+++ +VLGIEA R ++  E+   +++ G  V+ RH+ LL DVMT +G ++ +TR G +
Sbjct: 1332 SFIDIMNVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTSQGFLMSVTRHGFN 1391

Query: 1377 KMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMTIGTGSFKVV 1430
            +     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTG+F V+
Sbjct: 1392 RSDTGALMRCSFEETVEILFEAGAAAELDNCRGVSENVILGQMAPIGTGAFDVM 1445

>Kwal_56.24489 s56 (1018237..1023423) [5187 bp, 1728 aa] {ON} YDL140C
            (RPO21) - RNA polymerase II large subunit [contig 161]
            FULL
          Length = 1728

 Score =  697 bits (1799), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 510/1518 (33%), Positives = 768/1518 (50%), Gaps = 182/1518 (11%)

Query: 11   KRISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGVSSSQAECSTC 70
            + +  ++F   S  ++ A S  +I   +  D    RA K GG  D R+G      +C TC
Sbjct: 12   RTVKEVQFGMFSPEEVRAISVAKIEFPETMDETQMRA-KVGGLNDPRLGSIDRNFKCQTC 70

Query: 71   HGTLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNEEDKRQFLSELRRP 130
               +  C GHFGHI+LA PVFH+GY     ++ + +C +C KLLL+E       SEL + 
Sbjct: 71   GEGMNDCPGHFGHIELAKPVFHIGYISKIKKVCECVCMHCGKLLLDEH------SELMKQ 124

Query: 131  GI---DNLRRMATLKKVLDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXLKIIHDTFRWVG 187
             I   D  RR      V   CK +  C                     +   +D  ++V 
Sbjct: 125  AIKIKDPKRR---FNAVWSLCKVKMVC------------------ETEVPSDNDPSQYVS 163

Query: 188  K------KSAPEKD--KWIGDW--NQVLQHSPELERYMKRTMENLNPLKTLNLFKQISPQ 237
            +      + +  KD    +G W  ++    + + ER +      ++  + LN+FK ISP+
Sbjct: 164  RGGCGNTQPSVRKDGLSLVGTWKKDKGADDADQPERRI------ISADEVLNVFKHISPE 217

Query: 238  DCELLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSS 297
            D   LG +      RPE  I   LP PP  +RPS+   ++    EDDLT KL +I+  + 
Sbjct: 218  DSVRLGFNEDF--ARPEWMILTVLPVPPPPVRPSISFNET-QRGEDDLTYKLGDILKANI 274

Query: 298  LIKAGLEKGISINNMMEQWDYLQMAVAMYINSDSVNP--ALMPGGNGGGKTKPIRGFCQR 355
             ++     G   + + E    LQ  VA Y+++D      AL   G      +PI+    R
Sbjct: 275  NVQRLEINGSPQHVIQESEALLQFHVATYMDNDIAGQPQALQKSG------RPIKSIRAR 328

Query: 356  LKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKHKL 415
            LKGK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +A+ LT+PE VT YN  +L
Sbjct: 329  LKGKEGRIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIARTLTYPEVVTPYNIDRL 388

Query: 416  QQLIVNGANVHPGANYLLKKNEEARRNLRYGDRIKLAKNLQIGDVVERHLEDGDVVLFNR 475
             QL+ NG N HPGA Y+++ N + R +LRY  R    + LQ G  VERH+ D D VLFNR
Sbjct: 389  TQLVRNGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIIDEDPVLFNR 446

Query: 476  QPSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMG 535
            QPSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  
Sbjct: 447  QPSLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCA 506

Query: 536  VKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFVQMLSMMSDGNLQFDIPPPA 595
            V   +++ +S +P +   QD + G   ++ +D+F +    + ML  + D +    IP P 
Sbjct: 507  VPQQIVSAQSNKPCMGIVQDTLCGVRKMTLRDTFIELEQVLNMLYWIPDWDGV--IPTPI 564

Query: 596  IMRPHYLWTGKQLFSLLIKPNKKSPVIINLDA--KNKVYIAPKNKAYPNEMSANDGYVVI 653
            I++P  LW+GKQ+ S+ I      P  I+L    +    ++PK+          +G ++I
Sbjct: 565  ILKPKPLWSGKQILSIAI------PTGIHLQRFDEGTTLLSPKD----------NGMLII 608

Query: 654  RGSNILSGVMDKSVLGDGKKHSVFYTILRDFGPQEATQAMNRMAKLCARYLGNRGFSIGI 713
             G  I+ GV+DK  +G      + + + R+ GP+   +  + + K+   +L + GFSIGI
Sbjct: 609  DG-QIIFGVVDKKTVG-SSSGGLIHVVTREKGPKICARLFSNLQKVVNYWLLHNGFSIGI 666

Query: 714  SDVTPGVELKATKEEMVEIAYAKCDELIDLYKRGKLETQPGCNEEQTLEAKIGGLLSKVR 773
             D     +      + + +A  K +E+    +   L  + G    ++ E  +   L++ R
Sbjct: 667  GDTIADEKSMREITDAIVVAKRKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRYLNEAR 726

Query: 774  EEVGDVCIRELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPH 833
            ++ G      L +LN    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPH
Sbjct: 727  DKAGRSAEVNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFADRTLPH 786

Query: 834  FPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLE 893
            F K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LE
Sbjct: 787  FSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALE 846

Query: 894  DLSCQYDNTVRTSSNGIVQFTYGGDGLDPLNMEGNAKPVNFNRSWDHANNITYNHD---D 950
            D+   YD T R S   ++QF YG DG+D  ++E  A  ++     D A    +  D    
Sbjct: 847  DIMVHYDGTTRNSLGNVIQFIYGEDGMDAAHIEKQA--IDTIACSDAAFERRFKIDLLNP 904

Query: 951  KGMLPYQILEETNAILHPLEQQLSRYDNVGNPLAPGLENEELYIDQHDAEREFYQSL--- 1007
            K  L   +LE  + I+  L+ Q              L +EE    Q   +R+F + +   
Sbjct: 905  KHALDPSLLESGSEIIGDLKLQ-------------ALLDEEF--KQLSEDRQFLRKIFVD 949

Query: 1008 ------------RTYMSEKARKLADITKSRGLK---ELYHAPALELQLMDLDASCP---E 1049
                        R   + +     D TK   L     +Y    L+ +L+ L        E
Sbjct: 950  GEQNWPLPVNIRRIIQNAQQTFRIDHTKPTDLSIRDVIYGVKELQEKLLVLRGKSKILQE 1009

Query: 1050 VDVKSVNQLC-----KISSKLV--------RTF---LDIAISKYRKAKVEPGTAVGAIGA 1093
              V +V   C     +++S+ V        +TF   L    +++ ++ V PG  VG + A
Sbjct: 1010 AQVNAVTLFCCLLRSRLASRRVIQEYRLNKQTFEWVLSNVEAQFLRSLVHPGEMVGVLAA 1069

Query: 1094 HSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIINATLVNDD--DER 1151
             SIGEP TQMTL TFHFAGVAS  VT GVPR+KEI+N +K + TP +   L  +   D+ 
Sbjct: 1070 QSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLDEEHAADQE 1129

Query: 1152 AARVVKGRVEKTLLSDV-----IFYIQD----VYRDNMSFLQVKVDLATIEKLQLELTVE 1202
             A++++  +E T L  +     I+Y  D    V  D+   +Q+   L   E+ +  L  +
Sbjct: 1130 KAKLIRSAIEHTTLKSITVASEIYYDPDPRSTVIEDDEEIIQLHFSLMD-EETEQSLDYQ 1188

Query: 1203 DIAIAITSAPKLKISTGDVSI--VGRNKININVCNDL------DKAKSI----------S 1244
               +      +  ++  D+++  VG  KI     NDL      D A+ +           
Sbjct: 1189 SPWLLRLELDRAAMNDKDLTMGQVGE-KIKETFKNDLFVIWSEDNAEKLVIRCRVVRDPK 1247

Query: 1245 TLASEPHENDVFFKMQHLRRALPGIVVKGLPDISRAVINIRDDG------------KREL 1292
            TL +E    +     +     L  I ++G+ DI+R V+   D              +  L
Sbjct: 1248 TLDAEAEAEEDHMLKRIENTMLESITLRGVEDITRVVMMKYDRKVPSPAGDYHKIPEWVL 1307

Query: 1293 LVEGYGLRDVMTTDGVVGYKTKTNHFLEVYDVLGIEAARTSIIDEIDYTMSNHGMSVDPR 1352
              +G  L +VM   GV   +  TN F+++ +VLGIEA R ++  E+   +++ G  V+ R
Sbjct: 1308 ETDGVNLAEVMCVPGVDPARIYTNSFIDIMNVLGIEAGRAALYKEVYNVIASDGSYVNYR 1367

Query: 1353 HIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSE 1412
            H+ LL DVMT +G ++ +TR G ++     L   SFE+T + LF+A    + D   GVSE
Sbjct: 1368 HMALLVDVMTSQGFLMSVTRHGFNRSDTGALMRCSFEETVEILFEAGAAAELDDCRGVSE 1427

Query: 1413 CIILGQTMTIGTGSFKVV 1430
             ++LGQ   IGTG+F V+
Sbjct: 1428 NVLLGQVAPIGTGAFDVM 1445

>KLTH0H02046g Chr8 complement(182788..188010) [5223 bp, 1740 aa] {ON}
            highly similar to uniprot|P04050 Saccharomyces cerevisiae
            YDL140C
          Length = 1740

 Score =  696 bits (1797), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 507/1502 (33%), Positives = 766/1502 (50%), Gaps = 150/1502 (9%)

Query: 11   KRISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGVSSSQAECSTC 70
            + +  ++F   S  ++ A S  +I   +  D    RA K GG  D R+G      +C TC
Sbjct: 12   RTVKEVQFGIFSPEEVRAISVAKIEFPETMDETQMRA-KVGGLNDPRLGSIDRNYKCQTC 70

Query: 71   HGTLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNEEDKRQFLSELRRP 130
               +  C GHFGHI+LA PVFH+GY     ++ + +C +C KLLL+E       SEL R 
Sbjct: 71   GEGMNDCPGHFGHIELAKPVFHIGYISKIKKVCECVCMHCGKLLLDEH------SELMRQ 124

Query: 131  GI---DNLRRMATLKKVLDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXLKIIHDTFRWVG 187
             I   D  RR      V   CK +  C                     +   +D  ++V 
Sbjct: 125  AIKIKDPKRR---FNAVWSLCKAKMVC------------------ETEVPSDNDPAQYVS 163

Query: 188  K------KSAPEKD--KWIGDWNQVLQHSPELERYMKRTMENLNPLKTLNLFKQISPQDC 239
            +      + +  KD    +G W +  + + + ++  +R    ++  + LN+FK ISP+D 
Sbjct: 164  RGGCGNTQPSVRKDGLSLVGTWKKD-KGADDADQPERRV---ISADEVLNVFKHISPEDS 219

Query: 240  ELLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLI 299
              LG +      RPE  I   LP PP  +RPS+   ++    EDDLT KL +I+  +  +
Sbjct: 220  VRLGFNEDF--ARPEWMILTVLPVPPPPVRPSISFNET-QRGEDDLTYKLGDILKANINV 276

Query: 300  KAGLEKGISINNMMEQWDYLQMAVAMYINSDSVNP--ALMPGGNGGGKTKPIRGFCQRLK 357
            +     G   + + E    LQ  VA Y+++D      AL   G      +PI+    RLK
Sbjct: 277  QRLEINGSPQHVIQESEALLQFHVATYMDNDIAGQPQALQKSG------RPIKSIRARLK 330

Query: 358  GKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKHKLQQ 417
            GK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +A+ LT+PE VT YN  +L Q
Sbjct: 331  GKEGRIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIARTLTYPEVVTPYNIDRLTQ 390

Query: 418  LIVNGANVHPGANYLLKKNEEARRNLRYGDRIKLAKNLQIGDVVERHLEDGDVVLFNRQP 477
            L+ NG N HPGA Y+++ N + R +LRY  R    + LQ G  VERH+ D D VLFNRQP
Sbjct: 391  LVRNGPNEHPGAKYIIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIIDEDPVLFNRQP 448

Query: 478  SLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVK 537
            SLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V 
Sbjct: 449  SLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVP 508

Query: 538  NNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFVQMLSMMSDGNLQFDIPPPAIM 597
              +++ +S +P +   QD + G   ++ +D+F +    + ML  + D +    IP P I+
Sbjct: 509  QQIVSAQSNKPCMGIVQDTLCGVRKMTLRDTFIELDQVLNMLYWIPDWDGV--IPTPIIL 566

Query: 598  RPHYLWTGKQLFSLLIKPNKKSPVIINLDA--KNKVYIAPKNKAYPNEMSANDGYVVIRG 655
            +P  LW+GKQ+ S+ I      P  I+L    +    ++PK+          +G ++I G
Sbjct: 567  KPKPLWSGKQILSIAI------PSGIHLQRFDEGTTLLSPKD----------NGMLIIDG 610

Query: 656  SNILSGVMDKSVLGDGKKHSVFYTILRDFGPQEATQAMNRMAKLCARYLGNRGFSIGISD 715
              I+ GV+DK  +G      + + + R+ GP+   +  + + K+   +L + GFSIGI D
Sbjct: 611  -QIIFGVVDKKTVGSSSG-GLIHVVTREKGPKICARLFSNLQKVVNFWLLHNGFSIGIGD 668

Query: 716  VTPGVELKATKEEMVEIAYAKCDELIDLYKRGKLETQPGCNEEQTLEAKIGGLLSKVREE 775
                 +      E + +A  K +E+    +   L  + G    ++ E  +   L++ R++
Sbjct: 669  TIADEKSMREITEAIIVAKRKVEEVTKEAQANLLTAKHGMTLRESFEDSVVRYLNEARDK 728

Query: 776  VGDVCIRELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFP 835
             G      L +LN    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF 
Sbjct: 729  AGRSAEVNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFADRTLPHFS 788

Query: 836  KNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDL 895
            K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+
Sbjct: 789  KDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDI 848

Query: 896  SCQYDNTVRTSSNGIVQFTYGGDGLDPLNMEGNAKPVNFNRSWDHANNITYNHD---DKG 952
               YD T R S   ++QF YG DG+D  ++E   + ++   S D A    +  D    + 
Sbjct: 849  MVHYDGTTRNSLGNVIQFIYGEDGMDAAHIE--KQTIDTIASSDAAFERRFRIDLLNPRH 906

Query: 953  MLPYQILEETNAILHPLEQQLSRYDNVGNPLAPGLEN-EELYIDQHDAE------REFYQ 1005
             L   +LE  + I+  L+ Q +  D     L    E   ++++D           R   Q
Sbjct: 907  ALDPSLLESGSEIIGDLKLQ-ALLDEEFKQLVEDREFLRKIFVDGEQNWPLPVNIRRIIQ 965

Query: 1006 SLRTYMSEKARKLADITKS---RGLKELYHAPAL---------ELQLMDLDASC----PE 1049
            + +        K  D+T      G+KEL     +         E Q   +   C      
Sbjct: 966  NAQQTFRIDQTKPTDLTIRDVVYGVKELQEKLLVLRGKSKILQEAQQNAVTLFCCLLRSR 1025

Query: 1050 VDVKSVNQLCKISSKLVRTFLDIAISKYRKAKVEPGTAVGAIGAHSIGEPGTQMTLKTFH 1109
            +  + V Q  +++ +     L    S++ ++ V PG  VG + A SIGEP TQMTL TFH
Sbjct: 1026 LATRRVIQEYRLNKQTFEWVLSNVESQFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFH 1085

Query: 1110 FAGVASMNVTLGVPRIKEIINASKVISTPIINATLVNDD--DERAARVVKGRVEKTLLSD 1167
            FAGVAS  VT GVPR+KEI+N +K + TP +   L  D   D+  A++++  +E T L  
Sbjct: 1086 FAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLDKDHAADQEKAKLIRSAIEHTTLKS 1145

Query: 1168 V-----IFYIQD----VYRDNMSFLQVKVDLATIEKLQLELTVEDIAIAITSAPKLKIST 1218
            +     I+Y  D    V  ++   +Q+   L   E+ +  L  +   +      +  ++ 
Sbjct: 1146 ITVASEIYYDPDPRSTVIEEDEEIIQLHFSLMD-EETEQSLDYQSPWLLRLELDRAAMND 1204

Query: 1219 GDVSI--VGRNKININVCNDL------DKAKSI----------STLASEPHENDVFFKMQ 1260
             D+++  VG  KI     NDL      D A+ +           TL +E    +     +
Sbjct: 1205 KDLTMGQVG-EKIKETFKNDLFVIWSEDNAEKLIIRCRVVRDPKTLDAEAEAEEDHMLKR 1263

Query: 1261 HLRRALPGIVVKGLPDISRAVINIRD------DGKRE------LLVEGYGLRDVMTTDGV 1308
                 L  I ++G+ DI+R V+   D       G+        L  +G  L +VM   GV
Sbjct: 1264 IENTMLESITLRGVEDITRVVMMKYDRKVPSPTGEYHKVPEWVLETDGVNLAEVMCVPGV 1323

Query: 1309 VGYKTKTNHFLEVYDVLGIEAARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVL 1368
               +  TN F+++ +VLGIEA R ++  E+   +++ G  V+ RH+ LL DVMT +G ++
Sbjct: 1324 DPARIYTNSFIDIMNVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTSQGFLM 1383

Query: 1369 GITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMTIGTGSFK 1428
             +TR G ++     L   SFE+T + LF+A    + D   GVSE ++LGQ   IGTG+F 
Sbjct: 1384 SVTRHGFNRSDTGALMRCSFEETVEILFEAGAAAELDDCRGVSENVLLGQVAPIGTGAFD 1443

Query: 1429 VV 1430
            V+
Sbjct: 1444 VM 1445

>Ecym_8065 Chr8 (139544..144775) [5232 bp, 1743 aa] {ON} similar to
            Ashbya gossypii ADR086C
          Length = 1743

 Score =  657 bits (1694), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/1505 (32%), Positives = 756/1505 (50%), Gaps = 156/1505 (10%)

Query: 11   KRISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGVSSSQAECSTC 70
            + I  ++F   S  ++ A S  +I   +  D    RA K GG  D R+G      +C TC
Sbjct: 12   RTIKEVQFGLFSPEEVRAISVAKIEFPETMDETQMRA-KVGGLNDPRLGSIDRNYKCQTC 70

Query: 71   HGTLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNEEDKRQFLSELRRP 130
               +  C GHFGHI+LA PVFH+G+     ++ + +C +C KLLL+E       +EL R 
Sbjct: 71   GEGMNDCPGHFGHIELAKPVFHIGFISKIKKVCECVCMHCGKLLLDE------YNELMRQ 124

Query: 131  GI---DNLRRMATLKKVLDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXLKIIHDTFRWVG 187
             I   D  RR      V   CK +  C                     +    D  +++ 
Sbjct: 125  AIKIKDPKRR---FNAVWSLCKSKMVC------------------DTEVPSEDDPSKYIS 163

Query: 188  K------KSAPEKD--KWIGDWNQVLQHSPELERYMKRTMENLNPLKTLNLFKQISPQDC 239
            +      + +  KD    +G W +  ++S + ++  KR    L+  + LN+FK I+P+D 
Sbjct: 164  RGGCGNAQPSIRKDGLSLVGTWKKD-KNSEDSDQPEKRI---LSAEEILNVFKHITPEDS 219

Query: 240  ELLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLI 299
              LG +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  +
Sbjct: 220  LRLGFNEDF--ARPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTYKLGDILKANINV 276

Query: 300  KAGLEKGISINNMMEQWDYLQMAVAMYINSDSVNPALMPGGNGGGKTKPIRGFCQRLKGK 359
            +     G   + + E    LQ  VA Y+++D          +G    +PI+    RLKGK
Sbjct: 277  QRLEINGSPQHVIQESESLLQFHVATYMDNDIAGQPQAVQKSG----RPIKSIRARLKGK 332

Query: 360  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKHKLQQLI 419
            +GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LT+PE VT YN  +L QL+
Sbjct: 333  EGRIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLV 392

Query: 420  VNGANVHPGANYLLKKNEEARRNLRYGDRIKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 479
             NG N HPGA Y+++ N + R +LRY  R    + LQ G  VERH+ D D VLFNRQPSL
Sbjct: 393  RNGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIIDNDPVLFNRQPSL 450

Query: 480  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 539
            H++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   
Sbjct: 451  HKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPQQ 510

Query: 540  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFVQMLSMMSDGNLQFDIPPPAIMRP 599
            +++P+S +P +   QD + G   ++ +D+F +    + ML  + D +    IP P I++P
Sbjct: 511  IVSPQSNKPCMGIVQDTLCGIRKMTLRDTFIELDQVLNMLYWIPDWDGV--IPKPTILKP 568

Query: 600  HYLWTGKQLFSLLIKPNKKSPVIINLDAKNKVYIAPKNKAYPNEMSANDGYVVIRGSNIL 659
              LW+GKQL S+ I PN    + +    +   Y++PK+          +G ++I G  I+
Sbjct: 569  KPLWSGKQLLSMAI-PNG---IHLQRFDEGTTYLSPKD----------NGMLIIDG-QII 613

Query: 660  SGVMDKSVLGDGKKHSVFYTILRDFGPQEATQAMNRMAKLCARYLGNRGFSIGISDVTPG 719
             GV+DK  +G      + + + R+ GPQ   +    + K+   +L + GFSIGI D    
Sbjct: 614  FGVVDKKTVG-SSSGGLIHVVTREKGPQVCAKLFGNIQKVVNYWLLHNGFSIGIGDTIAD 672

Query: 720  VELKATKEEMVEIAYAKCDELIDLYKRGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 779
             +      E + +A  +  E+    +   L  + G    ++ E  +   L++ R++ G  
Sbjct: 673  EKTMREITEAIALAKKRVQEVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRS 732

Query: 780  CIRELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 839
                L +LN    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  
Sbjct: 733  AELNLRDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFADRTLPHFSKDDY 792

Query: 840  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899
            +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   Y
Sbjct: 793  SPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHY 852

Query: 900  DNTVRTSSNGIVQFTYGGDGLDPLNMEGNAKPV--NFNRSWDHANNITYNHDDKGMLPYQ 957
            D T R S   I+QF YG DG+D  ++E  +       + +++    I   + + G+ P  
Sbjct: 853  DGTTRNSLGNIIQFVYGEDGMDASHIEKQSIDTIPGSDLAFEKRYRIDLLNPEYGLDP-S 911

Query: 958  ILEETNAILHPLEQQLSRYDNVGNPLAPGLENEELYID-QHDAE-----REFYQSLRTYM 1011
            +LE    I+  L+ Q    +     +        +++D +H+       R   Q+ +   
Sbjct: 912  LLESATEIMGDLKLQNMLDEEYKQLVQDRQLLRSVFLDGEHNWPLPVNIRRIIQNAQQTF 971

Query: 1012 SEKARKLADITKSRGLKE-LYHAPALELQLMDLDASC---PEVDVKSVNQLCKISSKLVR 1067
                 K  D+T    +K+ +     L+  L+ L  S     E    +V   C     LVR
Sbjct: 972  RIDTTKPTDLT----IKDVVLGVRKLQDNLLVLRGSSNILKEAQENAVTLFC----SLVR 1023

Query: 1068 TFLDI--AISKYRKAKVEPGTAVGAIGAH---SIGEPGTQMTLKTFHFAGVASMNVTL-- 1120
            + L     +++YR  K      +  I A    SI  PG  + +      G  +  +TL  
Sbjct: 1024 SRLATRRVLTEYRLTKQTFQWVLNNIEAQFLRSIVHPGEMVGVLAAQSIGEPATQMTLNT 1083

Query: 1121 -------------GVPRIKEIINASKVISTPIINATLVND--DDERAARVVKGRVEKTLL 1165
                         GVPR+KEI+N +K + TP +   L  D   D+  A++++  +E T L
Sbjct: 1084 FHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLNEDYAADQEKAKLIRSAIEHTTL 1143

Query: 1166 SDV-----IFYIQD----VYRDNMSFLQVKVDLATIEK-----------LQLEL-----T 1200
              V     I+Y  D    V  ++   +Q+   L   E            L+LEL      
Sbjct: 1144 KSVTVSSEIYYDPDPSSTVIEEDEEIIQLHFSLMDEETENSLKHQSPWLLRLELDRAAMN 1203

Query: 1201 VEDIAIAITSAPKLKISTGDVSIVGR--NKININV-CNDLDKAKSISTLASEPHENDVFF 1257
             +D+ +        +    D+ ++    N  N+ + C  +   K++   A E  E+ +  
Sbjct: 1204 DKDLTMGQVGEKIKETFKNDLFVIWSEDNAENLIIRCRVVRDPKTLDAEA-EAEEDHMLK 1262

Query: 1258 KMQHLRRALPGIVVKGLPDISRAVINIRD------DGKRE------LLVEGYGLRDVMTT 1305
            K+++    L  I ++G+ DI+R V+   D       G+        L  +G  L +VMT 
Sbjct: 1263 KIENT--MLESITLRGVQDITRVVMMKYDRKVPNETGEYHKVPEWVLETDGVNLSEVMTV 1320

Query: 1306 DGVVGYKTKTNHFLEVYDVLGIEAARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKG 1365
             GV   +  TN F+++ +VLGIEA R ++  E+   +++ G  V+ RH+ LL DVMT +G
Sbjct: 1321 PGVDPTRIYTNSFIDIMNVLGIEAGRAALYREVYNVIASDGSYVNYRHMALLVDVMTSQG 1380

Query: 1366 EVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMTIGTG 1425
             ++ +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTG
Sbjct: 1381 FLMSVTRHGFNRADTGALMRCSFEETVEILFEAGASAELDDCNGVSENVILGQMAPIGTG 1440

Query: 1426 SFKVV 1430
            +F V+
Sbjct: 1441 AFDVM 1445

>TPHA0A03070 Chr1 complement(671766..676925) [5160 bp, 1719 aa] {ON}
            Anc_7.314 YDL140C
          Length = 1719

 Score =  645 bits (1664), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/1508 (32%), Positives = 755/1508 (50%), Gaps = 163/1508 (10%)

Query: 11   KRISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGVSSSQAECSTC 70
            + +  ++F   S  ++ + S  +I   +  D    RA K GG  D R+G      +C TC
Sbjct: 12   RTVKEVQFGLFSPEEVRSISVAKIKFPETMDETQTRA-KIGGLNDPRLGSIDRNLKCQTC 70

Query: 71   HGTLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNE--EDKRQFLSELR 128
               +  C GHFGHI LA PVFH+G+     ++ + IC +C KLLL+E  E  RQ +S   
Sbjct: 71   QEGMNECPGHFGHIDLAKPVFHIGFISKIKKVCECICMHCGKLLLDENNEQMRQVMSIK- 129

Query: 129  RPGIDNLRRMATLKKVLDQCKKQRRCLH--CGMLNXXXXXXXXXXXXXXLKIIHDTFRWV 186
                D+ +R   +  +   CK +  C        +                I  D  + V
Sbjct: 130  ----DSKKRFNAIWTL---CKTKTVCETDVPSEDDPTQLISRGGCGNAQPTIRKDGLKLV 182

Query: 187  GKKSAPEKDKWIGDWNQVLQHSPELERYMKRTMENLNPLKTLNLFKQISPQDCELLGIDS 246
            G   + +KDK   D ++  Q               LN  + LN+FK IS  D   LG + 
Sbjct: 183  G---SWKKDKATNDGDEPEQRV-------------LNTEEILNIFKHISVHDSNTLGFNE 226

Query: 247  TVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAGLEKG 306
              +  RP+  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++     G
Sbjct: 227  --QFARPDWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETLEHNG 283

Query: 307  ISINNMMEQWDYLQMAVAMYINSDSVNP--ALMPGGNGGGKTKPIRGFCQRLKGKQGRFR 364
               + + E    LQ  +A Y+++D      AL   G      +P++    RLKGK+GR R
Sbjct: 284  APHHAIEEAESLLQFHIATYMDNDIAGQPQALQKSG------RPVKSIRARLKGKEGRIR 337

Query: 365  GNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKHKLQQLIVNGAN 424
            GNL GKRVDFS RTVIS DPNL +D+V VP  +AK LT+PE VT YN  +L QL+ NG N
Sbjct: 338  GNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPN 397

Query: 425  VHPGANYLLKKNEEARRNLRYGDRIKLAKNLQIGDVVERHLEDGDVVLFNRQPSLHRLSI 484
             HPGA Y+++ N + R +LRY  R    + LQ G  VERH+ D D VLFNRQPSLH++S+
Sbjct: 398  EHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQPSLHKMSM 455

Query: 485  LSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPK 544
            ++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++P+
Sbjct: 456  MAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCSVPLQIVSPQ 515

Query: 545  SGEPIIAATQDFITGSYLISHKDSFFDRATFVQMLSMMSDGNLQFD--IPPPAIMRPHYL 602
            S +P +   QD + G   ++ +D F +    + ML  + D    +D  IP PAI++P  L
Sbjct: 516  SNKPCMGIVQDTLCGIRKLTLRDCFIELDQLLNMLYWVPD----WDGIIPTPAIIKPVPL 571

Query: 603  WTGKQLFSLLIKPNKKSPVIINLDA--KNKVYIAPKNKAYPNEMSANDGYVVIRGSNILS 660
            W+GKQ+ S+ I      P  I+L    +    ++PK+          +G ++I G  I+ 
Sbjct: 572  WSGKQILSIAI------PKGIHLQRFDEGTTMLSPKD----------NGMLIIDG-QIIF 614

Query: 661  GVMDKSVLGDGKKHSVFYTILRDFGPQEATQAMNRMAKLCARYLGNRGFSIGISD-VTPG 719
            GV+DK  +G      + + + R+ GPQ   +    + K+   +  + GFS GI D +  G
Sbjct: 615  GVVDKKTVGSSNG-GLIHVVTREKGPQICAKMFGNIQKVVNFWFLHNGFSTGIGDTIADG 673

Query: 720  VELKATKEEMVEIAYAKCDELIDLYKRGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 779
              +K   E + + A  K +E+    +   L  + G    ++ E  +   L++ R++ G +
Sbjct: 674  GTMKEITETIAD-AKRKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRL 732

Query: 780  CIRELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 839
                L++LN    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  
Sbjct: 733  AEVNLNDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDY 792

Query: 840  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899
            +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   Y
Sbjct: 793  SPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHY 852

Query: 900  DNTVRTSSNGIVQFTYGGDGLDPLNMEGNA------KPVNFNRSWDHANNITYNHDDKGM 953
            D+T R S   ++QF YG DG+D  ++E  +          F + +   + ++ NH     
Sbjct: 853  DSTTRNSLGNVIQFVYGEDGIDAGHIEKQSIDTIGGSDAAFEKRY-RIDLMSPNHALDPS 911

Query: 954  LPYQILEET-----NAILHPLEQQL---SRYDNVGNPLAPGLENEELYIDQHDAEREFYQ 1005
            L    LE T      +IL    +QL    R+  + N    G  N  L ++     R   Q
Sbjct: 912  LLESGLEITGDVKLQSILDTEYKQLVDDRRF--LRNVFIDGEPNWHLPVNI----RRIIQ 965

Query: 1006 SLRTYMSEKARKLADITKSRGLKELYHAPALELQLMDLDASCPEVDVKSVNQLCKISSKL 1065
            + +        K +D+T +  ++++       L L        E    ++   C     L
Sbjct: 966  NAQQTFRIDHTKPSDLTINEVIRDVARLQENLLVLRGKGKIIEEAQNDAITLFC----CL 1021

Query: 1066 VRTFLDI--AISKYRKAKVEPGTAVGAIGAH---SIGEPGTQMTLKTFHFAGVASMNVTL 1120
            VR+ L +   + +YR  K      +  I +    SI  PG  + +      G  +  +TL
Sbjct: 1022 VRSRLAVRRVLQEYRLTKQAFQWVLNNIESQFLRSIVHPGEMVGVLAAQSIGEPATQMTL 1081

Query: 1121 ---------------GVPRIKEIINASKVISTPIINATLVND----DDERAARVVKGRVE 1161
                           GVPR+KEI+N +K + TP  ++T+  D     D+  A++++  +E
Sbjct: 1082 NTFHFAGVASKKVTSGVPRLKEILNVAKNMKTP--SSTVYLDPEYATDQEKAKIIRSAIE 1139

Query: 1162 KTLLSDV-----IFYIQD----VYRDNMSFLQVKVDLATIEK-----------LQLEL-- 1199
             T L  V     I+Y  D    V  ++   +Q+   L   E            L+LEL  
Sbjct: 1140 HTTLKSVTVASEIYYDPDPTTTVIAEDEEIIQLHYSLMDSETEKNIDNQSPWLLRLELDR 1199

Query: 1200 ---TVEDIAIAITSAPKLKISTGDVSIVGR--NKININVCNDLDKAKSISTLASEPHEND 1254
                 +D+ +        +    D+S++    N   + +   + + KS+    +E  E+ 
Sbjct: 1200 AAMNDKDLTMVQVGEKIKETFRNDLSVIWSEDNADKLIIRCRVVRPKSLDA-ETEAEEDH 1258

Query: 1255 VFFKMQHLRRALPGIVVKGLPDISRAVINIRD------DGKRE------LLVEGYGLRDV 1302
            +  K+++    L  I ++G+ DI R V+   D       G+ +      L  +G  L +V
Sbjct: 1259 MLKKIENT--MLESITLRGVEDIERVVMMKYDRKMPSETGEYQKVPEWVLETDGVNLMEV 1316

Query: 1303 MTTDGVVGYKTKTNHFLEVYDVLGIEAARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMT 1362
            MT  GV G +  TN F+++ +VLGIEA R ++  E+   +++ G  V+ RH+ LL DVMT
Sbjct: 1317 MTVPGVDGSRIYTNSFIDITEVLGIEAGRAALYREVYNVIASDGSYVNYRHMALLVDVMT 1376

Query: 1363 YKGEVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMTI 1422
             +G +  +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   I
Sbjct: 1377 TQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPI 1436

Query: 1423 GTGSFKVV 1430
            GTG+F V+
Sbjct: 1437 GTGAFDVM 1444

>Kwal_55.21464 s55 (850323..851285) [963 bp, 320 aa] {OFF} YOR116C
            (RPO31) - RNA polymerase III large subunit [contig 130]
            FULL
          Length = 320

 Score =  533 bits (1372), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 260/318 (81%), Positives = 291/318 (91%), Gaps = 3/318 (0%)

Query: 1144 LVNDDDERAARVVKGRVEKTLLSDVIFYIQDVYRDNMSFLQVKVDLATIEKLQLELTVED 1203
            LVN +DERAARVVKGR+EKTLLSDV FYIQDVY+DN+SFLQVK+DL TIEKLQLELT+ED
Sbjct: 4    LVNMNDERAARVVKGRIEKTLLSDVAFYIQDVYKDNLSFLQVKIDLGTIEKLQLELTIED 63

Query: 1204 IAIAITSAPKLKISTGDVSIVGRNKININVCNDLDKAKSISTLASEPHENDVFFKMQHLR 1263
            IA+AIT A KLKI+  DVSI+G++K+NINV  +  K KSIST A EP EN++F+++QHLR
Sbjct: 64   IAVAITRASKLKIAAQDVSIIGKDKVNINVYPEGSKLKSISTSAKEPIENELFYRVQHLR 123

Query: 1264 RALPGIVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVVGYKTKTNHFLEVYD 1323
            R+LPGIVVKGLPDI+RAVINI+ DG RELLVEGYGLRDVMTTDGVVG+KTKTNH LEV  
Sbjct: 124  RSLPGIVVKGLPDIARAVINIKSDGSRELLVEGYGLRDVMTTDGVVGHKTKTNHILEVVS 183

Query: 1324 VLGIEAARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVL 1383
            VLGIEAARTSI+ EIDYTMSNHGMSVDPRH+QLLGDVMTYKGEVLGITRFGLSKMRDSVL
Sbjct: 184  VLGIEAARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEVLGITRFGLSKMRDSVL 243

Query: 1384 QLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMTIGTGSFKVVKGTNISPDDLKPK 1443
            QLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTM+IGTG+FKVVKGTN+S ++LKPK
Sbjct: 244  QLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVVKGTNLSSEELKPK 303

Query: 1444 PTLFENLCSLNT--LKVN 1459
             TLFE+LC  NT  LK+N
Sbjct: 304  ATLFESLCG-NTAALKIN 320

>Kpol_162.1 s162 complement(211..4146) [3936 bp, 1311 aa] {ON}
            complement(211..4146) [3936 nt, 1312 aa]
          Length = 1311

 Score =  565 bits (1457), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 397/1160 (34%), Positives = 606/1160 (52%), Gaps = 111/1160 (9%)

Query: 347  KPIRGFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEK 406
            +P++    RLKGK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LT+PE 
Sbjct: 2    RPVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEV 61

Query: 407  VTRYNKHKLQQLIVNGANVHPGANYLLKKNEEARRNLRYGDRIKLAKNLQIGDVVERHLE 466
            VT YN  +L QL+ NG N HPGA Y+++ N + R +LRY  R    + LQ G  VERH+ 
Sbjct: 62   VTPYNIDRLTQLVRNGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIM 119

Query: 467  DGDVVLFNRQPSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEA 526
            D D VLFNRQPSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE 
Sbjct: 120  DNDPVLFNRQPSLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEET 179

Query: 527  RAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFVQMLSMMSDGN 586
            RAE   L  V   +++P+S +P +   QD + G   ++ +DSF +    + ML  + D +
Sbjct: 180  RAELSQLCAVPMQIVSPQSNKPCMGIVQDTLCGIRKLTLRDSFIEFDQVLNMLYWVPDWD 239

Query: 587  LQFDIPPPAIMRPHYLWTGKQLFSLLIKPNKKSPVIINLDA--KNKVYIAPKNKAYPNEM 644
                IP PAI++P  LWTGKQ+ S+ I      P  I+L    +    ++PK+       
Sbjct: 240  GV--IPQPAILKPKPLWTGKQILSIAI------PKGIHLQRFDEGTTMLSPKD------- 284

Query: 645  SANDGYVVIRGSNILSGVMDKSVLGDGKKHSVFYTILRDFGPQEATQAMNRMAKLCARYL 704
               +G +VI G  I+ GV+DK  +G      + + + R+ GPQ   +    + K+   +L
Sbjct: 285  ---NGMLVIDG-QIVFGVVDKKTVGSSSG-GLIHVVTREKGPQVCAKMFGNIQKVVNFWL 339

Query: 705  GNRGFSIGISD-VTPGVELKATKEEMVEIAYAKCDELIDLYKRGKLETQPGCNEEQTLEA 763
             + GFS GI D +  G  +K   E + E A  K +E+    +   L  + G    ++ E 
Sbjct: 340  LHNGFSTGIGDTIADGETMKEITETIAE-AKKKVEEVTKEAQANLLTAKHGMTLRESFED 398

Query: 764  KIGGLLSKVREEVGDVCIRELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVP 823
             +   L++ R++ G +    L++ N    M + GSKGS +N++QM A VGQQ + G R+ 
Sbjct: 399  NVVRFLNEARDKAGRLAEVNLNDTNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIA 458

Query: 824  DGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGY 883
             GF DR+LPHF K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY
Sbjct: 459  FGFVDRTLPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGY 518

Query: 884  MSRRLMKSLEDLSCQYDNTVRTSSNGIVQFTYGGDGLDPLNMEGNAKPV--NFNRSWDHA 941
            + RRL+K+LED+   YD+T R S   ++QF YG DG+D   +E  +       N++++  
Sbjct: 519  IQRRLVKALEDIMVHYDSTTRNSLGNVIQFVYGEDGIDASYIEKQSIDTIGGSNQAFEKR 578

Query: 942  NNITYNHDDKGMLPYQILEETNAIL------HPLEQQLSRYDN----VGNPLAPGLENEE 991
              I     +   L   +LE  + I+        L+++  +  N    + N    G +N  
Sbjct: 579  YRIDLMSPEHS-LDTTLLESGSEIIGDVKIQSMLDEEYKQLVNDRRFLRNVFIDGEQNWP 637

Query: 992  LYIDQHDAEREFYQSLRTYMSEKARKLADITKSRGLKELYHAPALELQLMDLDASCPEVD 1051
            L ++     +   Q+ R   +    K +D+T       +Y    LE +L+ L      ++
Sbjct: 638  LPVNIRRIVQNAQQTFRIDHT----KPSDLTIR---DVVYGVKELESKLLVLRGKSKIIE 690

Query: 1052 VKSVNQLCKISSKLVRTFLDI--AISKYRKAKVEPGTAVGAIGAH---SIGEPGTQMTLK 1106
             ++ N    +   L+R+ L     + +YR  K      +  I +    SI  PG  + + 
Sbjct: 691  -EAQNDAITLFCCLLRSRLAARRVLEEYRLTKQAFDWVLSNIESQFLRSIVHPGEMVGVL 749

Query: 1107 TFHFAGVASMNVTL---------------GVPRIKEIINASKVISTPIINATLVNDD--D 1149
                 G  +  +TL               GVPR+KEI+N +K + TP     L  +   D
Sbjct: 750  AAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSSTVYLEPEYAID 809

Query: 1150 ERAARVVKGRVEKTLLSDV-----IFYIQD----VYRDNMSFLQVKVDLATIEK------ 1194
            +  A+ ++  +E T L  V     I+Y  D    V  D+   +Q+   L   E       
Sbjct: 810  QEKAKFIRSAIEHTTLKSVTVASEIYYDPDPRSTVIPDDEEIIQLHFSLLDDETEKALDN 869

Query: 1195 -----LQLEL-----TVEDIAIAITSAPKLKISTGDVSIVGR--NKININVCNDLDKAKS 1242
                 L+LEL       +D+ +        +    D+ ++    N   + +   + + KS
Sbjct: 870  QSPWLLRLELDRAAMNDKDLTMGQVGEKIKETFKNDLFVIWSEDNADKLIIRCRVVRPKS 929

Query: 1243 ISTLASEPHENDVFFKMQHLRRALPGIVVKGLPDISRAVINIRD------DGKRE----- 1291
            +    +E  E+ +  K+++    L  I ++G+ DI R V+   D      +G  E     
Sbjct: 930  LDA-ETEAEEDHMLKKIENT--MLESITLRGVEDIERVVMMKYDRKMPSENGAYEKVPEW 986

Query: 1292 -LLVEGYGLRDVMTTDGVVGYKTKTNHFLEVYDVLGIEAARTSIIDEIDYTMSNHGMSVD 1350
             L  +G  L +VMT  GV   +  TN F+++ +VLGIEA R ++  E+   +++ G  V+
Sbjct: 987  VLETDGVNLLEVMTVTGVDPTRIYTNSFIDITEVLGIEAGRAALYREVYNVIASDGSYVN 1046

Query: 1351 PRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGV 1410
             RH+ LL DVMT +G +  +TR G ++     L   SFE+T + LF+A    + D   GV
Sbjct: 1047 YRHMALLVDVMTTQGSLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGV 1106

Query: 1411 SECIILGQTMTIGTGSFKVV 1430
            SE +ILGQ   +GTG+F V+
Sbjct: 1107 SENVILGQMAPVGTGAFDVM 1126

>KAFR0B01060 Chr2 complement(197351..202408) [5058 bp, 1685 aa] {ON}
           Anc_7.314 YDL140C
          Length = 1685

 Score =  561 bits (1447), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 358/927 (38%), Positives = 508/927 (54%), Gaps = 70/927 (7%)

Query: 11  KRISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGVSSSQAECSTC 70
           + +  ++F   S  ++ A S  ++   +  D    RA K GG  D R+G      +C TC
Sbjct: 12  RTVKEVQFGLFSPEEVRAISVAKVRFPETMDETQTRA-KIGGLNDPRLGSIDRNLKCQTC 70

Query: 71  HGTLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNE--EDKRQFLSELR 128
              +  C GHFGHI LA PVFHVG+     ++ +S+C +C KLLL+E  E  RQ L +++
Sbjct: 71  QEGMNECPGHFGHIDLAKPVFHVGFISKIKKVCESVCMHCGKLLLDEHNEQMRQVL-KIK 129

Query: 129 RPGIDNLRRMATLKKVLDQCKKQRRC-LHCGMLNXXXXXXXXXXXXXXLKIIH-DTFRWV 186
            P             V   CK +  C       N                 +  D  + V
Sbjct: 130 DP-------KKRFNAVWSLCKTKMICETDVPSENDPTQLISRGGCGNAQPTVRKDGLKLV 182

Query: 187 GKKSAPEKDKWIGDWNQVLQHSPELERYMKRTMENLNPLKTLNLFKQISPQDCELLGIDS 246
           G   + +KDK   D  +  Q    +E             + LN+FK ISP+D   LG D 
Sbjct: 183 G---SWKKDKATSDGEEPEQRVLGVE-------------EILNIFKHISPEDSTKLGFDE 226

Query: 247 TVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAGLEKG 306
             +  RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++     G
Sbjct: 227 --EFARPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETLEHNG 283

Query: 307 ISINNMMEQWDYLQMAVAMYINSDSVNP--ALMPGGNGGGKTKPIRGFCQRLKGKQGRFR 364
              + + E    LQ  VA Y+++D      AL   G      +P++    RLKGK+GR R
Sbjct: 284 APHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARLKGKEGRIR 337

Query: 365 GNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKHKLQQLIVNGAN 424
           GNL GKRVDFS RTVIS DPNL +D+V VP  +A+ LT+PE VT YN  +L QL+ NG N
Sbjct: 338 GNLMGKRVDFSARTVISGDPNLELDQVGVPKSIARTLTYPEVVTPYNIDRLTQLVRNGPN 397

Query: 425 VHPGANYLLKKNEEARRNLRYGDRIKLAKNLQIGDVVERHLEDGDVVLFNRQPSLHRLSI 484
            HPGA Y+++ N + R +LRY  R    + LQ G  VERH+ D D VLFNRQPSLH++S+
Sbjct: 398 EHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDDDPVLFNRQPSLHKMSM 455

Query: 485 LSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPK 544
           +SH  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++P+
Sbjct: 456 MSHRVKVVPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQ 515

Query: 545 SGEPIIAATQDFITGSYLISHKDSFFDRATFVQMLSMMSDGNLQFD--IPPPAIMRPHYL 602
           S +P +   QD + G  +++ KD+F +    + ML  + D    +D  IP PAI++P  L
Sbjct: 516 SNKPCMGIVQDTLCGIRILTLKDTFLEFDHVLNMLYWVPD----WDGIIPTPAILKPKPL 571

Query: 603 WTGKQLFSLLIKPNKKSPVIINLDA--KNKVYIAPKNKAYPNEMSANDGYVVIRGSNILS 660
           WTGKQ+ S  I      P  I+L    +    ++PK+          +G ++I G  I+ 
Sbjct: 572 WTGKQILSAAI------PKGIHLQRFDEGTTLLSPKD----------NGMLIIDG-QIIF 614

Query: 661 GVMDKSVLGDGKKHSVFYTILRDFGPQEATQAMNRMAKLCARYLGNRGFSIGISD-VTPG 719
           GV+DK  +G      + + + R+ GPQ  ++    + K+   +L + GFS GI D +  G
Sbjct: 615 GVVDKKTVGSSSG-GLIHVVTREKGPQVCSRLFGNIQKVVNFWLLHNGFSTGIGDTIANG 673

Query: 720 VELKATKEEMVEIAYAKCDELIDLYKRGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 779
             +K   E + E A  K +E+    +   L  + G    ++ E  +   L++ R++ G +
Sbjct: 674 ETIKEITETIAE-AKKKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRL 732

Query: 780 CIRELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 839
               L++ N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  
Sbjct: 733 AEVNLNDTNYVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIGYGFVDRTLPHFSKDDY 792

Query: 840 TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 899
           +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   Y
Sbjct: 793 SPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHY 852

Query: 900 DNTVRTSSNGIVQFTYGGDGLDPLNME 926
           D T R S   I+QF YG DG+D  ++E
Sbjct: 853 DGTTRNSLGNIIQFIYGEDGIDASHIE 879

 Score =  174 bits (440), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 128/397 (32%), Positives = 203/397 (51%), Gaps = 44/397 (11%)

Query: 1075 SKYRKAKVEPGTAVGAIGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKV 1134
            S++ ++ V PG  VG + A SIGEP TQMTL TFHFAGVAS  VT GVPR+KEI+N +K 
Sbjct: 1051 SQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKN 1110

Query: 1135 ISTPIINATLVND--DDERAARVVKGRVEKTLLSDV-----IFYIQD----VYRDNMSFL 1183
            + TP +   L      D+  A+ ++  +E T L  V     I+Y  D    V  D+   +
Sbjct: 1111 MKTPSLTVYLEEKYAADQERAKYIRSAIEHTTLKSVTVASEIYYDPDPRSTVIEDDEEII 1170

Query: 1184 QVKVDLATIEKLQLELTVEDIAIAITSAPKLKISTGDVSI--VGRN-----KININVCND 1236
            Q+   L   E+++  L  +   +      +  ++  D+++  VG       K ++ V   
Sbjct: 1171 QLHFSLLD-EEMEASLDQQSPWLLRLELDRAAMNDKDLTMGQVGERIKETFKKDLFVIWS 1229

Query: 1237 LDKAKSIST-----------LASEPHENDVFFKMQHLRRALPGIVVKGLPDISRAVINIR 1285
             D A+ +               +E  E+ +  K+++    L  I ++G+ +I R V+   
Sbjct: 1230 EDNAEKLIIRCRVVRPKGLDAETEAEEDHMLKKIENT--MLENITLRGVENIERVVMMKY 1287

Query: 1286 D------DGKRE------LLVEGYGLRDVMTTDGVVGYKTKTNHFLEVYDVLGIEAARTS 1333
            D       G+ +      L  +G  L +VMT  GV   +  TN F+++ +VLGIEA R +
Sbjct: 1288 DRKVPSKTGEFQKVPEWVLETDGVNLAEVMTIPGVDTTRIYTNSFIDIMEVLGIEAGRAA 1347

Query: 1334 IIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASFEKTTD 1393
            +  E+   +++ G  V+ RH+ LL DVMT +G +  +TR G ++     L   SFE+T +
Sbjct: 1348 LYKEVYNVIASDGSYVNYRHMALLVDVMTCQGGLTSVTRHGFNRANTGALMRCSFEETVE 1407

Query: 1394 HLFDAAFYMKKDAVEGVSECIILGQTMTIGTGSFKVV 1430
             LF+A    + D   GVSE ++LGQ   IGTG+F V+
Sbjct: 1408 ILFEAGASAELDDCRGVSENVLLGQMAPIGTGAFGVM 1444

>KNAG0C03970 Chr3 complement(778936..784101) [5166 bp, 1721 aa] {ON}
           Anc_7.314 YDL140C
          Length = 1721

 Score =  556 bits (1434), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 352/929 (37%), Positives = 514/929 (55%), Gaps = 75/929 (8%)

Query: 11  KRISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGVSSSQAECSTC 70
           + +  ++F   S  ++ A S  +I   +  D    RA K GG  D R+G      +C TC
Sbjct: 12  RTVKEVQFGLFSPEEVRAISVAKIKFPETMDETQTRA-KIGGLNDPRLGSIDRNLKCQTC 70

Query: 71  HGTLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNE--EDKRQFLSELR 128
              ++ C GHFGHI LA PVFHVG+     ++ + +C +C KLLL+E  E  RQ ++   
Sbjct: 71  QEGMSECPGHFGHIDLAKPVFHVGFITKIKKVCECVCMHCGKLLLDENNEQMRQVMA--- 127

Query: 129 RPGIDNLRRMATLKKVLDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXLKIIHDTFRWVGK 188
              I + ++       L  CK +  C                     +   +D  + V +
Sbjct: 128 ---IKDPKKRFNATWAL--CKTKMVC------------------ETDVPSENDPTKLVSR 164

Query: 189 ------KSAPEKD--KWIGDWNQVLQHSPELERYMKRTMENLNPLKTLNLFKQISPQDCE 240
                 +    KD  K +G W +  + + E E   +R    L+  + LN+FK IS +D  
Sbjct: 165 GGCGNTQPTVRKDGLKLVGSWKR--KKTIEGEEPEQRV---LSTEEILNIFKHISTEDFI 219

Query: 241 LLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LG +   +  RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++
Sbjct: 220 RLGFNE--EFSRPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLE 276

Query: 301 AGLEKGISINNMMEQWDYLQMAVAMYINSDSVNP--ALMPGGNGGGKTKPIRGFCQRLKG 358
                G   + + E    LQ  VA Y+++D      AL   G      +P++    RLKG
Sbjct: 277 TLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARLKG 330

Query: 359 KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKHKLQQL 418
           K+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +A+ LT+PE VT YN  +L QL
Sbjct: 331 KEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIARTLTYPEVVTPYNIDRLTQL 390

Query: 419 IVNGANVHPGANYLLKKNEEARRNLRYGDRIKLAKNLQIGDVVERHLEDGDVVLFNRQPS 478
           + NG N HPGA Y++++N + R +LRY  R    + LQ G  VERH+ D D VLFNRQPS
Sbjct: 391 VRNGPNEHPGAKYVIRENGD-RIDLRYSKRAGDVQ-LQYGWKVERHIMDDDPVLFNRQPS 448

Query: 479 LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 538
           LH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V  
Sbjct: 449 LHKMSMMAHKVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPL 508

Query: 539 NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFVQMLSMMSDGNLQFDIPPPAIMR 598
            +++P+S +P +   QD + G  +++ +D+F +    + ML  + D +    IP PAI++
Sbjct: 509 QIVSPQSNKPCMGIVQDTLCGIRILTLRDTFLELDHVLNMLYWVPDWDGV--IPTPAILK 566

Query: 599 PHYLWTGKQLFSLLIKPNKKSPVIINLDAKNKVYIAPKNKAYPNEMSANDGYVVIRGSNI 658
           P  LWTGKQ+ S+ I PN    + +    +    ++PK+          +G ++I G  I
Sbjct: 567 PKPLWTGKQILSVAI-PNG---IHLQRFDEGTTLLSPKD----------NGMLIIDG-QI 611

Query: 659 LSGVMDKSVLGDGKKHSVFYTILRDFGPQEATQAMNRMAKLCARYLGNRGFSIGISD-VT 717
           + GV+DK  +G      + + + R+ GPQ   +    + K+   +L + GFS GI D + 
Sbjct: 612 IFGVVDKKTVGSSSG-GLIHVVTREKGPQTCARLFGNIQKVVNFWLLHNGFSTGIGDTIA 670

Query: 718 PGVELKATKEEMVEIAYAKCDELIDLYKRGKLETQPGCNEEQTLEAKIGGLLSKVREEVG 777
            G  +K   E + E A  K +E+    +   L  + G    ++ E  +   L++ R++ G
Sbjct: 671 DGATIKEITETIAE-AKKKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAG 729

Query: 778 DVCIRELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKN 837
            +    L++ N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+
Sbjct: 730 RLAEVNLNDTNFVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIGFGFVDRTLPHFSKD 789

Query: 838 SKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSC 897
             +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+  
Sbjct: 790 DYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMV 849

Query: 898 QYDNTVRTSSNGIVQFTYGGDGLDPLNME 926
            YDNT R S   ++QF YG DG+D   +E
Sbjct: 850 HYDNTTRNSLGNVIQFIYGEDGIDASYIE 878

 Score =  175 bits (443), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 127/398 (31%), Positives = 206/398 (51%), Gaps = 46/398 (11%)

Query: 1075 SKYRKAKVEPGTAVGAIGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKV 1134
            +++ ++ V PG  VG + A SIGEP TQMTL TFHFAGVAS  VT GVPR+KEI+N +K 
Sbjct: 1050 AQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKN 1109

Query: 1135 ISTPIINATLVND--DDERAARVVKGRVEKTLLSDV-----IFYIQD----VYRDNMSFL 1183
            + TP +   L +D   D+  A++++  +E T L  V     I+Y  D    V  ++   +
Sbjct: 1110 MKTPSLTVYLKDDYSSDQEKAKLIRSAIEHTTLKSVTVASEIYYDPDPRSTVIEEDEEII 1169

Query: 1184 QVKVDLATIEKLQLELTVEDIAIAITSAPKLKISTGDVSI--VGRNKININVCNDL---- 1237
            Q+   L   ++++  L  +   +      +  ++  D+++  VG  +I     NDL    
Sbjct: 1170 QLHFSLLD-DEMESSLDQQSPWLLRLELDRAAMNDKDLTMGQVGE-RIKETFKNDLFVIW 1227

Query: 1238 --DKAKSIST-----------LASEPHENDVFFKMQHLRRALPGIVVKGLPDISRAVINI 1284
              D A+ +               +E  E+ +  K+++    L  I ++G+ +I R V+  
Sbjct: 1228 SEDNAEKLIIRCRVVRPKSLDAETEAEEDHMLKKIENT--MLENITLRGVENIERVVMMK 1285

Query: 1285 RD------DGKRE------LLVEGYGLRDVMTTDGVVGYKTKTNHFLEVYDVLGIEAART 1332
             D       G+ +      L  +G  L +VM   GV   +  TN F+++ +VLGIEA R 
Sbjct: 1286 YDRKVPNESGEYQKVPEWVLESDGVNLAEVMQVPGVDATRIYTNSFIDIMEVLGIEAGRA 1345

Query: 1333 SIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASFEKTT 1392
            ++  E+   +++ G  V+ RH+ LL DVMT +G +  +TR G ++     L   SFE+T 
Sbjct: 1346 ALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSNTGALMRCSFEETV 1405

Query: 1393 DHLFDAAFYMKKDAVEGVSECIILGQTMTIGTGSFKVV 1430
            + LF+A    + D   GVSE ++LGQ   IGTG+F V+
Sbjct: 1406 EILFEAGAAAELDDCRGVSENVLLGQMAPIGTGAFDVM 1443

>YDL140C Chr4 complement(205360..210561) [5202 bp, 1733 aa] {ON}
           RPO21RNA polymerase II largest subunit B220, part of
           central core; phosphorylation of C-terminal heptapeptide
           repeat domain regulates association with transcription
           and splicing factors; similar to bacterial beta-prime
          Length = 1733

 Score =  553 bits (1426), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 351/926 (37%), Positives = 509/926 (54%), Gaps = 68/926 (7%)

Query: 11  KRISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGVSSSQAECSTC 70
           + +  ++F   S  ++ A S  +I   +  D    RA K GG  D R+G      +C TC
Sbjct: 12  RTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNLKCQTC 70

Query: 71  HGTLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNEEDKRQFLSELRRP 130
              +  C GHFGHI LA PVFHVG+     ++ + +C +C KLLL+E +      EL R 
Sbjct: 71  QEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHN------ELMRQ 124

Query: 131 GI---DNLRRMATLKKVLDQCKKQRRCLH--CGMLNXXXXXXXXXXXXXXLKIIHDTFRW 185
            +   D+ +R A +  +   CK +  C        +                I  D  + 
Sbjct: 125 ALAIKDSKKRFAAIWTL---CKTKMVCETDVPSEDDPTQLVSRGGCGNTQPTIRKDGLKL 181

Query: 186 VGKKSAPEKDKWIGDWNQVLQHSPELERYMKRTMENLNPLKTLNLFKQISPQDCELLGID 245
           VG   + +KD+  GD ++     PEL          L+  + LN+FK IS +D   LG +
Sbjct: 182 VG---SWKKDRATGDADE-----PELRV--------LSTEEILNIFKHISVKDFTSLGFN 225

Query: 246 STVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAGLEK 305
                 RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++     
Sbjct: 226 EVFS--RPEWMILTCLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETLEHN 282

Query: 306 GISINNMMEQWDYLQMAVAMYINSDSVNP--ALMPGGNGGGKTKPIRGFCQRLKGKQGRF 363
           G   + + E    LQ  VA Y+++D      AL   G      +P++    RLKGK+GR 
Sbjct: 283 GAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARLKGKEGRI 336

Query: 364 RGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKHKLQQLIVNGA 423
           RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LT+PE VT YN  +L QL+ NG 
Sbjct: 337 RGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGP 396

Query: 424 NVHPGANYLLKKNEEARRNLRYGDRIKLAKNLQIGDVVERHLEDGDVVLFNRQPSLHRLS 483
           N HPGA Y+++ + + R +LRY  R    + LQ G  VERH+ D D VLFNRQPSLH++S
Sbjct: 397 NEHPGAKYVIRDSGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQPSLHKMS 454

Query: 484 ILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTP 543
           +++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++P
Sbjct: 455 MMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSP 514

Query: 544 KSGEPIIAATQDFITGSYLISHKDSFFDRATFVQMLSMMSDGNLQFDIPPPAIMRPHYLW 603
           +S +P +   QD + G   ++ +D+F +    + ML  + D +    IP PAI++P  LW
Sbjct: 515 QSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGV--IPTPAIIKPKPLW 572

Query: 604 TGKQLFSLLIKPNKKSPVIINLDAKNKVYIAPKNKAYPNEMSANDGYVVIRGSNILSGVM 663
           +GKQ+ S+ I PN    + +    +    ++PK+          +G ++I G  I+ GV+
Sbjct: 573 SGKQILSVAI-PNG---IHLQRFDEGTTLLSPKD----------NGMLIIDG-QIIFGVV 617

Query: 664 DKSVLGDGKKHSVFYTILRDFGPQEATQAMNRMAKLCARYLGNRGFSIGISDVTPGVELK 723
           +K  +G      + + + R+ GPQ   +    + K+   +L + GFS GI D    +   
Sbjct: 618 EKKTVGSSNG-GLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHNGFSTGIGDT---IADG 673

Query: 724 ATKEEMVEIAYAKCDELIDLYKRGK---LETQPGCNEEQTLEAKIGGLLSKVREEVGDVC 780
            T  E+ E       +++D+ K  +   L  + G    ++ E  +   L++ R++ G + 
Sbjct: 674 PTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRLA 733

Query: 781 IRELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKT 840
              L +LN    M   GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +
Sbjct: 734 EVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYS 793

Query: 841 PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 900
           P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YD
Sbjct: 794 PESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYD 853

Query: 901 NTVRTSSNGIVQFTYGGDGLDPLNME 926
           NT R S   ++QF YG DG+D  ++E
Sbjct: 854 NTTRNSLGNVIQFIYGEDGMDAAHIE 879

 Score =  173 bits (438), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 129/412 (31%), Positives = 208/412 (50%), Gaps = 48/412 (11%)

Query: 1064 KLVRTFLDIAIS----KYRKAKVEPGTAVGAIGAHSIGEPGTQMTLKTFHFAGVASMNVT 1119
            +L +   D  +S    ++ ++ V PG  VG + A SIGEP TQMTL TFHFAGVAS  VT
Sbjct: 1036 RLTKQAFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVT 1095

Query: 1120 LGVPRIKEIINASKVISTPIINATLV--NDDDERAARVVKGRVEKTLLSDV-----IFYI 1172
             GVPR+KEI+N +K + TP +   L   +  D+  A++++  +E T L  V     I+Y 
Sbjct: 1096 SGVPRLKEILNVAKNMKTPSLTVYLEPGHAADQEQAKLIRSAIEHTTLKSVTIASEIYYD 1155

Query: 1173 QD----VYRDNMSFLQVKVDLATIEK-----------LQLEL-----TVEDIAIAITSAP 1212
             D    V  ++   +Q+   L   E            L+LEL       +D+ +      
Sbjct: 1156 PDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRAAMNDKDLTMGQVGER 1215

Query: 1213 KLKISTGDVSIVGR--NKININVCNDLDKAKSISTLASEPHENDVFFKMQHLRRALPGIV 1270
              +    D+ ++    N   + +   + + KS+    +E  E+ +  K+++    L  I 
Sbjct: 1216 IKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDA-ETEAEEDHMLKKIENT--MLENIT 1272

Query: 1271 VKGLPDISRAVINIRD------------DGKRELLVEGYGLRDVMTTDGVVGYKTKTNHF 1318
            ++G+ +I R V+   D            + +  L  +G  L +VMT  G+   +  TN F
Sbjct: 1273 LRGVENIERVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDPTRIYTNSF 1332

Query: 1319 LEVYDVLGIEAARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1378
            +++ +VLGIEA R ++  E+   +++ G  V+ RH+ LL DVMT +G +  +TR G ++ 
Sbjct: 1333 IDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGLTSVTRHGFNRS 1392

Query: 1379 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMTIGTGSFKVV 1430
                L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTG+F V+
Sbjct: 1393 NTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGAFDVM 1444

>CAGL0I03828g Chr9 complement(328922..334069) [5148 bp, 1715 aa]
           {ON} highly similar to uniprot|P04050 Saccharomyces
           cerevisiae YDL140c RPO21 DNA-directed RNA polymerase II
          Length = 1715

 Score =  553 bits (1425), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 352/923 (38%), Positives = 501/923 (54%), Gaps = 62/923 (6%)

Query: 11  KRISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGVSSSQAECSTC 70
           + +  ++F   S  +I A S  +I   +  D    RA K GG  D R+G      +C TC
Sbjct: 12  RTVKEVQFGLFSPEEIRAISVAKIRLPETMDETQTRA-KIGGLNDPRLGSIDRNLKCQTC 70

Query: 71  HGTLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNEEDKRQFLSELRRP 130
              +  C GHFGHI LA PVFH+G+     ++ +S+C +C KLLL+E +      E  R 
Sbjct: 71  QEGMNECPGHFGHIDLAKPVFHIGFITKIKKVCESLCMHCGKLLLDEHN------EQMRQ 124

Query: 131 GIDNLRRMATLKKVLDQCKKQRRCLH--CGMLNXXXXXXXXXXXXXXLKIIHDTFRWVGK 188
            I           V   CK +  C        +                I  D  + VG 
Sbjct: 125 AIQIKDPKKRFNAVWSLCKTKMVCETDVPSEDDPTKLISRGGCGNTQPTIRKDGLKLVG- 183

Query: 189 KSAPEKDKWIGDWNQVLQHSPELERYMKRTMENLNPLKTLNLFKQISPQDCELLGIDSTV 248
             + +KDK  GD ++  Q               L+  + LN+FK ISP+D   LG +   
Sbjct: 184 --SWKKDKSTGDADEPEQRV-------------LSTEEILNIFKHISPEDSYRLGFNE-- 226

Query: 249 KAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAGLEKGIS 308
           +  RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++     G  
Sbjct: 227 EFARPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETLEHNGAP 285

Query: 309 INNMMEQWDYLQMAVAMYINSDSVNP--ALMPGGNGGGKTKPIRGFCQRLKGKQGRFRGN 366
            + + E    LQ  VA Y+++D      AL   G      +P++    RLKGK+GR RGN
Sbjct: 286 HHAVEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARLKGKEGRIRGN 339

Query: 367 LSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKHKLQQLIVNGANVH 426
           L GKRVDFS RTVIS DPNL +D+V VP  +A+ LT+PE VT YN  +L QL+ NG N H
Sbjct: 340 LMGKRVDFSARTVISGDPNLELDQVGVPKSIARTLTYPEVVTPYNIDRLSQLVRNGPNEH 399

Query: 427 PGANYLLKKNEEARRNLRYGDRIKLAKNLQIGDVVERHLEDGDVVLFNRQPSLHRLSILS 486
           PGA Y+++ N + R +LRY  R    + LQ G  VERH+ D D VLFNRQPSLH++S+++
Sbjct: 400 PGAKYVIRDNGD-RIDLRYSKRSGDVQ-LQYGWKVERHIMDDDPVLFNRQPSLHKMSMMA 457

Query: 487 HYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPKSG 546
           H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++P+S 
Sbjct: 458 HRVKVVPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSN 517

Query: 547 EPIIAATQDFITGSYLISHKDSFFDRATFVQMLSMMSDGNLQFDIPPPAIMRPHYLWTGK 606
           +P +   QD + G   ++ +D+F +    + ML  + D +    IP PAI++P  LW+GK
Sbjct: 518 KPCMGIVQDTLCGIRKLTLRDTFLEFDQVLNMLYWVPDWDGV--IPTPAIIKPKPLWSGK 575

Query: 607 QLFSLLIKPNKKSPVIINLDA--KNKVYIAPKNKAYPNEMSANDGYVVIRGSNILSGVMD 664
           Q+ S+ I      P  I+L    +    ++PK+          +G +VI G  I+ GV+D
Sbjct: 576 QILSVAI------PKGIHLQRFDEGTTLLSPKD----------NGMLVIDG-EIIFGVVD 618

Query: 665 KSVLGDGKKHSVFYTILRDFGPQEATQAMNRMAKLCARYLGNRGFSIGISD-VTPGVELK 723
           K  +G      + + + R+ GP    +    + K+   +L + GFS GI D V  G  ++
Sbjct: 619 KKTVG-SSSGGLIHVVTREKGPTICARLFGNIQKVVNFWLLHNGFSTGIGDTVADGQTMR 677

Query: 724 ATKEEMVEIAYAKCDELIDLYKRGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVCIRE 783
              E + E A  K + +    +   L  + G    ++ E  +   L++ R+  G +    
Sbjct: 678 EISETIAE-AKQKVEAVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDRAGRLAEMN 736

Query: 784 LDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQS 843
           L +LN    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +P+S
Sbjct: 737 LKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIGFGFVDRTLPHFSKDDYSPES 796

Query: 844 KGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTV 903
           KGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YD T 
Sbjct: 797 KGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDGTT 856

Query: 904 RTSSNGIVQFTYGGDGLDPLNME 926
           R S   ++QF YG DG+D  ++E
Sbjct: 857 RNSLGNVIQFIYGEDGMDAGHIE 879

 Score =  172 bits (437), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 134/421 (31%), Positives = 213/421 (50%), Gaps = 46/421 (10%)

Query: 1052 VKSVNQLCKISSKLVRTFLDIAISKYRKAKVEPGTAVGAIGAHSIGEPGTQMTLKTFHFA 1111
             + V Q  +++ +     L+   +++ ++ V PG  VG + A SIGEP TQMTL TFHFA
Sbjct: 1028 TRRVLQEYRLTKEAFEWVLNNVEAQFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHFA 1087

Query: 1112 GVASMNVTLGVPRIKEIINASKVISTPIINATLVND--DDERAARVVKGRVEKTLLSDV- 1168
            GVAS  VT GVPR+KEI+N +K + TP +   L  +   D+  A++V+  +E T L  V 
Sbjct: 1088 GVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLEPEYSADQEKAKLVRSAIEHTTLKSVT 1147

Query: 1169 ----IFYIQD----VYRDNMSFLQVKVDLATIEKLQLELTVEDIAIAITSAPKLKISTGD 1220
                I+Y  D    V  ++   +Q+   L   E  +L L  +   +      +  ++  D
Sbjct: 1148 VASEIYYDPDPRSTVIPEDDEIIQLHFSLLDDETEKL-LDQQSPWLLRLELDRAAMNDKD 1206

Query: 1221 VSI--VGRNKININVCNDL------DKAKSIST-----------LASEPHENDVFFKMQH 1261
            +++  VG  +I     NDL      D A+ +               +E  E+ +  K+++
Sbjct: 1207 LTMGQVGE-RIKDTFKNDLFVIWSEDNAEKLIIRCRVVRPKALDAETEAEEDHMLKKIEN 1265

Query: 1262 LRRALPGIVVKGLPDISRAVINIRD------DGKRE------LLVEGYGLRDVMTTDGVV 1309
                L  I ++G+  I R V+   D       G+ +      L  +G  L +VMT  GV 
Sbjct: 1266 T--MLENITLRGIEGIERVVMMKYDRKVPNETGEYQKVPEWVLETDGVNLSEVMTVPGVD 1323

Query: 1310 GYKTKTNHFLEVYDVLGIEAARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLG 1369
              +  TN F+++ +VLGIEA R ++  E+   +++ G  V+ RH+ LL DVMT +G +  
Sbjct: 1324 PTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGLTS 1383

Query: 1370 ITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMTIGTGSFKV 1429
            +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTG+F V
Sbjct: 1384 VTRHGFNRSSTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGAFDV 1443

Query: 1430 V 1430
            +
Sbjct: 1444 M 1444

>KLLA0F05071g Chr6 complement(496371..501533) [5163 bp, 1720 aa]
           {ON} highly similar to uniprot|P04050 Saccharomyces
           cerevisiae YDL140C
          Length = 1720

 Score =  553 bits (1425), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 352/936 (37%), Positives = 507/936 (54%), Gaps = 88/936 (9%)

Query: 11  KRISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGVSSSQAECSTC 70
           + I  ++F   S  ++   S  +I   +  D    +A K GG  D R+G      +C TC
Sbjct: 12  RTIKEVQFGLFSPEEVRGISVAKIEFPETMDESQMKA-KIGGLNDPRLGSIDRNYKCQTC 70

Query: 71  HGTLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNE--EDKRQFLSELR 128
              +A C GHFGHI+LA PVFH+G+     ++ +S+C +C KLLL+E  E  RQ + +++
Sbjct: 71  GEGMAECPGHFGHIELAKPVFHIGFLSKIKKVCESVCMHCGKLLLDEYNEQMRQAI-KIK 129

Query: 129 RPGIDNLRRMATLKKVLDQCKKQRRCLH----------------CGMLNXXXXXXXXXXX 172
            P     RR      V   CK +  C                  CG +            
Sbjct: 130 DPK----RR---FNAVWTLCKAKMVCETEVPSPDDPTVFLSRGGCGHIQP---------- 172

Query: 173 XXXLKIIHDTFRWVGKKSAPEKDKWIGDWNQVLQHSPELERYMKRTMENLNPLKTLNLFK 232
                I  D    VG         W  D N      PE     KR    ++  + LN+FK
Sbjct: 173 ----SIRKDGLSLVGT--------WKKDKNADDSDQPE-----KRI---ISAEEILNVFK 212

Query: 233 QISPQDCELLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEI 292
            ISP+D   LG +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I
Sbjct: 213 HISPEDGWRLGFNEDFS--RPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTYKLGDI 269

Query: 293 VWTSSLIKAGLEKGISINNMMEQWDYLQMAVAMYINSDSVNPALMPGGNGGGKTKPIRGF 352
           +  +  ++     G   + + E    LQ  VA Y+++D          +G    +PI+  
Sbjct: 270 LKANINVQKLEINGSPQHVIQESESLLQFHVATYMDNDIAGQPQAVQKSG----RPIKSI 325

Query: 353 CQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNK 412
             RLKGK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LT+PE VT YN 
Sbjct: 326 RARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIAKTLTYPEVVTPYNI 385

Query: 413 HKLQQLIVNGANVHPGANYLLKKNEEARRNLRYGDRIKLAKNLQIGDVVERHLEDGDVVL 472
            +L QL+ NG N HPGA Y+++++ + R +LRY  R    + LQ G  VERH+ D D VL
Sbjct: 386 DRLTQLVRNGPNEHPGAKYVIRESGD-RIDLRYSKRAGDIQ-LQYGWKVERHITDNDPVL 443

Query: 473 FNRQPSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAIN 532
           FNRQPSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   
Sbjct: 444 FNRQPSLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQ 503

Query: 533 LMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFVQMLSMMSDGNLQFD-- 590
           L  V   +++P+S +P +   QD + G   ++ +D+F +    + ML  + D    +D  
Sbjct: 504 LCAVPLQIVSPQSNKPCMGIVQDTLCGIRKMTLRDTFIELDQVLNMLYWIPD----WDGI 559

Query: 591 IPPPAIMRPHYLWTGKQLFSLLIKPNKKSPVIINLDAKNKVYIAPKNKAYPNEMSANDGY 650
           IP PAI++P  LW+GKQ+ S+ I PN    + +        +++PK+          +G 
Sbjct: 560 IPTPAILKPVPLWSGKQVLSMAI-PNG---IHLQRFDDGTTFLSPKD----------NGM 605

Query: 651 VVIRGSNILSGVMDKSVLGDGKKHSVFYTILRDFGPQEATQAMNRMAKLCARYLGNRGFS 710
           ++I G  I+ GV+DK  +G      + + + R+ GP+   +  + + K+   +L + GFS
Sbjct: 606 LIIDG-KIIFGVVDKKTVG-SSSGGLIHVVTREKGPEICARLFSNIQKVVNYWLLHNGFS 663

Query: 711 IGISDVTPGVELKATKEEMVEIAYAKCDELIDLYKRGKLETQPGCNEEQTLEAKIGGLLS 770
           IGI D     +      E + +A  K +++    +   L  + G    ++ E  +   L+
Sbjct: 664 IGIGDTIADEKTMREITEAIAVAKKKVEDVTKEAQANLLTAKHGMTLRESFEDNVVRYLN 723

Query: 771 KVREEVGDVCIRELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRS 830
           + R++ G      L +LN    M + GSKGS +N++QM A VGQQ + G R+  GF DR+
Sbjct: 724 EARDKAGRSAEVNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFADRT 783

Query: 831 LPHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMK 890
           LPHF K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K
Sbjct: 784 LPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVK 843

Query: 891 SLEDLSCQYDNTVRTSSNGIVQFTYGGDGLDPLNME 926
           +LED+   YD T R S   ++QF YG DG+D  ++E
Sbjct: 844 ALEDIMVHYDGTTRNSLGNVIQFIYGEDGMDAAHIE 879

 Score =  181 bits (460), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 135/399 (33%), Positives = 208/399 (52%), Gaps = 47/399 (11%)

Query: 1075 SKYRKAKVEPGTAVGAIGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKV 1134
            +++ ++ V PG  VG + A SIGEP TQMTL TFHFAGVAS  VT GVPR+KEI+N +K 
Sbjct: 1051 AQFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKN 1110

Query: 1135 ISTPIINATLVND--DDERAARVVKGRVEKTLLSDV-----IFYIQD----VYRDNMSFL 1183
            + TP +   L  +   D+  A+ ++  +E T L  V     I+Y  D    V  D+   +
Sbjct: 1111 MKTPSLTVYLDPEYAADQEKAKEIRSAIEHTTLKSVTVASEIYYDPDPRSTVIEDDEEII 1170

Query: 1184 QVKVDLATIEKLQLELTVEDIAIAITSAPKLKISTGDVSI--VGRNKININVCNDL---- 1237
            Q+   L   E+ +  L  +   +      +  ++  D+++  VG  KI     NDL    
Sbjct: 1171 QLHFSLMD-EETEKSLDYQSPWLLRLELDRAAMTDKDLTMGQVGE-KIKETFKNDLFVIW 1228

Query: 1238 --DKAKSI----------STLAS--EPHENDVFFKMQHLRRALPGIVVKGLPDISRAVIN 1283
              D A+ +           TL +  E  E+ +  K+++    L  I ++G+ DI+R V+ 
Sbjct: 1229 SEDNAEKLIIRCRVIRDPKTLDADVEAEEDHMLKKIEN--SMLEKITLRGVEDITRVVMM 1286

Query: 1284 IRD------DGKRE------LLVEGYGLRDVMTTDGVVGYKTKTNHFLEVYDVLGIEAAR 1331
              D       G+        L  +G  L +VMT  GV G +  TN F+++ +VLGIEA R
Sbjct: 1287 KYDRKVPSETGEYHKVPEWVLETDGVNLSEVMTVSGVDGSRIYTNSFIDIMNVLGIEAGR 1346

Query: 1332 TSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASFEKT 1391
             ++  E+   +++ G  V+ RH+ LL DVMT +G ++ +TR G ++     L   SFE+T
Sbjct: 1347 AALYREVYNVIASDGSYVNYRHMALLVDVMTSQGFLMSVTRHGFNRADTGALMRCSFEET 1406

Query: 1392 TDHLFDAAFYMKKDAVEGVSECIILGQTMTIGTGSFKVV 1430
             + LF+A    + D   GVSE +ILGQ   IGTG+F V+
Sbjct: 1407 VEILFEAGAAAELDDCRGVSENVILGQMAPIGTGAFDVM 1445

>ADR086C Chr4 complement(860406..865643) [5238 bp, 1745 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL140C
           (RPO21)
          Length = 1745

 Score =  553 bits (1425), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 349/929 (37%), Positives = 509/929 (54%), Gaps = 74/929 (7%)

Query: 11  KRISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGVSSSQAECSTC 70
           + I  ++F   S  ++ A S  +I   +  D    RA K GG  D R+G      +C TC
Sbjct: 12  RTIKEVQFGLFSPEEVRAISVAKIEFPETMDETQMRA-KVGGLNDPRLGSIDRNFKCQTC 70

Query: 71  HGTLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNEEDKRQFLSELRRP 130
              +  C GHFGHI+LA PVFH+G+     ++ + +C +C KLLL+E       +EL R 
Sbjct: 71  GEGMNDCPGHFGHIELAKPVFHIGFISKIKKVCECVCMHCGKLLLDE------YNELMRQ 124

Query: 131 GI---DNLRRMATLKKVLDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXLKIIHDTFRWVG 187
            I   D  RR      V   CK +  C                     +    D  +++ 
Sbjct: 125 AIKIKDPKRR---FNAVWSLCKAKMVC------------------DTEVPSEDDPSKYIS 163

Query: 188 K------KSAPEKD--KWIGDWNQVLQHSPELERYMKRTMENLNPLKTLNLFKQISPQDC 239
           +      + +  KD    +G W +  +++ + ++  KR    ++  + LN+FK ISP+D 
Sbjct: 164 RGGCGNAQPSIRKDGLSLVGTWKKD-KNAEDADQPEKRI---ISAEEILNVFKHISPEDS 219

Query: 240 ELLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLI 299
             LG +      RPE  +   LP PP  +RPS+   +S    EDDLT KL +I+  +  +
Sbjct: 220 WRLGFNEDFS--RPEWMLLTVLPVPPPPVRPSISFNES-QRGEDDLTYKLGDILKANINV 276

Query: 300 KAGLEKGISINNMMEQWDYLQMAVAMYINSDSVNPALMPGGNGGGKTKPIRGFCQRLKGK 359
           +     G   + + E    LQ  VA Y+++D          +G    +PI+    RLKGK
Sbjct: 277 QRLEINGSPQHVIQESESLLQFHVATYMDNDIAGQPQAVQKSG----RPIKSIRARLKGK 332

Query: 360 QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKHKLQQLI 419
           +GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LT+PE VT YN  +L QL+
Sbjct: 333 EGRIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLV 392

Query: 420 VNGANVHPGANYLLKKNEEARRNLRYGDRIKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 479
            NG N HPGA Y+++ N + R +LRY  R    + LQ G  VERH+ D D VLFNRQPSL
Sbjct: 393 RNGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDDDPVLFNRQPSL 450

Query: 480 HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 539
           H++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   
Sbjct: 451 HKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQ 510

Query: 540 LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFVQMLSMMSDGNLQFDIPPPAIMRP 599
           +++P+S +P +   QD + G   ++ +D+F +    + ML  + D +    IP P I++P
Sbjct: 511 IVSPQSNKPCMGIVQDTLCGIRKMTLRDTFIELDQVLNMLYWIPDWDGV--IPTPTILKP 568

Query: 600 HYLWTGKQLFSLLIKPNKKSPVIINLDA--KNKVYIAPKNKAYPNEMSANDGYVVIRGSN 657
             LW+GKQL S+ I      P  I+L    +   Y++PK+          +G ++I G  
Sbjct: 569 KPLWSGKQLLSMAI------PSGIHLQRFDEGTTYLSPKD----------NGMLIIDG-Q 611

Query: 658 ILSGVMDKSVLGDGKKHSVFYTILRDFGPQEATQAMNRMAKLCARYLGNRGFSIGISDVT 717
           I+ GV+DK  +G      + + + R+ GP+   +    + K+   +L + GFSIGI D  
Sbjct: 612 IIFGVVDKKTVGSSSG-GLIHVVTREKGPEVCAKLFGNIQKVVNYWLLHNGFSIGIGDTI 670

Query: 718 PGVELKATKEEMVEIAYAKCDELIDLYKRGKLETQPGCNEEQTLEAKIGGLLSKVREEVG 777
              +      + + +A  K +E+    +   L  + G    ++ E  +   L++ R++ G
Sbjct: 671 ADEKTMREITDAIALAKKKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRYLNEARDKAG 730

Query: 778 DVCIRELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKN 837
                 L +LN    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+
Sbjct: 731 RSAEVNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFADRTLPHFSKD 790

Query: 838 SKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSC 897
             +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+  
Sbjct: 791 DYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMV 850

Query: 898 QYDNTVRTSSNGIVQFTYGGDGLDPLNME 926
            YD T R S   I+QF YG DG+D  ++E
Sbjct: 851 HYDGTTRNSLGNIIQFVYGEDGMDAAHIE 879

 Score =  179 bits (453), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 133/399 (33%), Positives = 208/399 (52%), Gaps = 47/399 (11%)

Query: 1075 SKYRKAKVEPGTAVGAIGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKV 1134
            +++ ++ V PG  VG + A SIGEP TQMTL TFHFAGVAS  VT GVPR+KEI+N +K 
Sbjct: 1051 AQFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKN 1110

Query: 1135 ISTPIINATLVND--DDERAARVVKGRVEKTLLSDV-----IFYIQD----VYRDNMSFL 1183
            + TP +   L      D+  A++++  +E T L  V     I+Y  D    V  ++   +
Sbjct: 1111 MKTPSLTVYLEESYATDQEKAKLIRSAIEHTTLKSVPVASEIYYDPDPSSTVIEEDEEII 1170

Query: 1184 QVKVDLATIEKLQLELTVEDIAIAITSAPKLKISTGDVSI--VGRNKININVCNDL---- 1237
            Q+   L   E+ +  L  +   +      ++ ++  D+++  VG  KI     NDL    
Sbjct: 1171 QLHFSLMD-EETEASLKHQSPWLLRLELDRVAMTDKDLTMGQVGE-KIKETFKNDLFVIW 1228

Query: 1238 --DKAKSI----------STL--ASEPHENDVFFKMQHLRRALPGIVVKGLPDISRAVIN 1283
              D A+ +           TL   +E  E+ +  K+++    L  I ++G+ DI+R V+ 
Sbjct: 1229 SEDNAEKLIIRCRVVRDPKTLDAEAEAEEDHMLKKIENT--MLESITLRGVQDITRVVMM 1286

Query: 1284 IRD------DGKRE------LLVEGYGLRDVMTTDGVVGYKTKTNHFLEVYDVLGIEAAR 1331
              D       G+        L  +G  L +VM+  GV   +  TN F+++ +VLGIEA R
Sbjct: 1287 KYDRKVPSETGEYHKIPEWVLETDGVNLSEVMSVPGVDPTRIYTNSFIDIMNVLGIEAGR 1346

Query: 1332 TSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASFEKT 1391
             ++  E+   +++ G  V+ RH+ LL DVMT +G ++ +TR G ++     L   SFE+T
Sbjct: 1347 AALYKEVYNVIASDGSYVNYRHMALLVDVMTSQGFLMSVTRHGFNRADTGALMRCSFEET 1406

Query: 1392 TDHLFDAAFYMKKDAVEGVSECIILGQTMTIGTGSFKVV 1430
             + LF+A    + D   GVSE +ILGQ   IGTGSF V+
Sbjct: 1407 VEILFEAGAAAELDDCSGVSENVILGQMAPIGTGSFDVM 1445

>Smik_4.95 Chr4 complement(182198..187357) [5160 bp, 1719 aa] {ON}
           YDL140C (REAL)
          Length = 1719

 Score =  552 bits (1422), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 350/926 (37%), Positives = 508/926 (54%), Gaps = 68/926 (7%)

Query: 11  KRISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGVSSSQAECSTC 70
           + +  ++F   S  ++ A S  +I   +  D    RA K GG  D R+G      +C TC
Sbjct: 12  RTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNLKCQTC 70

Query: 71  HGTLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNEEDKRQFLSELRRP 130
              +  C GHFGHI LA PVFHVG+     ++ + +C +C KLLL+E +      EL R 
Sbjct: 71  QEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHN------ELMRQ 124

Query: 131 GI---DNLRRMATLKKVLDQCKKQRRCLH--CGMLNXXXXXXXXXXXXXXLKIIHDTFRW 185
            +   D+ +R A +  +   CK +  C        +                +  D  + 
Sbjct: 125 ALAIKDSKKRFAAIWTL---CKTKMVCETDVPSEDDPTQLVSRGGCGNTQPTVRKDGLKL 181

Query: 186 VGKKSAPEKDKWIGDWNQVLQHSPELERYMKRTMENLNPLKTLNLFKQISPQDCELLGID 245
           VG   + +KD+  GD  +     PEL          L+  + LN+FK IS +D   LG +
Sbjct: 182 VG---SWKKDRASGDAEE-----PELRV--------LSTEEILNIFKHISVKDFTSLGFN 225

Query: 246 STVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAGLEK 305
                 RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++     
Sbjct: 226 EVFS--RPEWMILTCLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETLEHN 282

Query: 306 GISINNMMEQWDYLQMAVAMYINSDSVNP--ALMPGGNGGGKTKPIRGFCQRLKGKQGRF 363
           G   + + E    LQ  VA Y+++D      AL   G      +P++    RLKGK+GR 
Sbjct: 283 GAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARLKGKEGRI 336

Query: 364 RGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKHKLQQLIVNGA 423
           RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LT+PE VT YN  +L QL+ NG 
Sbjct: 337 RGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGP 396

Query: 424 NVHPGANYLLKKNEEARRNLRYGDRIKLAKNLQIGDVVERHLEDGDVVLFNRQPSLHRLS 483
           N HPGA Y+++ + + R +LRY  R    + LQ G  VERH+ D D VLFNRQPSLH++S
Sbjct: 397 NEHPGAKYVIRDSGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQPSLHKMS 454

Query: 484 ILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTP 543
           +++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++P
Sbjct: 455 MMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSP 514

Query: 544 KSGEPIIAATQDFITGSYLISHKDSFFDRATFVQMLSMMSDGNLQFDIPPPAIMRPHYLW 603
           +S +P +   QD + G   ++ +D+F +    + ML  + D +    IP PAI++P  LW
Sbjct: 515 QSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGV--IPTPAIIKPKPLW 572

Query: 604 TGKQLFSLLIKPNKKSPVIINLDAKNKVYIAPKNKAYPNEMSANDGYVVIRGSNILSGVM 663
           +GKQ+ S+ I PN    + +    +    ++PK+          +G ++I G  I+ GV+
Sbjct: 573 SGKQILSVAI-PNG---IHLQRFDEGTTLLSPKD----------NGMLIIDG-QIIFGVV 617

Query: 664 DKSVLGDGKKHSVFYTILRDFGPQEATQAMNRMAKLCARYLGNRGFSIGISDVTPGVELK 723
           +K  +G      + + + R+ GPQ   +    + K+   +L + GFS GI D    +   
Sbjct: 618 EKKTVGSSNG-GLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHNGFSTGIGDT---IADG 673

Query: 724 ATKEEMVEIAYAKCDELIDLYKRGK---LETQPGCNEEQTLEAKIGGLLSKVREEVGDVC 780
            T  E+ E       +++D+ K  +   L  + G    ++ E  +   L++ R++ G + 
Sbjct: 674 PTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRLA 733

Query: 781 IRELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKT 840
              L +LN    M   GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +
Sbjct: 734 EVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYS 793

Query: 841 PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 900
           P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YD
Sbjct: 794 PESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYD 853

Query: 901 NTVRTSSNGIVQFTYGGDGLDPLNME 926
           NT R S   ++QF YG DG+D  ++E
Sbjct: 854 NTTRNSLGNVIQFIYGEDGMDAAHIE 879

 Score =  174 bits (441), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 129/412 (31%), Positives = 208/412 (50%), Gaps = 48/412 (11%)

Query: 1064 KLVRTFLDIAIS----KYRKAKVEPGTAVGAIGAHSIGEPGTQMTLKTFHFAGVASMNVT 1119
            +L +   D  +S    ++ ++ V PG  VG + A SIGEP TQMTL TFHFAGVAS  VT
Sbjct: 1036 RLTKQAFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVT 1095

Query: 1120 LGVPRIKEIINASKVISTPIINATLV--NDDDERAARVVKGRVEKTLLSDV-----IFYI 1172
             GVPR+KEI+N +K + TP +   L   +  D+  A++++  +E T L  V     I+Y 
Sbjct: 1096 SGVPRLKEILNVAKNMKTPSLTVYLEPGHAADQEQAKLIRSAIEHTTLKSVTIASEIYYD 1155

Query: 1173 QD----VYRDNMSFLQVKVDLATIEK-----------LQLEL-----TVEDIAIAITSAP 1212
             D    V  ++   +Q+   L   E            L+LEL       +D+ +      
Sbjct: 1156 PDPRSTVIPEDEEIIQLHFSLLDDEAEQSFDQQSPWLLRLELDRAAMNDKDLTMGQVGER 1215

Query: 1213 KLKISTGDVSIVGR--NKININVCNDLDKAKSISTLASEPHENDVFFKMQHLRRALPGIV 1270
              +    D+ ++    N   + +   + + KS+    +E  E+ +  K+++    L  I 
Sbjct: 1216 IKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDA-ETEAEEDHMLKKIENT--MLENIT 1272

Query: 1271 VKGLPDISRAVINIRD------------DGKRELLVEGYGLRDVMTTDGVVGYKTKTNHF 1318
            ++G+ +I R V+   D            + +  L  +G  L +VMT  G+   +  TN F
Sbjct: 1273 LRGVENIERVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDATRIYTNSF 1332

Query: 1319 LEVYDVLGIEAARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1378
            +++ +VLGIEA R ++  E+   +++ G  V+ RH+ LL DVMT +G +  +TR G ++ 
Sbjct: 1333 IDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGLTSVTRHGFNRS 1392

Query: 1379 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMTIGTGSFKVV 1430
                L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTG+F V+
Sbjct: 1393 NTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGAFDVM 1444

>Suva_4.104 Chr4
           complement(193257..193711,193754..193782,194161..198878)
           [5202 bp, 1733 aa] {ON} YDL140C (REAL)
          Length = 1733

 Score =  551 bits (1420), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 350/926 (37%), Positives = 506/926 (54%), Gaps = 68/926 (7%)

Query: 11  KRISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGVSSSQAECSTC 70
           + +  ++F   S  ++ A S  +I   +  D    RA K GG  D R+G      +C TC
Sbjct: 12  RTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNLKCQTC 70

Query: 71  HGTLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNEEDKRQFLSELRRP 130
              +  C GHFGHI LA PVFHVG+     ++ + +C +C KLLL+E +      EL R 
Sbjct: 71  QEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHN------ELMRQ 124

Query: 131 GI---DNLRRMATLKKVLDQCKKQRRC-LHCGMLNXXXXXXXXXXXXXXLKIIH-DTFRW 185
            +   D  +R   +  +   CK +  C       N                 +  D  + 
Sbjct: 125 ALAIKDTKKRFGAIWTL---CKTKMVCETDVPSENDPTQLVSRGGCGNTQPTVRKDGLKL 181

Query: 186 VGKKSAPEKDKWIGDWNQVLQHSPELERYMKRTMENLNPLKTLNLFKQISPQDCELLGID 245
           VG   + +KD+  GD ++     PEL          L+  + LN+FK IS +D   LG +
Sbjct: 182 VG---SWKKDRATGDADE-----PELRV--------LSTEEILNIFKHISAKDSSSLGFN 225

Query: 246 STVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAGLEK 305
                 RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++     
Sbjct: 226 EVFS--RPEWMILTCLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETLEHN 282

Query: 306 GISINNMMEQWDYLQMAVAMYINSDSVNP--ALMPGGNGGGKTKPIRGFCQRLKGKQGRF 363
           G   + + E    LQ  VA Y+++D      AL   G      +P++    RLKGK+GR 
Sbjct: 283 GAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARLKGKEGRI 336

Query: 364 RGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKHKLQQLIVNGA 423
           RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LT+PE VT YN  +L QL+ NG 
Sbjct: 337 RGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGP 396

Query: 424 NVHPGANYLLKKNEEARRNLRYGDRIKLAKNLQIGDVVERHLEDGDVVLFNRQPSLHRLS 483
           N HPGA Y+++ + + R +LRY  R    + LQ G  VERH+ D D VLFNRQPSLH++S
Sbjct: 397 NEHPGAKYVIRDSGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQPSLHKMS 454

Query: 484 ILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTP 543
           +++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++P
Sbjct: 455 MMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSP 514

Query: 544 KSGEPIIAATQDFITGSYLISHKDSFFDRATFVQMLSMMSDGNLQFDIPPPAIMRPHYLW 603
           +S +P +   QD + G   ++ +D+F +    + ML  + D +    IP PAI++P  LW
Sbjct: 515 QSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGV--IPTPAIIKPKPLW 572

Query: 604 TGKQLFSLLIKPNKKSPVIINLDAKNKVYIAPKNKAYPNEMSANDGYVVIRGSNILSGVM 663
           +GKQ+ S+ I PN    + +    +    ++PK+          +G ++I G  I+ GV+
Sbjct: 573 SGKQVLSVAI-PNG---IHLQRFDEGTTLLSPKD----------NGMLIIDG-QIVFGVV 617

Query: 664 DKSVLGDGKKHSVFYTILRDFGPQEATQAMNRMAKLCARYLGNRGFSIGISDVTPGVELK 723
           +K  +G      + + + R+ GPQ   +    + K+   +L + GFS GI D    +   
Sbjct: 618 EKKTVGSSNG-GLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHNGFSTGIGDT---IADG 673

Query: 724 ATKEEMVEIAYAKCDELIDLYKRGK---LETQPGCNEEQTLEAKIGGLLSKVREEVGDVC 780
            T  E+ E       ++ D+ K  +   L  + G    ++ E  +   L++ R++ G + 
Sbjct: 674 PTMREITETIADAKKKVFDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRLA 733

Query: 781 IRELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKT 840
              L +LN    M   GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +
Sbjct: 734 EVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAYGFVDRTLPHFSKDDYS 793

Query: 841 PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 900
           P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YD
Sbjct: 794 PESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYD 853

Query: 901 NTVRTSSNGIVQFTYGGDGLDPLNME 926
           NT R S   ++QF YG DG+D  ++E
Sbjct: 854 NTTRNSLGNVIQFIYGEDGMDASHIE 879

 Score =  173 bits (439), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 130/419 (31%), Positives = 210/419 (50%), Gaps = 44/419 (10%)

Query: 1053 KSVNQLCKISSKLVRTFLDIAISKYRKAKVEPGTAVGAIGAHSIGEPGTQMTLKTFHFAG 1112
            + V Q  K++ +     L    +++ ++ V PG  VG + A SIGEP TQMTL TFHFAG
Sbjct: 1029 RRVIQEYKLTKQAFEWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAG 1088

Query: 1113 VASMNVTLGVPRIKEIINASKVISTPIINATLV--NDDDERAARVVKGRVEKTLLSDV-- 1168
            VAS  VT GVPR+KEI+N +K + TP +   L   +  D+  A+ ++  +E T L  V  
Sbjct: 1089 VASKKVTSGVPRLKEILNVAKNMKTPSLTVYLEPGHAADQEKAKFIRSAIEHTTLKSVTI 1148

Query: 1169 ---IFYIQD----VYRDNMSFLQVKVDLATIEK-----------LQLEL-----TVEDIA 1205
               I+Y  D    V  ++   +Q+   L   E            L+LEL       +D+ 
Sbjct: 1149 ASEIYYDPDPRSTVIPEDEEIIQLHFSLLDDEAEQSFDQQSPWLLRLELDRAAMNDKDLT 1208

Query: 1206 IAITSAPKLKISTGDVSIVGR--NKININVCNDLDKAKSISTLASEPHENDVFFKMQHLR 1263
            +        +    D+ ++    N   + +   + + KS+    +E  E+ +  K+++  
Sbjct: 1209 MGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDA-ETEAEEDHMLKKIENT- 1266

Query: 1264 RALPGIVVKGLPDISRAVINIRD------------DGKRELLVEGYGLRDVMTTDGVVGY 1311
              L  I ++G+ +I R V+   D            + +  L  +G  L +VMT  G+   
Sbjct: 1267 -MLENITLRGVENIERVVMMKYDRKVPSPTGEYIKEPEWVLETDGVNLSEVMTVPGIDPT 1325

Query: 1312 KTKTNHFLEVYDVLGIEAARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGIT 1371
            +  TN F+++ +VLGIEA R ++  E+   +++ G  V+ RH+ LL DVMT +G +  +T
Sbjct: 1326 RIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGLTSVT 1385

Query: 1372 RFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMTIGTGSFKVV 1430
            R G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTG+F V+
Sbjct: 1386 RHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGAFDVM 1444

>Skud_4.114 Chr4 complement(201053..206233) [5181 bp, 1726 aa] {ON}
           YDL140C (REAL)
          Length = 1726

 Score =  547 bits (1410), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 351/926 (37%), Positives = 507/926 (54%), Gaps = 68/926 (7%)

Query: 11  KRISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGVSSSQAECSTC 70
           + +  ++F   S  ++ A S  +I   +  D    RA K GG  D R+G      +C TC
Sbjct: 12  RTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNLKCQTC 70

Query: 71  HGTLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNEEDKRQFLSELRRP 130
              +  C GHFGHI LA PVFHVG+     ++ + +C +C KLLL+E +      EL R 
Sbjct: 71  QEGMNECPGHFGHIDLAKPVFHVGFIAKIKKLCECVCMHCGKLLLDEHN------ELMRQ 124

Query: 131 GI---DNLRRMATLKKVLDQCKKQRRC-LHCGMLNXXXXXXXXXXXXXXLKIIH-DTFRW 185
            +   D+ +R A +  +   CK +  C       N                 +  D  + 
Sbjct: 125 ALAIKDSKKRFAAIWTL---CKTKMVCETDVPSENDPTQLVSRGGCGNTQPTVRKDGLKL 181

Query: 186 VGKKSAPEKDKWIGDWNQVLQHSPELERYMKRTMENLNPLKTLNLFKQISPQDCELLGID 245
           VG   + +KD+  GD ++     PEL          L+  + LN+FK IS +D   LG +
Sbjct: 182 VG---SWKKDRASGDADE-----PELRV--------LSTEEILNIFKHISVEDFTSLGFN 225

Query: 246 STVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAGLEK 305
                 RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++     
Sbjct: 226 EVFS--RPEWMILTCLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETLEHN 282

Query: 306 GISINNMMEQWDYLQMAVAMYINSDSVNP--ALMPGGNGGGKTKPIRGFCQRLKGKQGRF 363
           G   + + E    LQ  VA Y+++D      AL   G      +P++    RLKGK+GR 
Sbjct: 283 GAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARLKGKEGRI 336

Query: 364 RGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKHKLQQLIVNGA 423
           RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LT+PE VT YN  +L QL+ NG 
Sbjct: 337 RGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGP 396

Query: 424 NVHPGANYLLKKNEEARRNLRYGDRIKLAKNLQIGDVVERHLEDGDVVLFNRQPSLHRLS 483
           N HPGA Y+++ + + R +LRY  R    + LQ G  VERH+ D D VLFNRQPSLH++S
Sbjct: 397 NEHPGAKYVIRDSGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQPSLHKMS 454

Query: 484 ILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTP 543
           +++H   + P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++P
Sbjct: 455 MMAHRVIVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSP 514

Query: 544 KSGEPIIAATQDFITGSYLISHKDSFFDRATFVQMLSMMSDGNLQFDIPPPAIMRPHYLW 603
           +S +P +   QD + G   ++ +D+F +    + ML  + D +    IP PAI++P  LW
Sbjct: 515 QSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGV--IPTPAIIKPKPLW 572

Query: 604 TGKQLFSLLIKPNKKSPVIINLDA--KNKVYIAPKNKAYPNEMSANDGYVVIRGSNILSG 661
           +GKQ+ S  I      P  I+L    +    ++PK+          +G ++I G  I+ G
Sbjct: 573 SGKQVLSAAI------PSGIHLQRFDEGTTLLSPKD----------NGMLIIDG-QIVFG 615

Query: 662 VMDKSVLGDGKKHSVFYTILRDFGPQEATQAMNRMAKLCARYLGNRGFSIGISD-VTPGV 720
           V++K  +G      + + + R+ GPQ   +    + K+   +L + GFS GI D +  G 
Sbjct: 616 VVEKKTVGSSNG-GLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGP 674

Query: 721 ELKATKEEMVEIAYAKCDELIDLYKRGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVC 780
            ++   E + E A  K  ++    +   L  + G    ++ E  +   L++ R++ G + 
Sbjct: 675 TMREITETIAE-AKKKVFDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRLA 733

Query: 781 IRELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKT 840
              L +LN    M   GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +
Sbjct: 734 EVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYS 793

Query: 841 PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 900
           P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YD
Sbjct: 794 PESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYD 853

Query: 901 NTVRTSSNGIVQFTYGGDGLDPLNME 926
           NT R S   ++QF YG DG+D  ++E
Sbjct: 854 NTTRNSLGNVIQFIYGEDGMDAAHIE 879

 Score =  173 bits (438), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 126/397 (31%), Positives = 203/397 (51%), Gaps = 44/397 (11%)

Query: 1075 SKYRKAKVEPGTAVGAIGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKV 1134
            +++ ++ V PG  VG + A SIGEP TQMTL TFHFAGVAS  VT GVPR+KEI+N +K 
Sbjct: 1051 AQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKN 1110

Query: 1135 ISTPIINATLV--NDDDERAARVVKGRVEKTLLSDV-----IFYIQD----VYRDNMSFL 1183
            + TP +   L   +  D+  A++++  +E T L  V     I+Y  D    V  ++   +
Sbjct: 1111 MKTPSLTVYLEPGHAADQEQAKLIRSAIEHTTLKSVTIASEIYYDPDPRSTVIPEDEEII 1170

Query: 1184 QVKVDLATIEK-----------LQLEL-----TVEDIAIAITSAPKLKISTGDVSIVGR- 1226
            Q+   L   E            L+LEL       +D+ +        +    D+ ++   
Sbjct: 1171 QLHFSLLDDEAEQSFDQQSPWLLRLELDRAAMNDKDLTMGQVGERIKQTFKNDLFVIWSE 1230

Query: 1227 -NKININVCNDLDKAKSISTLASEPHENDVFFKMQHLRRALPGIVVKGLPDISRAVINIR 1285
             N   + +   + + KS+    +E  E+ +  K+++    L  I ++G+ +I R V+   
Sbjct: 1231 DNDEKLIIRCRVVRPKSLDA-ETEAEEDHMLKKIENT--MLENITLRGVENIERVVMMKY 1287

Query: 1286 D------------DGKRELLVEGYGLRDVMTTDGVVGYKTKTNHFLEVYDVLGIEAARTS 1333
            D            + +  L  +G  L +VMT  G+   +  TN F+++ +VLGIEA R +
Sbjct: 1288 DRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDPTRIYTNSFIDIMEVLGIEAGRAA 1347

Query: 1334 IIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASFEKTTD 1393
            +  E+   +++ G  V+ RH+ LL DVMT +G +  +TR G ++     L   SFE+T +
Sbjct: 1348 LYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSNTGALMRCSFEETVE 1407

Query: 1394 HLFDAAFYMKKDAVEGVSECIILGQTMTIGTGSFKVV 1430
             LF+A    + D   GVSE +ILGQ   IGTG+F V+
Sbjct: 1408 ILFEAGASAELDDCRGVSENVILGQMAPIGTGAFDVM 1444

>TDEL0C02320 Chr3 complement(403851..409034) [5184 bp, 1727 aa] {ON}
           Anc_7.314 YDL140C
          Length = 1727

 Score =  547 bits (1410), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 345/925 (37%), Positives = 501/925 (54%), Gaps = 60/925 (6%)

Query: 11  KRISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGVSSSQAECSTC 70
           + +  ++F   S  ++ A S  +I   +  D    RA K GG  D R+G      +C TC
Sbjct: 12  RTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNLKCQTC 70

Query: 71  HGTLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNEEDKRQFLSELRRP 130
              +  C GHFGHI LA PVFH+G+     ++ + +C +C KLLL++ +++   +   + 
Sbjct: 71  QEGMNECPGHFGHIDLAKPVFHIGFITKIKKVCECVCMHCGKLLLDDHNEQMRQACKIKD 130

Query: 131 GIDNLRRMATLKKVLDQCKKQRRCLH--CGMLNXXXXXXXXXXXXXXLKIIHDTFRWVGK 188
                  + TL      CK +  C        +                +  D  + VG 
Sbjct: 131 SKKRFNAIWTL------CKTKMICESDVPSEEDPTKLISRGGCGNAQPTVRKDGLKLVG- 183

Query: 189 KSAPEKDKWIGDWNQVLQHSPELERYMKRTMENLNPLKTLNLFKQISPQDCELLGIDSTV 248
             + +K+K  GD        PE       TME +     LN+FK IS +D   LG +   
Sbjct: 184 --SWKKEKNTGD--------PEEPEQRILTMEEI-----LNIFKHISKEDSNRLGFNE-- 226

Query: 249 KAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAGLEKGIS 308
           +  RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++     G  
Sbjct: 227 EFARPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETLEHNGAP 285

Query: 309 INNMMEQWDYLQMAVAMYINSDSVNP--ALMPGGNGGGKTKPIRGFCQRLKGKQGRFRGN 366
            + + E    LQ  VA Y+++D      AL   G      +P++    RLKGK+GR RGN
Sbjct: 286 HHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARLKGKEGRIRGN 339

Query: 367 LSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKHKLQQLIVNGANVH 426
           L GKRVDFS RTVIS DPNL +D+V VP  +AK LT+PE VT YN  +L  L+ NG N H
Sbjct: 340 LMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTFLVRNGPNEH 399

Query: 427 PGANYLLKKNEEARRNLRYGDRIKLAKNLQIGDVVERHLEDGDVVLFNRQPSLHRLSILS 486
           PGA Y+++ N + R +LRY  R    + LQ G  VERH+ D D VLFNRQPSLH++S+++
Sbjct: 400 PGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQPSLHKMSMMA 457

Query: 487 HYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPKSG 546
           H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++P+S 
Sbjct: 458 HRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSN 517

Query: 547 EPIIAATQDFITGSYLISHKDSFFDRATFVQMLSMMSDGNLQFDIPPPAIMRPHYLWTGK 606
           +P +   QD + G   ++ +D+F +    + ML  + D +    IP PAI++P  LWTGK
Sbjct: 518 KPCMGIVQDTLCGIRKLTLRDNFIELDQVLNMLYWVPDWDGV--IPTPAIIKPKPLWTGK 575

Query: 607 QLFSLLIKPNKKSPVIINLDA--KNKVYIAPKNKAYPNEMSANDGYVVIRGSNILSGVMD 664
           Q+ S+ I      P  I+L    +    ++PK+          +G ++I G  I+ GV+D
Sbjct: 576 QILSIAI------PKGIHLQRFDEGTTLLSPKD----------NGMLIIDG-KIIFGVVD 618

Query: 665 KSVLGDGKKHSVFYTILRDFGPQEATQAMNRMAKLCARYLGNRGFSIGISDVTPGVELKA 724
           K  +G      + + + R+ GPQ   +    + K+   +  + GFS GI D     +   
Sbjct: 619 KKTVGSSSG-GLIHVVTREKGPQICARLFGNIQKVVNYWFLHNGFSTGIGDTIADGQTMR 677

Query: 725 TKEEMVEIAYAKCDELIDLYKRGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVCIREL 784
              E +  A  K +++    +   L  + G    ++ E  +   L++ R++ G +    L
Sbjct: 678 EITETIADAKKKVEDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRLAEVNL 737

Query: 785 DNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSK 844
            +LN    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +P+SK
Sbjct: 738 KDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESK 797

Query: 845 GFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVR 904
           GFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YD+T R
Sbjct: 798 GFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDSTTR 857

Query: 905 TSSNGIVQFTYGGDGLDPLNMEGNA 929
            S   ++QF YG DG+D  ++E  A
Sbjct: 858 NSLGNVIQFVYGEDGMDASHIEKQA 882

 Score =  156 bits (395), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 122/382 (31%), Positives = 195/382 (51%), Gaps = 39/382 (10%)

Query: 1076 KYRKAKVEPGTAVGAIGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVI 1135
            ++ ++ V PG  VG + A SIGEP TQMTL TFHFAGVAS  VT GVPR+      +K I
Sbjct: 1052 QFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLXXXXEKAKFI 1111

Query: 1136 STPIINATLVN---------DDDERAARVVKG----RVEKTLLSDVIFYIQDVYRDNMSF 1182
             + I + TL +         D D R+  + +     ++  +LL D      D  + +   
Sbjct: 1112 RSAIEHTTLKSVTVASEIYYDPDPRSTVIAEDEEIIQLHFSLLDDETEKSLD--QQSPWL 1169

Query: 1183 LQVKVDLATIEKLQLELTVEDIAIAITSAPKLKISTGDVSIVGR--NKININVCNDLDKA 1240
            L++++D A +     +LT+  +   I    K      D+ ++    N   + +   + + 
Sbjct: 1170 LRLELDRAAMN--DKDLTMGQVGEKIKETFK-----NDLFVIWSEDNAEKLIIRCRVVRP 1222

Query: 1241 KSISTLASEPHENDVFFKMQHLRRALPGIVVKGLPDISRAVINIRD------DGKRE--- 1291
            KS+  + +E  E+ +  K+++    L  I ++G+ +I R V+   D       G+     
Sbjct: 1223 KSMD-IETEAEEDHMLKKIENT--MLENITLRGVENIERVVMMKYDRKVPSATGEYHKVP 1279

Query: 1292 ---LLVEGYGLRDVMTTDGVVGYKTKTNHFLEVYDVLGIEAARTSIIDEIDYTMSNHGMS 1348
               L  +G  L +VMT  GV   +  TN F+++ +VLGIEA R ++  E+   +++ G  
Sbjct: 1280 EWVLETDGVNLSEVMTVPGVDSKRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSY 1339

Query: 1349 VDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVE 1408
            V+ RH+ LL DVMT +G +  +TR G ++     L   SFE+T + LF+A    + D   
Sbjct: 1340 VNYRHMALLVDVMTTQGGLTSVTRHGFNRSATGALMRCSFEETVEILFEAGACAEMDDCR 1399

Query: 1409 GVSECIILGQTMTIGTGSFKVV 1430
            GVSE +ILGQ   IGTGSF V+
Sbjct: 1400 GVSENVILGQMAPIGTGSFDVM 1421

>TBLA0F02170 Chr6 (535350..540530) [5181 bp, 1726 aa] {ON} Anc_7.314
           YDL140C
          Length = 1726

 Score =  546 bits (1407), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 348/932 (37%), Positives = 506/932 (54%), Gaps = 80/932 (8%)

Query: 11  KRISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGVSSSQAECSTC 70
           + I  ++F   S  +I A S  +I   +  D    RA K GG  D R+G      +C TC
Sbjct: 12  RTIKEVQFGLFSPEEIRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNLKCQTC 70

Query: 71  HGTLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNE--EDKRQFLSELR 128
              +  C GHFGHI LA PVFH+G+     ++ + IC +C KLLL+E  E  RQ L +++
Sbjct: 71  QEGMNECPGHFGHIDLAKPVFHIGFISKIKKVCECICMHCGKLLLDEHNEQMRQIL-KIK 129

Query: 129 RPGIDNLRRMATLKKVLDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXLKIIHDTFRWVGK 188
               D+ +R      +   CK +  C                     +   HD  + V +
Sbjct: 130 ----DSKKR---FNAIWSLCKTKMIC------------------DTDVPSEHDPTQLVSR 164

Query: 189 ------KSAPEKD--KWIGDWNQVLQHSP--ELERYMKRTMENLNPLKTLNLFKQISPQD 238
                 +    KD  K +G W +    S   E E+ +  T E       LN+FK ISP+D
Sbjct: 165 GGCGNAQPTVRKDGLKLVGSWKKEKNTSDGDEPEQRILSTEE------ILNIFKHISPED 218

Query: 239 CELLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSL 298
              +G +   +  RPE      LP PP  +RPS+   +S    EDDLT KL +I+  +  
Sbjct: 219 SIAMGFNE--EFSRPEWMFLTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANIS 275

Query: 299 IKAGLEKGISINNMMEQWDYLQMAVAMYINSDSVNP--ALMPGGNGGGKTKPIRGFCQRL 356
           ++     G   + + E    LQ  VA Y+++D      AL   G      +P++    RL
Sbjct: 276 LETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARL 329

Query: 357 KGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKHKLQ 416
           KGK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LT+PE VT YN  +L 
Sbjct: 330 KGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLT 389

Query: 417 QLIVNGANVHPGANYLLKKNEEARRNLRYGDRIKLAKNLQIGDVVERHLEDGDVVLFNRQ 476
            L+ NG N HPGA Y+++ N + R +LRY  R    + LQ G  VERH+ D D VLFNRQ
Sbjct: 390 HLVRNGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQ 447

Query: 477 PSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGV 536
           PSLH++S+++H  ++ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V
Sbjct: 448 PSLHKMSMMAHRVRVMPFSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAV 507

Query: 537 KNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFVQMLSMMSDGNLQFDIPPPAI 596
              +++ +S +P +   QD + G   ++ +D+F +    + +L  + D +    IP PAI
Sbjct: 508 PLQIVSAQSNKPCMGIVQDTLCGIRKLTLRDNFIEFDQVLNLLYWVPDWDGV--IPTPAI 565

Query: 597 MRPHYLWTGKQLFSLLIKPNKKSPVIINLDA--KNKVYIAPKNKAYPNEMSANDGYVVIR 654
           ++P  LW+GKQ+ S+ I      P  I+L    +   +++PK+          +G ++I 
Sbjct: 566 LKPKPLWSGKQILSIAI------PKGIHLQRFDEGTTFLSPKD----------NGMLIID 609

Query: 655 GSNILSGVMDKSVLGDGKKHSVFYTILRDFGPQEATQAMNRMAKLCARYLGNRGFSIGIS 714
           G  I+ GV+DK  +G      + + + R+ GPQ   +  + + K+   +  + GFS GI 
Sbjct: 610 G-QIIFGVVDKKTVGSSSG-GLIHVVTREKGPQICAKLFSNIQKVTNYWFLHNGFSTGIG 667

Query: 715 DVTPGVELKATKEEMVEIAYAKCDELIDLYKRGKLETQPGCNEEQTLEAKIGGLLSKVRE 774
           D     E        +  A  K +E+    +   L  + G    ++ E  +   L++ R+
Sbjct: 668 DTIADGETMREITGTIAEAKRKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARD 727

Query: 775 EVGDVCIRELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF 834
           + G +    L++ N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF
Sbjct: 728 KAGRLAEVNLNDTNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHF 787

Query: 835 PKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLED 894
            K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED
Sbjct: 788 SKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALED 847

Query: 895 LSCQYDNTVRTSSNGIVQFTYGGDGLDPLNME 926
           +   YD+T R S   ++QF YG DG+D  ++E
Sbjct: 848 IMVHYDSTTRNSLGNVIQFVYGEDGIDAGHIE 879

 Score =  180 bits (457), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 138/421 (32%), Positives = 212/421 (50%), Gaps = 46/421 (10%)

Query: 1052 VKSVNQLCKISSKLVRTFLDIAISKYRKAKVEPGTAVGAIGAHSIGEPGTQMTLKTFHFA 1111
             + V Q  K++ +  +  L+   +++ ++ V PG  VG + A SIGEP TQMTL TFHFA
Sbjct: 1028 TRRVLQEFKLNKQSFQWVLNNVEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFA 1087

Query: 1112 GVASMNVTLGVPRIKEIINASKVISTPIINATL--VNDDDERAARVVKGRVEKTLLSDVI 1169
            GVAS  VT GVPR+KEI+N +K + TP + A L      D+  A++++  +E T L  V 
Sbjct: 1088 GVASKKVTSGVPRLKEILNVAKNMKTPSLTAYLEPAYAADQEKAKLIRSAIEHTTLKSVT 1147

Query: 1170 FYIQDVYRDNMSFLQVKVDLATIEKLQLELTVEDIAIAI-TSAPKL--------KISTGD 1220
                ++Y D      V  +   I +L   L  E+   ++   +P L         ++  D
Sbjct: 1148 V-ASEIYYDPDPRTTVIAEDEEIMQLHFSLMDEETEKSLDQQSPWLLRLELDRAAMNDKD 1206

Query: 1221 VSI--VGRNKININVCNDL------DKAKSIST-----------LASEPHENDVFFKMQH 1261
            +++  VG  KI     NDL      D A+ +               +E  E+ +  K+++
Sbjct: 1207 LTMGQVGE-KIRETFRNDLFVIWSEDNAEKLIIRCRVVRPKALDAETEAEEDHMLKKIEN 1265

Query: 1262 LRRALPGIVVKGLPDISRAVINIRD------DGKRE------LLVEGYGLRDVMTTDGVV 1309
                L  I ++G+ +I R V+   D       G  E      L  +G  L +VMT  GV 
Sbjct: 1266 T--MLENITLRGVENIERVVMMKYDRKIPGTSGAYEKVPEWVLETDGVNLLEVMTVPGVD 1323

Query: 1310 GYKTKTNHFLEVYDVLGIEAARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLG 1369
              +  TN F+++ +VLGIEA R ++  E+   +++ G  V+ RH+ LL DVMT  G +  
Sbjct: 1324 ASRIYTNSFIDITEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTNGSLTS 1383

Query: 1370 ITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMTIGTGSFKV 1429
            +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTGSF V
Sbjct: 1384 VTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGSFDV 1443

Query: 1430 V 1430
            +
Sbjct: 1444 M 1444

>NDAI0A02130 Chr1 complement(477808..482997) [5190 bp, 1729 aa] {ON}
           Anc_7.314
          Length = 1729

 Score =  546 bits (1407), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 347/925 (37%), Positives = 507/925 (54%), Gaps = 66/925 (7%)

Query: 11  KRISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGVSSSQAECSTC 70
           + +  ++F   S  ++ A S  +I   +  D    RA K GG  D R+G      +C TC
Sbjct: 12  RTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNLKCQTC 70

Query: 71  HGTLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNEEDKRQFLSELRRP 130
              +  C GHFGHI LA PV HVG+     ++ +S+C +C KLLL+E +      E  R 
Sbjct: 71  QEGMNECPGHFGHIDLAKPVLHVGFIAKIKKVCESVCMHCGKLLLDEHN------EQMRQ 124

Query: 131 GIDNLRRMATLKKVLDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXLKIIHDTFRWVGKKS 190
            I           V + CK +  C                      ++I    R     +
Sbjct: 125 AIAIKDSKKRFNAVWNLCKTKMIC-----------DTDVPSDDDPTQLIS---RGGCGNA 170

Query: 191 AP--EKD--KWIGDWNQVLQHSPELERYMKRTMENLNPLKTLNLFKQISPQDCELLGIDS 246
            P   KD  K +G W +  +++ + +   +R    L+  + LN+FK ISP+D   LG + 
Sbjct: 171 QPTVRKDGLKLVGSWKKE-KNTNDGDEPEQRV---LSTEEILNIFKHISPEDSTRLGFNE 226

Query: 247 TVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAGLEKG 306
             +  RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++     G
Sbjct: 227 --EFARPEWMILNVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETLEHNG 283

Query: 307 ISINNMMEQWDYLQMAVAMYINSDSVNP--ALMPGGNGGGKTKPIRGFCQRLKGKQGRFR 364
              + + E    LQ  VA Y+++D      AL   G      +P++    RLKGK+GR R
Sbjct: 284 APHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARLKGKEGRIR 337

Query: 365 GNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKHKLQQLIVNGAN 424
           GNL GKRVDFS RTVIS DPNL +D+V VP  +A+ LT+PE VT YN  +L QL+ NG N
Sbjct: 338 GNLMGKRVDFSARTVISGDPNLELDQVGVPKSIARTLTYPEVVTPYNIDRLTQLVRNGPN 397

Query: 425 VHPGANYLLKKNEEARRNLRYGDRIKLAKNLQIGDVVERHLEDGDVVLFNRQPSLHRLSI 484
            HPGA Y+++ N + R +LRY  R    + LQ G  VERH+ D D VLFNRQPSLH++S+
Sbjct: 398 EHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHITDNDPVLFNRQPSLHKMSM 455

Query: 485 LSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPK 544
           ++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++ +
Sbjct: 456 MAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSAQ 515

Query: 545 SGEPIIAATQDFITGSYLISHKDSFFDRATFVQMLSMMSDGNLQFDIPPPAIMRPHYLWT 604
           S +P +   QD + G   ++ +D+F +    + ML  + D +    IP PAI++P  LW+
Sbjct: 516 SNKPCMGIVQDTLCGIRKLTLRDTFLEFDEVLNMLYWVPDWDGV--IPTPAIIKPKPLWS 573

Query: 605 GKQLFSLLIKPNKKSPVIINLDA--KNKVYIAPKNKAYPNEMSANDGYVVIRGSNILSGV 662
           GKQ+ S+ I      P  I+L    +    ++PK+          +G +V+ G  I+ GV
Sbjct: 574 GKQVLSIAI------PRGIHLQRFDEGTTLLSPKD----------NGMLVVDG-QIIFGV 616

Query: 663 MDKSVLGDGKKHSVFYTILRDFGPQEATQAMNRMAKLCARYLGNRGFSIGISD-VTPGVE 721
           +DK  +G      + + + R+ GP    +    + K+   +L + GFS GI D +  G  
Sbjct: 617 VDKKTVG-SSNGGLIHVVTREKGPTICAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGST 675

Query: 722 LKATKEEMVEIAYAKCDELIDLYKRGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVCI 781
           +K   E + + A  K +++    +   L  + G    ++ E  +   L++ R++ G +  
Sbjct: 676 IKEITETIAD-AKRKVEDVTKEAQSNLLTAKHGMTLRESFEDNVVRFLNEARDKAGRLAE 734

Query: 782 RELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTP 841
             L++LN    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +P
Sbjct: 735 MNLNDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIGYGFVDRTLPHFSKDDYSP 794

Query: 842 QSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDN 901
           +SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YD 
Sbjct: 795 ESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDG 854

Query: 902 TVRTSSNGIVQFTYGGDGLDPLNME 926
           T R S   ++QF YG DG+D  ++E
Sbjct: 855 TARNSLGNVIQFIYGEDGMDAAHIE 879

 Score =  177 bits (449), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 132/423 (31%), Positives = 215/423 (50%), Gaps = 46/423 (10%)

Query: 1050 VDVKSVNQLCKISSKLVRTFLDIAISKYRKAKVEPGTAVGAIGAHSIGEPGTQMTLKTFH 1109
            +  + + Q  +++ +     L+   +++ ++ V PG  VG + A SIGEP TQMTL TFH
Sbjct: 1026 LSTRRILQEYRLTKQAFEWVLNNVEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFH 1085

Query: 1110 FAGVASMNVTLGVPRIKEIINASKVISTPIINATLVND--DDERAARVVKGRVEKTLLSD 1167
            FAGVAS  VT GVPR+KEI+N +K + TP +   L +D   D+  A+ ++  +E T L  
Sbjct: 1086 FAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLKDDYSSDQEKAKFIRSAIEHTTLKS 1145

Query: 1168 V-----IFYIQD----VYRDNMSFLQVKVDLATIEKLQLELTVEDIAIAITSAPKLKIST 1218
            +     I+Y  D    V  ++   +Q+   L   E  Q  L  +   +      +  ++ 
Sbjct: 1146 ITVASEIYYDPDPRSTVIPEDDEIIQLHFSLLDDETEQ-SLDRQSPWLLRLELDRAAMND 1204

Query: 1219 GDVSI--VGRNKININVCNDL------DKAKSI-----------STLASEPHENDVFFKM 1259
             D+++  VG  +I     NDL      D A+ +               +E  E+ +  K+
Sbjct: 1205 KDLTMGQVGE-RIKETFRNDLFVIWSEDNAEKLIIRCRVVRPKSMDAETEAEEDHMLKKI 1263

Query: 1260 QHLRRALPGIVVKGLPDISRAVINIRD------DGKRE------LLVEGYGLRDVMTTDG 1307
            ++    L  I ++G+ +I R V+   D       G+ +      L  +G  L +VMT  G
Sbjct: 1264 ENT--MLENITLRGVENIERVVMMKYDRKVPSQSGEYQKVPEWVLETDGVNLSEVMTVPG 1321

Query: 1308 VVGYKTKTNHFLEVYDVLGIEAARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEV 1367
            V   +  TN F+++ +VLGIEA R ++  E+   +++ G  V+ RH+ LL DVMT +G +
Sbjct: 1322 VDATRIYTNSFIDITEVLGIEAGRAALYREVYNVIASDGSYVNYRHMALLVDVMTTQGAL 1381

Query: 1368 LGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMTIGTGSF 1427
              ITR G ++     L  +SFE+T + LF+A    + D   GVSE ++LGQ   IGTG+F
Sbjct: 1382 TSITRHGFNRASTGALMRSSFEETVEILFEAGASAELDDCRGVSENVLLGQMAPIGTGAF 1441

Query: 1428 KVV 1430
             V+
Sbjct: 1442 DVM 1444

>NCAS0A13900 Chr1 (2728572..2733722) [5151 bp, 1716 aa] {ON}
           Anc_7.314
          Length = 1716

 Score =  544 bits (1402), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 349/925 (37%), Positives = 501/925 (54%), Gaps = 66/925 (7%)

Query: 11  KRISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGVSSSQAECSTC 70
           + +  ++F   S  ++   S  +I   +  D    RA K GG  D R+G      +C TC
Sbjct: 12  RTVKEVQFGLFSPEEVRGISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNLKCQTC 70

Query: 71  HGTLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNE--EDKRQFLSELR 128
              +  C GHFGHI LA PVFHVG+     ++ +S+C +C KLLL+E  E  RQ ++   
Sbjct: 71  QEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCESVCMHCGKLLLDEHNEQMRQAMAIK- 129

Query: 129 RPGIDNLRRMATLKKVLDQCKKQRRCLHCGMLNXXXXXXXXXXXXXXLK--IIHDTFRWV 186
               D+ +R      V   CK +  C      +               +  I  D  + V
Sbjct: 130 ----DSKKR---FNAVWTLCKTKMICETDVPSDDDPTTLISRGGCGNAQPSIRKDGLKLV 182

Query: 187 GKKSAPEKDKWIGDWNQVLQHSPELERYMKRTMENLNPLKTLNLFKQISPQDCELLGIDS 246
           G         W  + N      PE           L+  + LN+FK ISP+D   +G   
Sbjct: 183 GS--------WKKEKNTSDGDEPE--------QRVLSTEEILNIFKHISPEDSTRMGFSE 226

Query: 247 TVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAGLEKG 306
             +  RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++     G
Sbjct: 227 --EFARPEWMILCVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETLEHNG 283

Query: 307 ISINNMMEQWDYLQMAVAMYINSDSVNP--ALMPGGNGGGKTKPIRGFCQRLKGKQGRFR 364
              + + E    LQ  VA Y+++D      AL   G      +P++    RLKGK+GR R
Sbjct: 284 APHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG------RPVKSIRARLKGKEGRIR 337

Query: 365 GNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKHKLQQLIVNGAN 424
           GNL GKRVDFS RTVIS DPNL +D+V VP  +A+ LT+PE VT YN  +L QL+ NG N
Sbjct: 338 GNLMGKRVDFSARTVISGDPNLELDQVGVPKSIARTLTYPEVVTPYNIDRLTQLVRNGPN 397

Query: 425 VHPGANYLLKKNEEARRNLRYGDRIKLAKNLQIGDVVERHLEDGDVVLFNRQPSLHRLSI 484
            HPGA Y+++ N + R +LRY  R    + LQ G  VERH+ D D VLFNRQPSLH++S+
Sbjct: 398 EHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDDDPVLFNRQPSLHKMSM 455

Query: 485 LSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPK 544
           ++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++ +
Sbjct: 456 MAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSAQ 515

Query: 545 SGEPIIAATQDFITGSYLISHKDSFFDRATFVQMLSMMSDGNLQFDIPPPAIMRPHYLWT 604
           S +P +   QD + G   ++ +D+F +    + ML  + D +    IP PA+++P  LWT
Sbjct: 516 SNKPCMGIVQDTLCGIRKLTLRDTFIEFDQVLNMLYWVPDWDGV--IPTPAVLKPKPLWT 573

Query: 605 GKQLFSLLIKPNKKSPVIINLDA--KNKVYIAPKNKAYPNEMSANDGYVVIRGSNILSGV 662
           GKQ+ S  I      P  I+L    +    ++PK+          +G +VI G  I+ GV
Sbjct: 574 GKQVLSAAI------PKGIHLQRFDEGTTLLSPKD----------NGMLVIDG-QIIFGV 616

Query: 663 MDKSVLGDGKKHSVFYTILRDFGPQEATQAMNRMAKLCARYLGNRGFSIGISD-VTPGVE 721
           +DK  +G      + + + R+ GP    +    + K+   +L + GFS GI D +  G  
Sbjct: 617 VDKKTVG-SSSGGLIHVVTREKGPTICARLFGNIQKIVNFWLLHNGFSTGIGDTIADGQT 675

Query: 722 LKATKEEMVEIAYAKCDELIDLYKRGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVCI 781
           +K   E + E A  K +++    +   L  + G    ++ E  +   L++ R++ G +  
Sbjct: 676 IKEITETIAE-AKKKVEDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRLAE 734

Query: 782 RELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTP 841
             L++LN    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +P
Sbjct: 735 VNLNDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIGFGFVDRTLPHFSKDDYSP 794

Query: 842 QSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDN 901
           +SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YD 
Sbjct: 795 ESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDG 854

Query: 902 TVRTSSNGIVQFTYGGDGLDPLNME 926
           T R S   ++QF YG DG+D  ++E
Sbjct: 855 TTRNSLGNVIQFIYGEDGIDAAHIE 879

 Score =  176 bits (447), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 130/420 (30%), Positives = 213/420 (50%), Gaps = 44/420 (10%)

Query: 1052 VKSVNQLCKISSKLVRTFLDIAISKYRKAKVEPGTAVGAIGAHSIGEPGTQMTLKTFHFA 1111
             + + Q  K++ +  +  L+   S++ ++ V PG  VG + A SIGEP TQMTL TFHFA
Sbjct: 1028 TRRILQEYKLTKQAFQWVLNNVESQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFA 1087

Query: 1112 GVASMNVTLGVPRIKEIINASKVISTPIINATLVN--DDDERAARVVKGRVEKTLLSDV- 1168
            GVAS  VT GVPR+KEI+N +K + TP +   L +    D+  A+ ++  +E T L  + 
Sbjct: 1088 GVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLKDGYSSDQEKAKFIRSAIEHTTLKSIT 1147

Query: 1169 ----IFYIQD----VYRDNMSFLQVKVDLATIEK-----------LQLEL-----TVEDI 1204
                I+Y  D    V  ++   +Q+   L   E            L+LEL       +D+
Sbjct: 1148 VASEIYYDPDPRSTVIPEDDEIIQLHFSLMDDETEQSLDRQSPWLLRLELDRAAMNDKDL 1207

Query: 1205 AIAITSAPKLKISTGDVSIVGR--NKININVCNDLDKAKSISTLASEPHENDVFFKMQHL 1262
             +        +    D+ ++    N   + +   + + KS+    +E  E+ +  K+++ 
Sbjct: 1208 TMGQVGERIKETFKNDLFVIWSEDNAEKLIIRCRVVRPKSLDA-ETEAEEDHMLKKIENT 1266

Query: 1263 RRALPGIVVKGLPDISRAVINIRD------DGKRE------LLVEGYGLRDVMTTDGVVG 1310
               L  I ++G+ +I R V+   D       G+ E      L  +G  L +VMT  G+  
Sbjct: 1267 --MLENITLRGVENIERVVMMKYDRKVPSATGEYEKVPEWVLETDGVNLSEVMTVPGIDA 1324

Query: 1311 YKTKTNHFLEVYDVLGIEAARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGI 1370
             +  TN F+++ +VLGIEA R ++  E+   +++ G  V+ RH+ LL DVMT +G +  +
Sbjct: 1325 TRIYTNSFIDIMEVLGIEAGRAALYREVYNVIASDGSYVNYRHMALLVDVMTTQGGLTSV 1384

Query: 1371 TRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMTIGTGSFKVV 1430
            TR G ++     L   SFE+T + LF+A    + D   GVSE ++LGQ   IGTG+F V+
Sbjct: 1385 TRHGFNRASTGALMRCSFEETVEILFEAGASAELDDCRGVSENVLLGQMAPIGTGAFDVM 1444

>CAGL0E05500g Chr5 (539213..544144) [4932 bp, 1643 aa] {ON} highly
            similar to uniprot|P10964 Saccharomyces cerevisiae
            YOR341w RPA190 DNA-directed RNA polymerase I
          Length = 1643

 Score =  441 bits (1133), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 317/975 (32%), Positives = 501/975 (51%), Gaps = 115/975 (11%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI----------- 299
            + + +    L  PP   R PS +  +   ++++ L   L++I+ TS LI           
Sbjct: 337  KADMFFMDVLVVPPTRFRLPSKLGDEVHENSQNQL---LSKILTTSLLIRDLNDELSTLQ 393

Query: 300  --KAGLE-KGISINNMMEQWDYLQMAVAMYINSDSVNPALMPGGNGGGKTKPIRGFCQRL 356
              K  LE + I  + +M  +  +Q  V  +I+S          GN GGK  PI G  Q L
Sbjct: 394  KDKVSLEDRRIIFSRLMNAFVTIQNDVNSFIDSTKAQ------GNTGGKV-PIPGVKQAL 446

Query: 357  KGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKHKLQ 416
            + K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LT+PE VT YN  +L+
Sbjct: 447  EKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAELR 506

Query: 417  QLIVNGANVHPGANYLLKKNEEARR----NLRYGDRIKLAKNLQ----------IGDVVE 462
            Q I+NG +  PGA+ +  +NE+        +    R  LA  L           +   V 
Sbjct: 507  QAIINGPDKWPGASQI--QNEDGSLISLVGMTLEQRKALANQLMTPSSNPYTHTLNKKVY 564

Query: 463  RHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVP 521
            RH+++ D+VL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H P
Sbjct: 565  RHIKNRDIVLMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFP 624

Query: 522  QTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFVQMLSM 581
            Q E ARAEA NL    +  LTP SG P+    QD I+    +++KDSFF R  + Q +  
Sbjct: 625  QNENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSFFTREQYQQYIYG 684

Query: 582  M---SDGN---LQFDIPPPAIMRPHYLWTGKQLFSLLIKPNKKSPVI--INLDAKNKVYI 633
                 DG+    +    PPAI +P  LWTGKQ+ + ++  N   P +  INL + NK+  
Sbjct: 685  CIRPEDGHATRAKLVTLPPAIHKPIPLWTGKQIITTVLL-NVTPPDMPGINLKSSNKI-- 741

Query: 634  APKNKAYPNEMSANDGYVVIRGSNILSGVMDKSVLGDGKKHSVFYTILRDFGPQEATQAM 693
              KN+ +      ND  V+ +   +L G++DKS  G   K+ + +++   +GP+ A + +
Sbjct: 742  --KNEYWGKHSEEND--VIFKDGQLLCGILDKSQYG-ASKYGIVHSLHEVYGPETAAKVL 796

Query: 694  NRMAKLCARYLGNRGFSIGISDV---TPGVELKA-TKEEMVEIAYAKCDELIDLYKRG-- 747
            + + +L   Y+ N  F+ G+ D+   + G + ++   +E V+I      E+ +L K    
Sbjct: 797  SVLGRLFTNYIMNTAFTCGMDDLRLTSDGNKWRSDILKESVDIGRQAAAEVTNLDKDTPS 856

Query: 748  -------KLETQPGCNEEQTL-----EAKIGGLLSKVREEVGDVCIRELDNLNAPLIMAT 795
                   +LE     N +  +      AK+  + SKV  +       +    N+   MA 
Sbjct: 857  NDPELLKRLEEILRDNNKLGILDAVSSAKVNTITSKVVSQCVPGGTMKKFPENSMQAMAL 916

Query: 796  CGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGL 855
             G+KGSN+NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+SG+
Sbjct: 917  SGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYIKGRFYSGI 976

Query: 856  SPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFTY 915
             P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR +   ++QF Y
Sbjct: 977  KPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDADGTLIQFLY 1036

Query: 916  GGDGLDPLNMEGNAKPVNFNRSWDHANNITYNHDDKGMLPYQILEETNAILHPLEQQLSR 975
            GGD +D +     +    FN   D+ + +   ++     P  ++E  +     +E  L +
Sbjct: 1037 GGDAVDVIK---ESHMTEFNFCLDNYDALLKKYN-----PSALVEHVD-----VETAL-K 1082

Query: 976  YDNVGNPLAPGLENEELYIDQHDAEREFYQSLRTYMSEKARKLADITKSRGLKELYHAPA 1035
            Y          L+N +    +H  E+ + Q+L+         L+    ++ L  +     
Sbjct: 1083 YSK------KTLKNRK----KHKDEKHYKQTLKY-----DPVLSKYNPAKYLGAVSENFQ 1127

Query: 1036 LELQLMDLDASCPEVDVKSVNQLCKISSKLVRTFLDIAISKYRKAKVEPGTAVGAIGAHS 1095
             +L+L  LD S      K+  +   I+ K  R  + +   KY ++ + PG AVG I + S
Sbjct: 1128 DKLELF-LDKSS-----KTFKEYESINEKKFRALMQL---KYMRSLINPGEAVGIIASQS 1178

Query: 1096 IGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINATLVNDDDERAAR 1154
            +GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   + ND  +  A 
Sbjct: 1179 VGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPIWNDVSDETAD 1238

Query: 1155 VVKGRVEKTLLSDVI 1169
                 + K +LS+VI
Sbjct: 1239 TFCKSISKVILSEVI 1253

 Score = 86.7 bits (213), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 48/162 (29%), Positives = 87/162 (53%), Gaps = 2/162 (1%)

Query: 1270 VVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVVGYKTKT-NHFLEVYDVLGIE 1328
            +++ +P I R +    ++GKR L+ EG   + +   +  +     T N    V    G+E
Sbjct: 1478 IIRQVPHIDRCIRPEPENGKRVLVTEGVNFQAMWDQEAFIDVDGITSNDIASVLQTYGVE 1537

Query: 1329 AARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1388
            AAR +I++EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1538 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-SY 1596

Query: 1389 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMTIGTGSFKVV 1430
            E T   L  A    +++ +E  S  I+LG+   +GTG+F ++
Sbjct: 1597 ETTCQFLTKAVLDNEREQLESPSARIVLGKLNNVGTGAFDIL 1638

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 51/116 (43%), Gaps = 3/116 (2%)

Query: 13  ISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGVSSSQAECSTCHG 72
           IS ++F  L+++DI   S   I    + D  +   P  GG  D  +G       C TC  
Sbjct: 11  ISSVDFGILTSADIRNLSAKRITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CGTCGL 67

Query: 73  TLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNEEDKRQFLSELR 128
               C GH GHI+L +P ++  +F      L+S C  C    L   D  ++  +LR
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSACLFCHHFKLKSLDVHRYACKLR 123

>Kpol_1040.3 s1040 complement(6642..11612) [4971 bp, 1656 aa] {ON}
            complement(6642..11612) [4971 nt, 1657 aa]
          Length = 1656

 Score =  437 bits (1124), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 313/976 (32%), Positives = 500/976 (51%), Gaps = 117/976 (11%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK------AGLE 304
            + +T+    +  PP   R PS +  +   + ++ L   L++I+ TS LI+      + L+
Sbjct: 346  KADTFFMEVVLVPPTRFRLPSKLGDEVHENTQNQL---LSKILTTSLLIRDLNDEMSKLQ 402

Query: 305  KG--------ISINNMMEQWDYLQMAVAMYINSDSVNPALMPGGNGGGKTKPIRGFCQRL 356
            K         +  + +M  +  +Q  V  +I+S          GN GGK  PI G  Q L
Sbjct: 403  KDKVSLQDRRVIFSRLMNAFVTIQNDVNAFIDSTKAQ------GNTGGKV-PIPGVKQAL 455

Query: 357  KGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKHKLQ 416
            + K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LT+PE VT YN  +L+
Sbjct: 456  EKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAELR 515

Query: 417  QLIVNGANVHPGANYLLKKNEEARR----NLRYGDRIKLAKNLQ----------IGDVVE 462
            Q ++NG +  PGA+ +  +NE+        +    R  LA  L           +   V 
Sbjct: 516  QAVINGPDKWPGASQI--QNEDGSLVSLIGMTLEQRKALANQLMTPSSNIATHTLNKKVY 573

Query: 463  RHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVP 521
            RH+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H P
Sbjct: 574  RHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFP 633

Query: 522  QTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFVQML-- 579
            Q E ARAEA NL    +  LTP SG P+    QD I+    ++ KDSFF R  + Q +  
Sbjct: 634  QNENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYG 693

Query: 580  ----SMMSDGNLQFDIPPPAIMRPHYLWTGKQLFS-LLIKPNKKSPVIINLDAKNKVYIA 634
                        +    PPA+ +P  LWTGKQ+ + +L+         INL++ NK+   
Sbjct: 694  CIRPEHGHTTRSKIVTVPPAVFKPVPLWTGKQIITTVLLNVTPSDMPGINLNSSNKI--- 750

Query: 635  PKNKAYPNEMSANDGYVVIRGSNILSGVMDKSVLGDGKKHSVFYTILRDFGPQEATQAMN 694
             KN+ + N  + ND  V+ +   +L G++DKS  G   K+ + +++   +GP  A + ++
Sbjct: 751  -KNEYWGNGSTEND--VIFKNGELLCGILDKSQYG-ASKYGIVHSLHEVYGPDVAAKVLS 806

Query: 695  RMAKLCARYLGNRGFSIGISDVTPGVELKATKEEMVEIAY-----AKCDELIDLYKRGKL 749
             + +L   Y+    F+ G+ D+    E    ++++++ +      A C E+ +L K    
Sbjct: 807  VLGRLFTNYITATAFTCGMDDLRLTDEGNKWRKDILKTSVDTGRQAAC-EVTNLEKETAS 865

Query: 750  ----------ETQPGCNEEQTLEA----KIGGLLSKVREE-VGDVCIRELDNLNAPLIMA 794
                      E     N+   L+A    K+  + SKV  + V D  +++    N+   MA
Sbjct: 866  DDSELLKRLEEILRDDNKSGILDAVTSSKVNSITSKVVSKCVPDGTMKKFP-YNSMQAMA 924

Query: 795  TCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSG 854
              G+KGSN+NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+SG
Sbjct: 925  LSGAKGSNVNVSQIMCLLGQQALEGRRVPTMVSGKTLPSFKPFETDAMAGGYIKGRFYSG 984

Query: 855  LSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFT 914
            + P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR     ++QF 
Sbjct: 985  IKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDGDGTLIQFL 1044

Query: 915  YGGDGLDPLNMEGNAKPVNFNRSWDHANNITYNHDDKGMLPYQILEETNAILHPLEQQLS 974
            YGGD +D   +   +    F    ++ +++   ++   ++ +  L+   A+ +  +   S
Sbjct: 1045 YGGDSVD---VTKESHLTQFEFCLENYDSLLKKYNPSALIEH--LDVETALKYSKKASKS 1099

Query: 975  RYDNVGNPLAPGLENEELYIDQHDAEREFYQSLRTYMSEKARKLADITKSRGLKELYHAP 1034
            R  N   P      + E  I    A  +F  +   Y+   + K  D              
Sbjct: 1100 RKKNRKVP------HYEQNIKYDPALAKFNPA--KYLGAVSEKFQD-------------- 1137

Query: 1035 ALELQLMDLDASCPEVDVKSVNQLCKISSKLVRTFLDIAISKYRKAKVEPGTAVGAIGAH 1094
             LEL  +D +AS  E D KSVN+      K  R  + +   KY ++ + PG +VG I + 
Sbjct: 1138 KLEL-FLDSNASLFESD-KSVNE------KKFRALMQL---KYMRSLINPGESVGIIASQ 1186

Query: 1095 SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINATLVNDDDERAA 1153
            S+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   +++D  +  A
Sbjct: 1187 SVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPILDDVSDDQA 1246

Query: 1154 RVVKGRVEKTLLSDVI 1169
             V    + K LLS+VI
Sbjct: 1247 DVFSKSISKVLLSEVI 1262

 Score = 86.3 bits (212), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 51/162 (31%), Positives = 87/162 (53%), Gaps = 2/162 (1%)

Query: 1270 VVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVVGYKTKT-NHFLEVYDVLGIE 1328
            V++ +P I R V    ++GKR L+ EG   + +   +  +G    T N    V    G+E
Sbjct: 1489 VIRQVPFIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIGVDGITSNDVSAVLKTYGVE 1548

Query: 1329 AARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1388
            AAR +I++EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1549 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-SY 1607

Query: 1389 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMTIGTGSFKVV 1430
            E T   L  A    + + ++  S  I+LG+   +GTG+F V+
Sbjct: 1608 ETTCQFLTKAVLDNENEELKSPSARIVLGKLNNVGTGAFDVL 1649

 Score = 47.0 bits (110), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 53/116 (45%), Gaps = 3/116 (2%)

Query: 13  ISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGVSSSQAECSTCHG 72
           I+ ++FS L+A +I   S  +I    + D  +   P  GG  D  +G       CSTC  
Sbjct: 11  ITSIDFSILTAQEIRNLSAKQITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CSTCGL 67

Query: 73  TLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNEEDKRQFLSELR 128
               C GH GHI+L +P ++  +F      L+S C  C    L   +  ++  +L+
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSSCLFCHHFRLRSIEVHRYTCKLK 123

>TDEL0H04000 Chr8 (680730..685727) [4998 bp, 1665 aa] {ON} Anc_7.51
            YOR341W
          Length = 1665

 Score =  434 bits (1115), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 310/991 (31%), Positives = 496/991 (50%), Gaps = 141/991 (14%)

Query: 249  KAGRPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK------A 301
            K  + + +    +  PP   R PS M ++   + ++ L   L++I+ TS LI+      +
Sbjct: 347  KVVKADNFFMEVVLVPPTRFRLPSKMGEEVHENTQNQL---LSKILTTSLLIRDLNDEMS 403

Query: 302  GLEKG-ISINN-------MMEQWDYLQMAVAMYINSDSVNPALMPGGNGGGKTKPIRGFC 353
             ++K  +S+++       +M  +  +Q  V  +I+S          G+   K  P+ G  
Sbjct: 404  TIQKDKVSVDDRRVIFSRLMNAFVTIQNDVNAFIDSTKAQ------GSASSKI-PVPGVK 456

Query: 354  QRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKH 413
            Q L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LT+PE VT YN  
Sbjct: 457  QALEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTAYNIA 516

Query: 414  KLQQLIVNGANVHPGANYLLKKNEEARR----NLRYGDRIKLAKNLQ----------IGD 459
            +L+Q ++NG +  PGA+ +  +NE+        +    R  LA  L           +  
Sbjct: 517  ELRQAVINGPDKWPGASQI--QNEDGTLVSLVGMTLEQRKALANQLMTPSSNVSTHPLNK 574

Query: 460  VVERHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNL 518
             V RH+++ DVVL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+
Sbjct: 575  KVYRHIKNRDVVLMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNM 634

Query: 519  HVPQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFVQM 578
            H PQ E ARAEA NL    +  LTP SG P+    QD I+    ++ KDSFF R  + Q 
Sbjct: 635  HFPQNENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREEYQQY 694

Query: 579  L--------SMMSDGNLQFDIPPPAIMRPHYLWTGKQLFS-LLIKPNKKSPVIINLDAKN 629
            +           S G +     PPA+++P  LWTGKQ+ S +L+         INL++ N
Sbjct: 695  IYGCIRPEHGHASRGKIV--TMPPAVLKPVPLWTGKQIISTVLLNVTPADMPGINLESNN 752

Query: 630  KVYIAPKNKAYPNEMSANDGYVVIRGSNILSGVMDKSVLGDGKKHSVFYTILRDFGPQEA 689
            K+    KN+ +    + ND  V+ +   ++ G++DKS  G   K+ + +++   +GP+ A
Sbjct: 753  KI----KNEYWGKGSTEND--VIFKNGELVCGILDKSQYG-ASKYGIVHSLHEVYGPEVA 805

Query: 690  TQAMNRMAKLCARYLGNRGFSIGISDVTPGVELKATKEEMVEI-------AYAKCDEL-- 740
             + ++ + +L   Y+    F+ G+ D+    E   ++ E+++        A A+   L  
Sbjct: 806  AKVLSVLGRLFTNYITATAFTCGMDDLRLTAEGNKSRSEILKTSIDIGRQAAAEVTNLDK 865

Query: 741  ------IDLYKRGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVCIRELDNLNAPL--- 791
                  ++L KR + E     N+   L+A     ++ V  +V   C+ +      P    
Sbjct: 866  DTPSDDVELLKRLE-EILRDENKSGILDAVTSSKVNTVTSKVVSTCVPDGTMKKFPYNSM 924

Query: 792  -IMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNS 850
              MA  G+KGSN+NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  
Sbjct: 925  QAMALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDSMAGGYIKGR 984

Query: 851  FFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGI 910
            F+SG+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR     +
Sbjct: 985  FYSGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDGDGSL 1044

Query: 911  VQFTYGGDGLDPLNMEGNAKPVNFNRSWDHANNITYNH-------DDKGMLPYQIL---- 959
            +QF YGGD +D +  E +    +F R    A    YN        D +  L Y       
Sbjct: 1045 IQFLYGGDAVD-VTKESHMTQFDFCRENYDALLKKYNPVALAEHLDVETALQYSKKVSKN 1103

Query: 960  EETNAILHPLEQQLSRYDNVGNPLAPGLENEELYIDQHDAEREFYQSLRTYMSEKARKLA 1019
             + N+     EQ++ +YD V     P       Y+       +F+  L +Y+ +KA++  
Sbjct: 1104 RKKNSKTAHYEQKV-KYDPVLAKYNPA-----KYLGS--VSEKFHDKLESYLEDKAKEF- 1154

Query: 1020 DITKSRGLKELYHAPALELQLMDLDASCPEVDVKSVNQLCKISSKLVRTFLDIAISKYRK 1079
               KSR                                   +S+K  R  + +   KY +
Sbjct: 1155 ---KSRE---------------------------------SVSAKRFRALMQL---KYMR 1175

Query: 1080 AKVEPGTAVGAIGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTP 1138
            + + PG AVG I + S+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP
Sbjct: 1176 SLINPGEAVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASSAIKTP 1235

Query: 1139 IINATLVNDDDERAARVVKGRVEKTLLSDVI 1169
             +   + +D  +  A +    + K +LS+V+
Sbjct: 1236 QMTLPIWDDVSDEQADLFCKSISKVVLSEVV 1266

 Score = 85.1 bits (209), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 50/162 (30%), Positives = 86/162 (53%), Gaps = 2/162 (1%)

Query: 1270 VVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVVGYKTKT-NHFLEVYDVLGIE 1328
            V++ +P I R V +   + KR L+ EG   + +   +  +     T N    V    G+E
Sbjct: 1497 VIREVPHIDRCVHSEPVNNKRMLVTEGVNFQAMWDQEAFIDVDAITSNDVASVLRTYGVE 1556

Query: 1329 AARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1388
            AAR +I++EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1557 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-SY 1615

Query: 1389 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMTIGTGSFKVV 1430
            E T   L  A    +++ +E  S  I+LG+   +GTGSF ++
Sbjct: 1616 ETTCQFLTKAVLDNEREELESPSARIVLGKLSNVGTGSFDLL 1657

 Score = 47.0 bits (110), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 53/116 (45%), Gaps = 3/116 (2%)

Query: 13  ISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGVSSSQAECSTCHG 72
           I+ L+F+ L+  DI   S  +I    + D  +   P  GG  D  +G       CSTC  
Sbjct: 11  ITSLDFNILTPQDIRNLSAKQITNPTVLD--NLGHPISGGLYDLSLGAFLRNL-CSTCGL 67

Query: 73  TLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNEEDKRQFLSELR 128
               C GH GHI+L +P ++  +F      L+S C  C    L + +  ++  +L+
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSCCLFCHHFRLKKVEVHRYACKLK 123

>KLTH0D01628g Chr4 complement(157597..162561) [4965 bp, 1654 aa] {ON}
            highly similar to uniprot|P10964 Saccharomyces cerevisiae
            YOR341W RPA190 RNA polymerase I subunit largest subunit
            of RNA polymerase I
          Length = 1654

 Score =  426 bits (1095), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 309/988 (31%), Positives = 489/988 (49%), Gaps = 141/988 (14%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI----------- 299
            R + +    +  PP   R PS + ++   + ++ L   L++I+ TS LI           
Sbjct: 346  RADMFFLEVVIVPPTRFRLPSKLGEEIHENTQNQL---LSKILTTSLLIRDLNEEMSKLQ 402

Query: 300  --KAGLE-KGISINNMMEQWDYLQMAVAMYINSDSVNPALMPGGNGGGKTKPIRGFCQRL 356
              K  +E K +  N +M  +  +Q  V  +I+S          GN GGK  PI G  Q L
Sbjct: 403  KDKVSVEDKKVIFNRLMNAFVTIQNDVNAFIDSTKAQ------GNTGGKV-PIPGVKQAL 455

Query: 357  KGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKHKLQ 416
            + K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LT+PE VT YN  +L+
Sbjct: 456  EKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAELR 515

Query: 417  QLIVNGANVHPGANYLLKKNEEARRNLRYG----DRIKLAKNL----------QIGDVVE 462
            Q ++NG +  PGA  +  +NE+       G     R  LA  L           +   V 
Sbjct: 516  QAVINGPDKWPGATQI--QNEDGSLVSLVGMTTEQRKALANQLLTPSSHSATHSLNKKVY 573

Query: 463  RHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVP 521
            RH+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H P
Sbjct: 574  RHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFP 633

Query: 522  QTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFVQMLSM 581
            Q E ARAEA NL    +  LTP SG P+    QD I+    +++KDSFF R  + Q +  
Sbjct: 634  QNENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSFFTREEYQQYIYG 693

Query: 582  M---SDGNL---QFDIPPPAIMRPHYLWTGKQLFS-LLIKPNKKSPVIINLDAKNKVYIA 634
                 DG+    +    PPA+ +P  LWTGKQ+ + +L+         INL +KNK+   
Sbjct: 694  CIRPEDGHATRNKLLTVPPAVFKPVPLWTGKQIITTVLLNVTPADMPGINLLSKNKI--- 750

Query: 635  PKNKAYPNEMSANDGYVVIRGSNILSGVMDKSVLGDGKKHSVFYTILRDFGPQEATQAMN 694
             KN+ +    + ND  VV +   +L G++DKS  G   K+ + +++   +GP  + + ++
Sbjct: 751  -KNEYWGKGSTEND--VVFKNGELLCGILDKSQYG-ASKYGIVHSLHEVYGPDVSAKVLS 806

Query: 695  RMAKLCARYLGNRGFSIGISDVTPGVE-------LKATKEEMVEIAYAKCDEL------- 740
             + +L   Y+    F+ G+ D+    E       +  T  ++  +A A+   L       
Sbjct: 807  VLGRLFTNYITATAFTCGMDDLRLTEEGNKWRSDILKTSTDVGRVAAAEVTNLDKDVSAN 866

Query: 741  -IDLYKRGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVCI-----RELDNLNAPLIMA 794
              +L KR + E     N+   L+A     ++ +  +V   C+     ++  N N+   MA
Sbjct: 867  DSELLKRLE-EILRDDNKLGILDAVTSSKVNSITSQVVSKCVPDGTMKKFPN-NSMQAMA 924

Query: 795  TCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSG 854
              G+KGSN+NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+SG
Sbjct: 925  LSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDAMAGGYIKGRFYSG 984

Query: 855  LSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFT 914
            + P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR +   ++QF 
Sbjct: 985  IKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDADGTLIQFL 1044

Query: 915  YGGDGLDPLNMEGNAKPVNFNRSWDHANNITYNHDDKGMLPYQILEET-----NAILH-- 967
            YGGD +D   +   +    F    D+ + +   ++   ++ +  +E        A+ H  
Sbjct: 1045 YGGDAVD---VTQESHMTQFKFCADNYDALLKKYNPAALIEHLDVESALKYSKKALKHRK 1101

Query: 968  -----PLEQQLSRYDNVGNPLAPGLENEELYIDQHDAEREFYQSLRTYMSEKARKLADIT 1022
                 P   Q  +YD V +   P       Y+        F   L +++        D+ 
Sbjct: 1102 KTEKVPHYSQKVKYDPVVSKFNPS-----KYLGS--VSENFQDKLESFIDSN----NDLF 1150

Query: 1023 KSRGLKELYHAPALELQLMDLDASCPEVDVKSVNQLCKISSKLVRTFLDIAISKYRKAKV 1082
            KSR                    +  E   +++ QL     K +R+ ++           
Sbjct: 1151 KSRD-------------------TVSEKKFRALMQL-----KYMRSLIN----------- 1175

Query: 1083 EPGTAVGAIGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIIN 1141
             PG AVG I + S+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP + 
Sbjct: 1176 -PGEAVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMT 1234

Query: 1142 ATLVNDDDERAARVVKGRVEKTLLSDVI 1169
              ++ D  +  A      V K +LS+V+
Sbjct: 1235 LPILADVTDPQADTFCKSVTKVMLSEVV 1262

 Score = 84.0 bits (206), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 50/162 (30%), Positives = 87/162 (53%), Gaps = 2/162 (1%)

Query: 1270 VVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVVGYKTKT-NHFLEVYDVLGIE 1328
            V++ + +I R V    ++GKR L+ EG   +++   D  +     T N    V    G+E
Sbjct: 1487 VIREVKNIDRCVHPEPENGKRILVTEGVNFQEMWDQDAFIDVNGITSNDVASVLKTYGVE 1546

Query: 1329 AARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1388
            AAR +I++EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1547 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-SY 1605

Query: 1389 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMTIGTGSFKVV 1430
            E T   L  A    + + ++  S  I+LG+   +GTG+F V+
Sbjct: 1606 ETTCQFLTKAVLDNECENLDSPSARIVLGKLNNVGTGAFDVL 1647

 Score = 47.8 bits (112), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 53/116 (45%), Gaps = 3/116 (2%)

Query: 13  ISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGVSSSQAECSTCHG 72
           I+ ++F  ++A DI   S ++I    + D  +   P  GG  D  +G       C+TC  
Sbjct: 11  ITSVDFGVMTAQDIRNFSAMQITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CATCGL 67

Query: 73  TLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNEEDKRQFLSELR 128
               C GH GHI+L +P ++  +F      L+S C  C    L   +  ++  +L+
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFSQLYIFLRSSCLYCHGFRLKASEVHRYACKLK 123

>ZYRO0D04532g Chr4 (374177..379180) [5004 bp, 1667 aa] {ON} highly
            similar to uniprot|P10964 Saccharomyces cerevisiae
            YOR341W RPA190 RNA polymerase I subunit largest subunit
            of RNA polymerase I
          Length = 1667

 Score =  426 bits (1095), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 307/980 (31%), Positives = 499/980 (50%), Gaps = 119/980 (12%)

Query: 249  KAGRPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK------A 301
            K+  P+ +    +  PP   R PS + ++   + ++ L   L++++ TS LI+      +
Sbjct: 349  KSVTPDVFFMEVVLVPPTRFRLPSKLGEEVHENTQNQL---LSKVLTTSLLIRDLNDEMS 405

Query: 302  GLEKG--------ISINNMMEQWDYLQMAVAMYINSDSVNPALMPGGNGGGKTKPIRGFC 353
             L+K         +  + +M  +  +Q  V  +I+S          G+ GGK  PI G  
Sbjct: 406  NLQKDKVSVEDRRVIFSRLMNAFVTIQNDVNSFIDSTKAQ------GSTGGKV-PIPGVK 458

Query: 354  QRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKH 413
            Q L+ K+G FR ++ GKRV+ + R+VISPDPN+  +E+ VP   A  LT+PE VT YN  
Sbjct: 459  QALEKKEGLFRKHMMGKRVNHAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIA 518

Query: 414  KLQQLIVNGANVHPGANYLLKKNEEARR----NLRYGDRIKLAKNL----------QIGD 459
            +L+Q ++NG +  PGA  +  +NE+        +    R  LA  L           +  
Sbjct: 519  ELRQAVINGPDKWPGATQI--QNEDGSLVSLVGMTLEQRNALANQLLTPSSNPATHTLNK 576

Query: 460  VVERHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNL 518
             V RH+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+
Sbjct: 577  KVFRHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNM 636

Query: 519  HVPQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFVQM 578
            H PQ E AR+EA NL    +  LTP SG P+    QD I+    +++KDSFF R  + Q 
Sbjct: 637  HFPQNENARSEAFNLANTDSQYLTPTSGSPLRGLIQDHISAGVWLTNKDSFFTRDQYQQY 696

Query: 579  LSMM---SDGNL---QFDIPPPAIMRPHYLWTGKQLFSLLIKPNKKSPVI-INLDAKNKV 631
            +       DG+    +    PPA+M+P  LWTGKQ+ + +I     + +  INL +KNK+
Sbjct: 697  IYGCIRPEDGHSTRPKIVTVPPAVMKPVPLWTGKQIITTVIMNVTPADMPGINLLSKNKI 756

Query: 632  YIAPKNKAYPNEMSANDGYVVIRGSNILSGVMDKSVLGDGKKHSVFYTILRDFGPQEATQ 691
                KN+ +    + N+  V+ +   +L G++DKS  G   K+ + +++   +GP+ A +
Sbjct: 757  ----KNEYWGQGSTENE--VIFKDGALLCGILDKSQYG-ASKYGIVHSLHEVYGPETAAK 809

Query: 692  AMNRMAKLCARYLGNRGFSIGISDVTPGVELKATKEEMVEI-------AYAKCDELI--- 741
             ++ + +L   ++ N  FS G+ D+    E    ++++++        A A+   L    
Sbjct: 810  VLSVLGRLFTNFITNTAFSCGMDDLRLTAEGNKDRKDLLKTSTDVGRQAAAEVTNLPTDT 869

Query: 742  -----DLYKRGKLETQPGCNEEQTLEA----KIGGLLSKVREEVGDVCIRELDNLNAPLI 792
                 +L KR + E     N+   L+A    K+  + SKV   V      +    N+   
Sbjct: 870  PSNDPELLKRLE-EILRDDNKSGILDAVTSSKVNSVTSKVVSTVIPKGTMKKFPQNSMQA 928

Query: 793  MATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFF 852
            MA  G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+
Sbjct: 929  MALSGAKGSTVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDSMAGGYIKGRFY 988

Query: 853  SGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQ 912
            SG+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDNTVR     +VQ
Sbjct: 989  SGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGIHVSYDNTVRDGDGTLVQ 1048

Query: 913  FTYGGDGLDPLNMEGNAKPVNFNRSWDHANNITYNHDDKGMLPYQILEETNAILHPLEQQ 972
            F YGGD +D       +    F+   ++ + +   ++   ++ +  L+  +A+ +  +  
Sbjct: 1049 FLYGGDAVDTTK---ESHMTQFDFCLENYDALLRKYNPSALVEH--LDVESALKYSKKAL 1103

Query: 973  LSRYDNVGNPLAPGLENEELY--IDQHDAEREFYQSLRTYMSEKARKLADITKSRGLKEL 1030
             SR           ++ E  Y   D++D     Y   + Y+   + K  D  K  G    
Sbjct: 1104 KSR---------KKIDKEPHYKNSDKYDPVLSKYNPAK-YLGSVSEKFQD--KLEGF--- 1148

Query: 1031 YHAPALELQLMDLDASCPEVDVKSVNQLCKISSKLVRTFLDIAISKYRKAKVEPGTAVGA 1090
                        LD+   ++ + S      I+ K  R  + +   KY ++ V PG AVG 
Sbjct: 1149 ------------LDSHSKQLKLHS-----GINEKKFRALMQL---KYMRSLVNPGEAVGI 1188

Query: 1091 IGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINATLVNDDD 1149
            I A S+GEP TQMTL TFHFAG  + NVTLG+PR++EI+  AS  I TP ++  + N   
Sbjct: 1189 IAAQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIVMTASAAIKTPQMSLPVWNHVS 1248

Query: 1150 ERAARVVKGRVEKTLLSDVI 1169
            +  A +    + K +LS+V+
Sbjct: 1249 DDQASIFCKSITKVVLSEVV 1268

 Score = 77.4 bits (189), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 49/167 (29%), Positives = 84/167 (50%), Gaps = 12/167 (7%)

Query: 1270 VVKGLPDISRAVINIRDDGKRELLVEGYGLRDV------MTTDGVVGYKTKTNHFLEVYD 1323
            V++ +P ISR +       +R L  EG   + +      +  DG+     ++N    V  
Sbjct: 1500 VIREVPHISRCIPGEPVGDRRMLTTEGVNFQAMWDQEMFIDVDGI-----RSNDVAAVLR 1554

Query: 1324 VLGIEAARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVL 1383
              G+EAAR +I+ EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S +
Sbjct: 1555 TYGVEAARNTIVYEINNVFSRYAISVSFRHLDLIADLMTRQGNYLAFNRQGMETSTSSFM 1614

Query: 1384 QLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMTIGTGSFKVV 1430
            ++ S+E T   L  A     ++ ++  S  I+LG+   +GTG+F V+
Sbjct: 1615 KM-SYETTCQFLTKAVLDNDREKLQSPSARIVLGKLNNVGTGAFDVL 1660

 Score = 49.3 bits (116), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 53/116 (45%), Gaps = 3/116 (2%)

Query: 13  ISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGVSSSQAECSTCHG 72
           IS ++F+  SA +I   S  +I    + D  +   P  GG  D  +G       C+TC  
Sbjct: 11  ISSVDFNVFSAEEIRNLSAKQITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CATCGL 67

Query: 73  TLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNEEDKRQFLSELR 128
               C GH GHI+L +P ++  +F      L+S C  C +  L   +  +F  +LR
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFSQLYIYLRSSCLYCHRFRLRSIEVNRFACKLR 123

>Kwal_26.6979 s26 complement(150350..155314) [4965 bp, 1654 aa] {ON}
            YOR341W (RPA190) - RNA polymerase I subunit 190 (alpha)
            [contig 46] FULL
          Length = 1654

 Score =  424 bits (1091), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 302/980 (30%), Positives = 500/980 (51%), Gaps = 125/980 (12%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK---------- 300
            R + +    +  PP   R PS + ++   ++++ L   L++I+ TS LI+          
Sbjct: 345  RADMFFLEVVIVPPTRFRLPSKLGEEIHENSQNQL---LSKILTTSLLIRDLNEEMSKLQ 401

Query: 301  ----AGLEKGISINNMMEQWDYLQMAVAMYINSDSVNPALMPGGNGGGKTKPIRGFCQRL 356
                +  +K +  N +M  +  +Q  V  +I+S          G+ GGK  PI G  Q L
Sbjct: 402  KDKVSAQDKIVIFNRLMNAFVTIQNDVNAFIDSTKAQ------GSAGGKV-PIPGVKQAL 454

Query: 357  KGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKHKLQ 416
            + K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LT+PE VT YN  +L+
Sbjct: 455  EKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAELR 514

Query: 417  QLIVNGANVHPGANYLLKKNEEARRNLRYG----DRIKLAKNL----------QIGDVVE 462
            Q ++NG +  PGA+ +  +NE+       G     R  LA  L           +   V 
Sbjct: 515  QAVINGPDKWPGASQI--QNEDGSLVSLVGMTTEQRKALANQLLTPSSHSSTHSLNKKVY 572

Query: 463  RHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVP 521
            RH+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H P
Sbjct: 573  RHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFP 632

Query: 522  QTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFVQMLSM 581
            Q E ARAEA NL    +  LTP SG P+    QD I+    ++ KDSFF R  + Q +  
Sbjct: 633  QNENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREEYQQYIYG 692

Query: 582  M---SDGNL---QFDIPPPAIMRPHYLWTGKQLFS-LLIKPNKKSPVIINLDAKNKVYIA 634
                 DG+    +    PPA+M+P  LWTGKQ+ + +L+         INL +KNK+   
Sbjct: 693  CIRPEDGHATRNKLVTVPPAVMKPVPLWTGKQIITTVLLNVTPADMPGINLISKNKI--- 749

Query: 635  PKNKAYPNEMSANDGYVVIRGSNILSGVMDKSVLGDGKKHSVFYTILRDFGPQEATQAMN 694
             KN  +    + ND  V+ +   +L G++DKS  G   K+ + +++   +GP  + + ++
Sbjct: 750  -KNDYWGKHSTEND--VIFKNGELLCGILDKSQYG-ASKYGIVHSLHEVYGPAVSAKVLS 805

Query: 695  RMAKLCARYLGNRGFSIGISDVT---PGVELKA----TKEEMVEIAYAKCDEL------- 740
             + +L   Y+    F+ G+ D+     G + ++    T  ++   A A+   L       
Sbjct: 806  VLGRLFTNYITATAFTCGMDDLRLTDDGNKWRSDILKTSTDVGRAAAAEVTNLDPDVSAN 865

Query: 741  -IDLYKRGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVCI-----RELDNLNAPLIMA 794
              +L KR + E     N+   L+A     ++ +  +V   C+     ++  N N+   MA
Sbjct: 866  DTELLKRLE-EILRDDNKLGILDAVTSSKVNTITSQVVSKCVPGGTMKKFPN-NSMQAMA 923

Query: 795  TCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSG 854
              G+KGSN+NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+SG
Sbjct: 924  LSGAKGSNVNVSQIMCLLGQQALEGRRVPVMISGKTLPSFKPFETDAMAGGYIKGRFYSG 983

Query: 855  LSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFT 914
            + P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR +   ++QF 
Sbjct: 984  IRPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDADGTLIQFL 1043

Query: 915  YGGDGLDPLNMEGNAKPVNFNRSWDHANNITYNHDDKGMLPYQILEETNAILHPLEQQLS 974
            YGG   D +++   +    F    D+ + +   ++   ++ +  L+  +A+ +  +   +
Sbjct: 1044 YGG---DAVDVTQESHMTEFKFCADNYDALLKKYNPSALIEH--LDVESALKYSKKALKN 1098

Query: 975  RYDNVGNPLAPGLENEELYIDQHDAEREFYQSLRTYMSEKARKLADITKSRGLKELYHAP 1034
            R  N   P              H A++  Y  + +  +  ++ L  ++++          
Sbjct: 1099 RKKNERVP--------------HFAQKVKYDPVVSKFN-PSKYLGSVSEN---------- 1133

Query: 1035 ALELQLMDLDASCPEVDVKSVNQLCK----ISSKLVRTFLDIAISKYRKAKVEPGTAVGA 1090
              + +L        E  + S N+L K    ++ K  R  + +   KY ++ + PG AVG 
Sbjct: 1134 -FQDKL--------ESFIDSNNELFKSRDSVNEKKFRALMQL---KYMRSLINPGEAVGI 1181

Query: 1091 IGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINATLVNDDD 1149
            I + S+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   ++ D  
Sbjct: 1182 IASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPILADVT 1241

Query: 1150 ERAARVVKGRVEKTLLSDVI 1169
            +  A      + K +LS+V+
Sbjct: 1242 DSQADTFCKSITKVMLSEVV 1261

 Score = 84.3 bits (207), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 89/168 (52%), Gaps = 2/168 (1%)

Query: 1270 VVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVVGYKTKT-NHFLEVYDVLGIE 1328
            V++ + +I R V    ++GKR L+ EG   +++   D  V     T N    V    G+E
Sbjct: 1487 VIREVKNIDRCVHPEPENGKRILVTEGVNFQEMWDQDAFVDVNGITSNDVSSVLKTYGVE 1546

Query: 1329 AARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1388
            AAR +I++EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1547 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-SY 1605

Query: 1389 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMTIGTGSFKVVKGTNIS 1436
            E T   L  A    + + ++  S  ++LG+   +GTG+F V+   + S
Sbjct: 1606 ETTCQFLTKAVLDNESENLDSPSARLVLGKLNNVGTGAFDVLAKVSAS 1653

 Score = 46.6 bits (109), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 53/116 (45%), Gaps = 3/116 (2%)

Query: 13  ISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGVSSSQAECSTCHG 72
           I+ ++F  ++A DI   S ++I    + D  +   P  GG  D  +G       C+TC  
Sbjct: 11  ITSVDFGVMTAQDIRNFSAMQITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CATCGL 67

Query: 73  TLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNEEDKRQFLSELR 128
               C GH GHI+L +P ++  +F      L+S C  C    L   +  ++  +L+
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFSQLYIYLRSSCLYCHGFRLKAPEVHRYACKLK 123

>TPHA0H02800 Chr8 (659254..664200) [4947 bp, 1648 aa] {ON} Anc_7.51
            YOR341W
          Length = 1648

 Score =  424 bits (1091), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 332/1103 (30%), Positives = 536/1103 (48%), Gaps = 157/1103 (14%)

Query: 247  TVKAGRPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK----- 300
            T K  + + +    +  PP   R PS +  +   ++++ L   L++I+ TS LI+     
Sbjct: 340  TGKIVKADDFFMDVVLVPPTRFRLPSKLGDEVHENSQNQL---LSKILTTSLLIRDLNDE 396

Query: 301  -AGLEKG--------ISINNMMEQWDYLQMAVAMYINSDSVNPALMPGGNGGGKTKPIRG 351
             + L+K         I  + +M  +  +Q  V  +I+S          GN  GK  P+ G
Sbjct: 397  ISKLQKDKVALDDRRIIFSRLMNAFVTIQNDVNSFIDSSKAQ------GNNSGKL-PVPG 449

Query: 352  FCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYN 411
              Q L+ K+G FR ++ GKRV+++ R+VISPDPN+  DE+ VP   A  LT+PE VT YN
Sbjct: 450  VKQALEKKEGLFRKHMMGKRVNYAARSVISPDPNIETDEIGVPPVFATKLTYPEPVTSYN 509

Query: 412  KHKLQQLIVNGANVHPGANYLLKKNEEARR----NLRYGDRIKLAKNLQ----------I 457
              +L+Q ++NG +  PGA  +  +NE+        +    R  LA  L           +
Sbjct: 510  IAELRQAVINGPDKWPGATQI--QNEDGSLVSLIGMTVEQRKALANQLMTPSSNPATHTL 567

Query: 458  GDVVERHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEM 516
               V RH+++ DVV+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEM
Sbjct: 568  NKKVYRHIKNRDVVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEM 627

Query: 517  NLHVPQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFV 576
            N+H PQ E ARAEA NL    +  LTP SG P+    QD I+    ++ KDS+F R  + 
Sbjct: 628  NMHFPQNENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSYFTREQYQ 687

Query: 577  QMLSMM---SDG---NLQFDIPPPAIMRPHYLWTGKQLFSLLIKPNKKSPVI---INLDA 627
            Q +       DG   N +    PPAI++P  LWTGKQ+ + ++     SPV    INL +
Sbjct: 688  QYIYGCIRPEDGHSANNKLLTIPPAIIKPVPLWTGKQIITTVLL--NVSPVDMPGINLKS 745

Query: 628  KNKVYIAPKNKAYPNEMSANDGYVVIRGSNILSGVMDKSVLGDGKKHSVFYTILRDFGPQ 687
            KNK+    K++ +      N+  V+ +   +L G++DKS  G   K+ + + +   +GP+
Sbjct: 746  KNKI----KDEYWGQHSEENE--VLFKDGALLCGILDKSQYG-ASKYGIVHALQEVYGPE 798

Query: 688  EATQAMNRMAKLCARYLGNRGFSIGISDVTPGVE--------LKAT----KEEMVEIAYA 735
             A + ++ + +L   Y+ N  F+ G+ D+    E        LK +    ++  VE+   
Sbjct: 799  VAAKVLSVLGRLFTNYITNTAFTCGMDDLRLTDEGNKWRTDILKTSVDRGRQAAVEVTNL 858

Query: 736  KCDELID---LYKRGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVCI----RELDNLN 788
            + D   D   L KR + E     N+   L+A     ++ +  +V   C+     +    N
Sbjct: 859  EKDTSADDSELLKRLE-EILRDDNKSGILDAVTSSKVNAITSQVVSKCVPGGTMKRFPEN 917

Query: 789  APLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVR 848
            +   MA  G+KGSN+NVSQ++ ++GQQ + G RVP     ++LP F        + G+++
Sbjct: 918  SMQSMALSGAKGSNVNVSQIMCLLGQQALEGRRVPIMVSGKTLPSFKPFETDAMAGGYIK 977

Query: 849  NSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSN 908
              F+SG+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDNTVR    
Sbjct: 978  GRFYSGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNTVRDGDG 1037

Query: 909  GIVQFTYGGDGLDPLNMEGNAKPVNFNRSWDHANNITYNHDDKGMLPYQILEETNAILHP 968
             +++F YGGD +D   +   +    F+   D+ +++   ++   ++ +  L+  +A+ + 
Sbjct: 1038 TLIEFLYGGDAVD---VTKESYMNQFDFCLDNYDSLLKRYNPAALIDF--LDVDSALKYS 1092

Query: 969  LEQQLSRYDNVGNPLAPGLENEELYIDQHDAEREFYQSLRTYMSEKARKLADITKSRGLK 1028
             +    R  N   P         L   ++D     Y   + Y+   + K  D      L+
Sbjct: 1093 KKTLKHRKKNKNVP-------HYLQNIKYDPVLAKYNPAK-YLGSVSEKFQD-----KLE 1139

Query: 1029 ELYHAPALELQLMDLDASCPEVDVKSVNQLCKISSKLVRTFLDIAISKYRKAKVEPGTAV 1088
                + +   QL     S  E   +++ QL     K +R+ ++            PG AV
Sbjct: 1140 NFLDSNS---QLFKSHKSVNEKKFRALMQL-----KYMRSLIN------------PGEAV 1179

Query: 1089 GAIGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINATLVND 1147
            G I + S+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   +++D
Sbjct: 1180 GIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPILDD 1239

Query: 1148 DDERAARVVKGRVEKTLLSDVI---------------------FYIQDVYRDNMSFLQVK 1186
              +  A +    + K +LS+VI                     FY QD Y +     + +
Sbjct: 1240 VTDDQADIFAKSISKVILSEVIDSVSVTETTTSQSRSYVISMKFYEQDEYNEEYDISKEE 1299

Query: 1187 VD-------LATIE-------KLQLELTVEDIAIAITSAPKLKISTGDVSIVGRNKININ 1232
            +        L ++E       K Q + T  D+ IAI   PK +++   V  +    +  N
Sbjct: 1300 LQNVVANNFLTSLEIAIHKEIKKQKKTTASDVGIAI---PKAQLALAAVEGLSSKVMEDN 1356

Query: 1233 VCNDLDKAKSISTLASEPHENDV 1255
                  K    +    EP E+++
Sbjct: 1357 DEEQSRKKTKQAVSYDEPDEDEI 1379

 Score = 89.4 bits (220), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 53/167 (31%), Positives = 89/167 (53%), Gaps = 12/167 (7%)

Query: 1270 VVKGLPDISRAVINIRDDGKRELLVEGYGLR------DVMTTDGVVGYKTKTNHFLEVYD 1323
            VV+ +P+I R V    ++GKR L+ EG   +      D +  DG+      +N    V  
Sbjct: 1481 VVRQVPNIDRCVHPNAENGKRVLVTEGVNFQAMWEQNDFVNVDGIT-----SNDVSSVLK 1535

Query: 1324 VLGIEAARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVL 1383
              G+EAAR +I++EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++
Sbjct: 1536 TYGVEAARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGSYLAFNRQGMETSTSSLM 1595

Query: 1384 QLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMTIGTGSFKVV 1430
            ++ S+E T   L  A    +++ +   S  I+LG+   +GTG+F V+
Sbjct: 1596 KM-SYETTCQFLTKAVLDNEREELNSPSARIVLGKLNNVGTGAFDVL 1641

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 53/116 (45%), Gaps = 3/116 (2%)

Query: 13  ISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGVSSSQAECSTCHG 72
           I+ ++FS LSA +I   S  +I    + D  +   P  GG  D  +G       CSTC  
Sbjct: 11  ITSVDFSILSAEEIRNLSTKQITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CSTCGL 67

Query: 73  TLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNEEDKRQFLSELR 128
               C GH GHI+L +P ++  +F      L+S C  C    L   +  ++  +L+
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSSCLFCHHFRLRSVEVHRYTCKLK 123

>YOR341W Chr15 (960987..965981) [4995 bp, 1664 aa] {ON}  RPA190RNA
            polymerase I largest subunit A190
          Length = 1664

 Score =  423 bits (1087), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 305/976 (31%), Positives = 487/976 (49%), Gaps = 117/976 (11%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI----------- 299
            + +++    L  PP   R PS + ++   ++++ L   L++++ TS LI           
Sbjct: 351  KADSFFMDVLVVPPTRFRLPSKLGEEVHENSQNQL---LSKVLTTSLLIRDLNDDLSKLQ 407

Query: 300  --KAGLE-KGISINNMMEQWDYLQMAVAMYINSDSVNPALMPGGNGGGKTKPIRGFCQRL 356
              K  LE + +  + +M  +  +Q  V  +I+S          G   GK  PI G  Q L
Sbjct: 408  KDKVSLEDRRVIFSRLMNAFVTIQNDVNAFIDSTKAQ------GRTSGKV-PIPGVKQAL 460

Query: 357  KGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKHKLQ 416
            + K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LT+PE VT YN  +L+
Sbjct: 461  EKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFAVKLTYPEPVTAYNIAELR 520

Query: 417  QLIVNGANVHPGANYLLKKNEEARR----NLRYGDRIKLAKNL----------QIGDVVE 462
            Q ++NG +  PGA  +  +NE+        +    R  LA  L           +   V 
Sbjct: 521  QAVINGPDKWPGATQI--QNEDGSLVSLIGMSVEQRKALANQLLTPSSNVSTHTLNKKVY 578

Query: 463  RHLEDGDVVLFNRQPSLHRLSILSHYAKIRP-WRTFRLNECVCTPYNADFDGDEMNLHVP 521
            RH+++ DVVL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H P
Sbjct: 579  RHIKNRDVVLMNRQPTLHKASMMGHKVRVLPNEKTLRLHYANTGAYNADFDGDEMNMHFP 638

Query: 522  QTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFVQMLSM 581
            Q E ARAEA+NL    +  LTP SG P+    QD I+    ++ KDSFF R  + Q +  
Sbjct: 639  QNENARAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYG 698

Query: 582  M---SDGNL---QFDIPPPAIMRPHYLWTGKQLFSLLIKPNKKSPVI--INLDAKNKVYI 633
                 DG+    +    PP I +P+ LWTGKQ+ + ++  N   P +  INL +KNK+  
Sbjct: 699  CIRPEDGHTTRSKIVTLPPTIFKPYPLWTGKQIITTVLL-NVTPPDMPGINLISKNKI-- 755

Query: 634  APKNKAYPNEMSANDGYVVIRGSNILSGVMDKSVLGDGKKHSVFYTILRDFGPQEATQAM 693
              KN+ +      N+  V+ +   +L G++DKS  G   K+ + +++   +GP+ A + +
Sbjct: 756  --KNEYWGKGSLENE--VLFKDGALLCGILDKSQYG-ASKYGIVHSLHEVYGPEVAAKVL 810

Query: 694  NRMAKLCARYLGNRGFSIGISDVTPGVE--------LKAT----KEEMVEIAYAKCDELI 741
            + + +L   Y+    F+ G+ D+    E        LK +    +E   E+     D   
Sbjct: 811  SVLGRLFTNYITATAFTCGMDDLRLTAEGNKWRTDILKTSVDTGREAAAEVTNLDKDTPA 870

Query: 742  D---LYKRGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVCIRELDNLNAPL----IMA 794
            D   L KR + E     N+   L+A     ++ +  +V   C+ +      P      MA
Sbjct: 871  DDPELLKRLQ-EILRDNNKSGILDAVTSSKVNAITSQVVSKCVPDGTMKKFPCNSMQAMA 929

Query: 795  TCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSG 854
              G+KGSN+NVSQ++ ++GQQ + G RVP     ++LP F        + G+V+  F+SG
Sbjct: 930  LSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGRFYSG 989

Query: 855  LSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFT 914
            + P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN++R +   +VQF 
Sbjct: 990  IKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSIRDADGTLVQFM 1049

Query: 915  YGGDGLDPLNMEGNAKPVNFNRSWDHANNITYNHDDKGMLPYQILEETNAILHPLEQQLS 974
            YGG   D +++   +    F    D+   +   ++   ++ +  +E   + L   ++ L 
Sbjct: 1050 YGG---DAIDITKESHMTQFEFCLDNYYALLKKYNPSALIEHLDVE---SALKYSKKTLK 1103

Query: 975  RYDNVGNPLAPGLENEELYIDQHDAEREFYQSLRTYMSEKARKLADITKSRGLKELYHAP 1034
                              Y  +H  E  + QS++         LA    ++ L       
Sbjct: 1104 ------------------YRKKHSKEPHYKQSVKY-----DPVLAKYNPAKYLG------ 1134

Query: 1035 ALELQLMDLDASCPEVDVKSVNQLCKISSKLVRTFLDIAISKYRKAKVEPGTAVGAIGAH 1094
            ++     D   S  + + K       ++ K  R  + +   KY ++ + PG AVG I + 
Sbjct: 1135 SVSENFQDKLESFLDKNSKLFKSSDGVNEKKFRALMQL---KYMRSLINPGEAVGIIASQ 1191

Query: 1095 SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINATLVNDDDERAA 1153
            S+GEP TQMTL TFHFAG  + NVTLG+PR++EI+  AS  I TP +   + ND  +  A
Sbjct: 1192 SVGEPSTQMTLNTFHFAGHGAANVTLGIPRLREIVMTASAAIKTPQMTLPIWNDVSDEQA 1251

Query: 1154 RVVKGRVEKTLLSDVI 1169
                  + K LLS+VI
Sbjct: 1252 DTFCKSISKVLLSEVI 1267

 Score = 85.5 bits (210), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 86/162 (53%), Gaps = 2/162 (1%)

Query: 1270 VVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVVGYKTKT-NHFLEVYDVLGIE 1328
            +++ +P I R V    ++GKR L+ EG   + +   +  +     T N    V    G+E
Sbjct: 1497 IIRQIPHIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIDVDGITSNDVAAVLKTYGVE 1556

Query: 1329 AARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1388
            AAR +I++EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S +++ S+
Sbjct: 1557 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSFMKM-SY 1615

Query: 1389 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMTIGTGSFKVV 1430
            E T   L  A    +++ ++  S  I++G+   +GTGSF V+
Sbjct: 1616 ETTCQFLTKAVLDNEREQLDSPSARIVVGKLNNVGTGSFDVL 1657

 Score = 45.8 bits (107), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 52/116 (44%), Gaps = 3/116 (2%)

Query: 13  ISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGVSSSQAECSTCHG 72
           I+ ++F  L+A +I   S  +I    + D  +   P  GG  D  +G       CSTC  
Sbjct: 11  ITSVDFGILTAKEIRNLSAKQITNPTVLD--NLGHPVSGGLYDLALGAFLRNL-CSTCGL 67

Query: 73  TLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNEEDKRQFLSELR 128
               C GH GHI+L +P ++  +F      L++ C  C    L   +  ++  +LR
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRASCLFCHHFRLKSVEVHRYACKLR 123

>KLLA0F23243g Chr6 (2165407..2170368) [4962 bp, 1653 aa] {ON} highly
            similar to uniprot|P10964 Saccharomyces cerevisiae
            YOR341W RPA190 RNA polymerase I subunit largest subunit
            of RNA polymerase I
          Length = 1653

 Score =  421 bits (1082), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 298/976 (30%), Positives = 488/976 (50%), Gaps = 113/976 (11%)

Query: 254  ETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK------------ 300
            + +    L  PP   R PS +  +   + ++ L   L++I+ TS LI+            
Sbjct: 353  DMFFMEVLIVPPTRFRLPSKLGDEVHENTQNQL---LSKILTTSLLIRDLNDEMSRLQKD 409

Query: 301  --AGLEKGISINNMMEQWDYLQMAVAMYINSDSVNPALMPGGNGGGKTKPIRGFCQRLKG 358
              +  ++ +  N +M  +  +Q  V  +I+S     +        G   PI G  Q L+ 
Sbjct: 410  KVSADDRKVIFNRLMNAFVTIQNDVNAFIDSTKAQSS-------SGNKVPIPGLKQALEK 462

Query: 359  KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKHKLQQL 418
            K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LT+PE VT YN  +L+Q 
Sbjct: 463  KEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTAYNVAELRQA 522

Query: 419  IVNGANVHPGANYLLKKNEEARR----NLRYGDRIKLAKNL----------QIGDVVERH 464
            ++NG +  PGA  +  +NE+        +    R  LA  L           I   V RH
Sbjct: 523  VINGPDKWPGATQI--QNEDGSFVSLVGMTLEQRKALANQLLTPSTHDVAHSINKKVYRH 580

Query: 465  LEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQT 523
            +++ DVV+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ 
Sbjct: 581  IKNRDVVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQN 640

Query: 524  EEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFVQMLSMM- 582
            E A+AEA+NL    +  LTP SG P+    QD I+    ++ KDSFF R  + Q +    
Sbjct: 641  ENAKAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGCI 700

Query: 583  --SDGNL---QFDIPPPAIMRPHYLWTGKQLFS-LLIKPNKKSPVIINLDAKNKVYIAPK 636
               DG+    +    PPA+M+P  LWTGKQ+ + +L+     +   INL++KNK+    K
Sbjct: 701  RPEDGHATRNKLVTIPPAVMKPEPLWTGKQIITTVLLNTCPANMPGINLNSKNKI----K 756

Query: 637  NKAYPNEMSANDGYVVIRGSNILSGVMDKSVLGDGKKHSVFYTILRDFGPQEATQAMNRM 696
            N+ +    S+ +  VV +   +L G++DKS  G   K  + +++   +GP  A + ++ +
Sbjct: 757  NEYWGK--SSEENNVVFKDGQLLCGILDKSQYG-ASKFGIVHSLHEVYGPDVAAKVLSVL 813

Query: 697  AKLCARYLGNRGFSIGISDVTPGVELKATKEEM----VEIAYAKCDELIDLYKR-----G 747
             +L   Y+    F+ G+ D+    E    + ++    V+I      E+ +L K      G
Sbjct: 814  GRLFTNYITATAFTCGMDDLRLTAEGNKWRNDILQTSVDIGRVAAAEVTNLDKDVKSDDG 873

Query: 748  KL-----ETQPGCNEEQTLEAKIGGLLSKVREEVGDVCIRELDNLNAPL----IMATCGS 798
            +L     E     N+   L+A     ++ +  +V   C+ +      P      MA  G+
Sbjct: 874  ELLKRLEEILRDDNKLGILDAITSSKVNSITSQVVSKCVPDGTMKKFPYNSMQAMALSGA 933

Query: 799  KGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLSPP 858
            KGSN+NVSQ++ ++GQQ + G RVP     ++LP F       ++ G+++  F+SG+ P 
Sbjct: 934  KGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDARAGGYIKGRFYSGIRPQ 993

Query: 859  EFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFTYGGD 918
            E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR     ++QF Y   
Sbjct: 994  EYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDGDGTLIQFLY--- 1050

Query: 919  GLDPLNMEGNAKPVNFNRSWDHANNITYNHDDKGMLPYQILEETNAILHPLEQQLSRYDN 978
            G D +++   +    F    D+ + +   ++   ++ +  L+  +A+ +  +   +R  N
Sbjct: 1051 GGDAVDITKESHMTEFKFCVDNYDALLKKYNPSALVDH--LDVESALKYSKKTLKNRKKN 1108

Query: 979  VGNPLAPGLENEELYIDQHDAEREFYQSLRTYMSEKARKLADITKSRGLKELYHAPALEL 1038
               P              H A+   Y  +          L+    S+ L  +  +   + 
Sbjct: 1109 SKLP--------------HYAQTSKYDPV----------LSKFNPSKYLGAV--SENFQD 1142

Query: 1039 QLMDLDASCPEVDVKSVNQLCKISSKLVRTFLDIAISKYRKAKVEPGTAVGAIGAHSIGE 1098
            +L    ++  +   K  N    ++ K  R  + +   KY ++ + PG AVG I + S+GE
Sbjct: 1143 KLEKFISTNDDFFKKDEN----VNEKKFRALMQL---KYMRSLINPGEAVGIIASQSVGE 1195

Query: 1099 PGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINATLVNDDDERAARVVK 1157
            P TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   + +D  +  A    
Sbjct: 1196 PSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQLTMPIRDDVSDELADTFC 1255

Query: 1158 GRVEKTLLSDVIFYIQ 1173
              + K +LS+VI  +Q
Sbjct: 1256 KNITKVMLSEVIDKVQ 1271

 Score = 85.1 bits (209), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 48/162 (29%), Positives = 87/162 (53%), Gaps = 2/162 (1%)

Query: 1270 VVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVVGYK-TKTNHFLEVYDVLGIE 1328
            +++ +P I R V    ++GKR L+ EG   + +   D  +     ++N    V    G+E
Sbjct: 1488 IIRQVPHIDRCVHPEPENGKRVLVTEGVNFQAMWDQDDFIDINGIRSNDVAAVLKTYGVE 1547

Query: 1329 AARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1388
            AAR +I++EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1548 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGNYLAFNRQGMESSTSSLMKM-SY 1606

Query: 1389 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMTIGTGSFKVV 1430
            E T   L  A    + + ++  S  I++G+   +GTGSF ++
Sbjct: 1607 ETTCQFLTKAVLDNEHEELKSPSAKIVMGKLNGVGTGSFDLL 1648

 Score = 48.9 bits (115), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 59/133 (44%), Gaps = 12/133 (9%)

Query: 13  ISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGVSSSQAECSTCHG 72
           I+ ++FS L++ +I   S  ++    + D  +   P +GG  D  +G       C+TC  
Sbjct: 11  ITSIDFSVLTSDEIRKLSAKQVTNPTVLD--NLGHPIQGGLYDLALGAFLKNL-CATCGL 67

Query: 73  TLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNEEDKRQFLSELR---- 128
               C GH GHI+L +P ++  +F      L+S C  C    L   +   +  +LR    
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSSCLFCHHFRLKSSEVHLYACKLRLLQY 127

Query: 129 -----RPGIDNLR 136
                R  IDN+R
Sbjct: 128 ALIDERYQIDNIR 140

>KAFR0K00540 Chr11 complement(114196..119184) [4989 bp, 1662 aa] {ON}
            Anc_7.51 YOR341W
          Length = 1662

 Score =  419 bits (1078), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 299/974 (30%), Positives = 491/974 (50%), Gaps = 136/974 (13%)

Query: 264  PPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK------AGLEKG--------IS 308
            PP   R PS + ++   ++++ L   L++I+ TS LI+      + L+K         I 
Sbjct: 362  PPTRFRLPSKLGEEVHENSQNQL---LSKILTTSLLIRDLNDEMSKLQKDKVSVDDRRII 418

Query: 309  INNMMEQWDYLQMAVAMYINSDSVNPALMPGGNGGGKTKPIRGFCQRLKGKQGRFRGNLS 368
             + +M  +  +Q  V  +I+S          GN  GK  P+ G  Q L+ K+G FR ++ 
Sbjct: 419  FSRLMNAFVTIQNDVNAFIDSTKAQ------GNTSGKV-PVPGVKQALEKKEGLFRKHMM 471

Query: 369  GKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKHKLQQLIVNGANVHPG 428
            GKRV+++ R+VISPDPN+  +E+ VP   A  LT+PE VT +N  +L+Q ++NG +  PG
Sbjct: 472  GKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSFNIAELRQAVINGPDKWPG 531

Query: 429  ANYLLKKNEEARR----NLRYGDRIKLAKNLQ-----------IGDVVERHLEDGDVVLF 473
            A  +  +NE+        +    R  LA  L            +   V RH+++ D+V+ 
Sbjct: 532  ATQI--QNEDGSLVSLIGMSAEQRKALANQLMTPTSHNGATHTLNKKVYRHIKNRDIVIM 589

Query: 474  NRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAIN 532
            NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ E ARAEA N
Sbjct: 590  NRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNENARAEAFN 649

Query: 533  LMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFVQMLSMM---SDGNL-- 587
            L    +  LTP SG P+    QD I+    +++KDSFF R  + Q +       DG+   
Sbjct: 650  LANTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSFFTREQYQQYIYGCIRPEDGHATR 709

Query: 588  -QFDIPPPAIMRPHYLWTGKQLFSLLIKPNKKSPVI--INLDAKNKVYIAPKNKAYPNEM 644
             +    PPA+M+P  LWTGKQ+ + ++  N   P +  INL + NK+    KN  +    
Sbjct: 710  AKLATVPPAVMKPVPLWTGKQIITTVLL-NITPPDMPGINLKSSNKI----KNDYWGK-- 762

Query: 645  SANDGYVVIRGSNILSGVMDKSVLGDGKKHSVFYTILRDFGPQEATQAMNRMAKLCARYL 704
             +N+  V+ +   +L G++DKS  G   K+ + + +   +GP  + +A++ + +L   Y+
Sbjct: 763  GSNENEVIFKNGELLCGILDKSQYG-ASKYGIIHCLHEVYGPDVSAKALSVLGRLFTNYI 821

Query: 705  GNRGFSIGISDVTPGVELKATKEEMVEI-------AYAKCDELI--------DLYKRGKL 749
                F+ G+ D+    E    ++E+++        A A+   L         +L KR + 
Sbjct: 822  TATAFTCGMDDLRLTEEGNKWRKEILKTSVDTGREAAAEVTNLPKDTPSNDPELLKRLE- 880

Query: 750  ETQPGCNEEQTLEAKIGGLLSKVREEVGDVCI-----RELDNLNAPLIMATCGSKGSNLN 804
            E     N+   L+A     ++ +  +V   C+     ++    N+   MA  G+KGSN+N
Sbjct: 881  EIIRDNNKSGILDAVTSSKVNTITSKVVSTCVPGGTMKKFPE-NSMQSMALSGAKGSNVN 939

Query: 805  VSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHA 864
            VSQ++ ++GQQ + G RVP     ++LP F       ++ G+++  F+SG+ P E+ FH 
Sbjct: 940  VSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDARAGGYIKGRFYSGIRPQEYYFHC 999

Query: 865  ISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFTYGGDGLDPLN 924
            ++GREGL+DTAVKTA +GY+ R L K LE +   YDN++R +   ++Q  YGG   D ++
Sbjct: 1000 MAGREGLIDTAVKTASSGYLQRCLTKQLEGVHVSYDNSIRDADGTLIQMLYGG---DAID 1056

Query: 925  MEGNAKPVNFNRSWDHANNITYNHDDKGMLPYQILEETNAILHPLEQQLSRYDNVGNPLA 984
            +   +    FN   ++ + +   ++   ++ +  +E     L   ++ L           
Sbjct: 1057 VTKESHLTKFNFCLENYDALLKKYNPSALIEHLDVE---TALKYSKKSLK---------- 1103

Query: 985  PGLENEELYIDQHDAEREFYQSLRTYMSEKARKLADITKSRGLKELYHAPALELQLMDLD 1044
                    Y  +H  E  + Q+++           D   S+      + PA  L      
Sbjct: 1104 --------YRKKHAKEAHYQQTVK----------YDPILSK------YNPAKYL------ 1133

Query: 1045 ASCPEVDVKSVNQLCKISSKLVRTFLDIAISKYR--------KAKVEPGTAVGAIGAHSI 1096
             S  E     +      +SKL+++  D+   K+R        ++ + PG AVG I + S+
Sbjct: 1134 GSVSENFQDQLENFLHDNSKLLKSHEDVNEKKFRALMQLKYMRSLINPGEAVGIIASQSV 1193

Query: 1097 GEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINATLVNDDDERAARV 1155
            GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   +++D  +  A  
Sbjct: 1194 GEPSTQMTLNTFHFAGHGAANVTLGIPRLREIIMTASAAIKTPQMTLPILDDVTDEQADT 1253

Query: 1156 VKGRVEKTLLSDVI 1169
                + K +LS+VI
Sbjct: 1254 FAKSISKVVLSEVI 1267

 Score = 88.2 bits (217), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 53/167 (31%), Positives = 89/167 (53%), Gaps = 12/167 (7%)

Query: 1270 VVKGLPDISRAVINIRDDGKRELLVEG------YGLRDVMTTDGVVGYKTKTNHFLEVYD 1323
            V++ +P I R V    ++GKR L+ EG      +   D +  DG+     ++N    V  
Sbjct: 1495 VIRQVPKIDRCVHPEPENGKRVLVTEGVNFNAMWDQEDFIDVDGI-----RSNDVSAVLK 1549

Query: 1324 VLGIEAARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVL 1383
              G+EAAR ++++EI+   S + +SV  RH+ LL D+MT +G  L   R G+     S++
Sbjct: 1550 TYGVEAARNTVVNEINNVFSRYAISVSFRHLDLLADMMTRQGTYLAFNRQGMETSTSSLM 1609

Query: 1384 QLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMTIGTGSFKVV 1430
            ++ S+E T   L  A    +++ +   S  I+LG+   +GTGSF V+
Sbjct: 1610 KM-SYETTCQFLTKAVLDNEREELNTPSARIVLGKLNNVGTGSFDVL 1655

 Score = 52.8 bits (125), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 55/116 (47%), Gaps = 3/116 (2%)

Query: 13  ISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGVSSSQAECSTCHG 72
           I+ ++FS L++ DI + S  +I    + D  +   P  GG  D  +G       C+TC  
Sbjct: 11  ITSVDFSILTSKDIRSLSAKQIINPTVLD--NLGHPISGGLYDLSLGAFLRNL-CTTCGL 67

Query: 73  TLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNEEDKRQFLSELR 128
               C GH GHI+L +PV++  +F      L+S C  C    L   +  +F  +L+
Sbjct: 68  DEKFCPGHVGHIELPVPVYNPLFFNQLYIYLRSSCLFCHHFRLKSAEVHRFALKLK 123

>TBLA0E01930 Chr5 (468692..473671) [4980 bp, 1659 aa] {ON} Anc_7.51
            YOR341W
          Length = 1659

 Score =  419 bits (1078), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 306/987 (31%), Positives = 486/987 (49%), Gaps = 141/987 (14%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI----------- 299
            +P+ +    +  PP   R PS +  +   + ++ L   L++I+ TS LI           
Sbjct: 353  KPDAFFMDVIVVPPTRFRLPSKLGDEVHENTQNQL---LSKILTTSLLIRDLNDEMSKLQ 409

Query: 300  --KAGLE-KGISINNMMEQWDYLQMAVAMYINSDSVNPALMPGGNGGGKTKPIRGFCQRL 356
              K  LE + +  + +M  +  +Q  V  +I+S          GN GG    I G  Q L
Sbjct: 410  KDKVSLEDRRVIFSRLMNAFVTIQNDVNSFIDSSKAQ------GNTGG-NDVIPGVKQAL 462

Query: 357  KGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKHKLQ 416
            + K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LT+PE VT YN  +L+
Sbjct: 463  EKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFAVKLTYPEPVTSYNIAELR 522

Query: 417  QLIVNGANVHPGANYLLKKNEEARR----NLRYGDRIKLAKNLQ----------IGDVVE 462
            Q ++NG +  PGA  +  +NE+        +    R  LA  L           +   V 
Sbjct: 523  QAVINGPDKWPGA--IQIQNEDGTLVSLIGMTLEQRKALANQLMTPSSNSSSHVLNKKVY 580

Query: 463  RHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVP 521
            RH+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H P
Sbjct: 581  RHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFP 640

Query: 522  QTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFVQMLSM 581
            Q E ARAE++ L    +  LTP SG P+    QD I+    +++KDSFF R  + Q +  
Sbjct: 641  QNENARAESLFLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSFFTREQYQQYIYG 700

Query: 582  M---SDGNL---QFDIPPPAIMRPHYLWTGKQLFS-LLIKPNKKSPVIINLDAKNKVYIA 634
                 DG+    +    PP I +P  LWTGKQ+ + +L+         INL +KNK+   
Sbjct: 701  CIRPEDGHATRAKIVTLPPTIFKPIPLWTGKQIITTVLLNITPSDMPGINLHSKNKI--- 757

Query: 635  PKNKAYPNEMSANDGYVVIRGSNILSGVMDKSVLGDGKKHSVFYTILRDFGPQEATQAMN 694
             KN+ +     +N+  V+ +   +L G++DK+  G  K + + +++   +GP  A + ++
Sbjct: 758  -KNEYWGK--GSNENEVIFKDGALLCGILDKNQYGSSK-YGIVHSLHELYGPDVAAKVLS 813

Query: 695  RMAKLCARYLGNRGFSIGISDVTPGVE--------LKAT----KEEMVEIAYAKCDELID 742
             + +L   Y+    F+ G+ D+    E        LK +    ++   E+     D   D
Sbjct: 814  VLGRLFTNYITATAFTCGMDDLRLTDEGNKWRRDILKTSVDTGRQAAAEVTNLSKDTPAD 873

Query: 743  ---LYKRGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVCI----RELDNLNAPLIMAT 795
               L KR + E     N+   L+A     ++ +  +V   C+     +    N+   MA 
Sbjct: 874  DPELLKRLE-EILRDDNKSGILDAVTSSKVNAITSKVVSTCVPGGTMKKFPYNSMQAMAL 932

Query: 796  CGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGL 855
             G+KGSN+NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+SG+
Sbjct: 933  SGAKGSNVNVSQIMCLLGQQALEGRRVPTMVSGKTLPSFKPYETDAMAGGYIKGRFYSGI 992

Query: 856  SPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFTY 915
             P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDNTVR     +++F Y
Sbjct: 993  KPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNTVRDGDGTLIEFLY 1052

Query: 916  GGDGLDPL-------------NMEGNAKPVNFNRSWDHANNITYNHDDKGMLPYQILEET 962
            GGD +D               N +G  K  N +   +H N  +     K  L Y+  ++ 
Sbjct: 1053 GGDAVDVTKESYMTQFKFCLENYDGLVKKYNPSALIEHLNVESALKYSKKALKYR--KKH 1110

Query: 963  NAILHPLEQQLSRYDNVGNPLAPGLENEELYIDQHDAEREFYQSLRTYMSEKARKLADIT 1022
            +++ H L  Q S+YD V     P       Y+       +F   L  +++E ++    + 
Sbjct: 1111 SSVPHYL--QNSKYDPVLAKYNPS-----KYLGS--VSEKFQDKLEEFLNENSKL---VK 1158

Query: 1023 KSRGLKELYHAPALELQLMDLDASCPEVDVKSVNQLCKISSKLVRTFLDIAISKYRKAKV 1082
             + G+ E                                  K  R  + +   KY ++ +
Sbjct: 1159 STEGVNE----------------------------------KKFRALMQL---KYMRSLI 1181

Query: 1083 EPGTAVGAIGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIIN 1141
            +PG +VG I + S+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +N
Sbjct: 1182 DPGESVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASSSIKTPQMN 1241

Query: 1142 ATLVNDDDERAARVVKGRVEKTLLSDV 1168
              ++ND   + A      + K LLS V
Sbjct: 1242 LPILNDVSNQQAETFCKSITKVLLSQV 1268

 Score = 91.7 bits (226), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 51/162 (31%), Positives = 86/162 (53%), Gaps = 2/162 (1%)

Query: 1270 VVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVVGY-KTKTNHFLEVYDVLGIE 1328
            V++ +P+I R V    ++G R L+ EG   + +   D  +   K  +N    V    G+E
Sbjct: 1492 VIREVPNIERCVYPEANNGDRSLITEGVNFQAMWDQDTFIDVDKITSNDVSAVLRTYGVE 1551

Query: 1329 AARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1388
            AAR +I++EID   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1552 AARNTIVNEIDRVFSTYAISVSSRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-SY 1610

Query: 1389 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMTIGTGSFKVV 1430
            E T   L  A    + + +   S  I+LG+   +GTGSF ++
Sbjct: 1611 ETTCQFLTKAVLDNEHEELNSPSARIVLGKLNNVGTGSFDIL 1652

 Score = 46.2 bits (108), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 50/116 (43%), Gaps = 3/116 (2%)

Query: 13  ISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGVSSSQAECSTCHG 72
           I+ ++F  LS+  I   S  +I    + D  +   P  GG  D  +G       CSTC  
Sbjct: 11  ITSVDFEILSSDQIRNLSAKQITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CSTCGQ 67

Query: 73  TLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNEEDKRQFLSELR 128
               C GH GHI+L +P ++  +F      L+S C  C    L   D   +  +L+
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLFIYLRSSCLYCHHFRLKSLDTHLYSCKLK 123

>Skud_15.506 Chr15 (901437..906434) [4998 bp, 1665 aa] {ON} YOR341W
            (REAL)
          Length = 1665

 Score =  419 bits (1078), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 299/979 (30%), Positives = 490/979 (50%), Gaps = 117/979 (11%)

Query: 249  KAGRPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI-------- 299
            K  + +++    +  PP   R PS +  +   ++++ L   L++++ TS LI        
Sbjct: 348  KVVKADSFFMDVIVVPPTRFRLPSKLGDEVHENSQNQL---LSKVLTTSLLIRDLNDDLS 404

Query: 300  -----KAGLE-KGISINNMMEQWDYLQMAVAMYINSDSVNPALMPGGNGGGKTKPIRGFC 353
                 K  LE + +  + +M  +  +Q  V  +I+S          G   GK  PI G  
Sbjct: 405  KLQKDKVSLEDRKVIFSRLMNAFVTIQNDVNAFIDSTKAQ------GRTSGKV-PIPGVK 457

Query: 354  QRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKH 413
            Q L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LT+PE VT YN  
Sbjct: 458  QALEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFAVKLTYPEPVTAYNIA 517

Query: 414  KLQQLIVNGANVHPGANYLLKKNEEARR----NLRYGDRIKLAKNL----------QIGD 459
            +L+Q ++NG +  PGA  +  +NE+        + +  R  LA  L           +  
Sbjct: 518  ELRQAVINGPDKWPGATQI--QNEDGSLVSLIGMSFEQRKALANQLLTPSSNVSTHTLNK 575

Query: 460  VVERHLEDGDVVLFNRQPSLHRLSILSHYAKIRP-WRTFRLNECVCTPYNADFDGDEMNL 518
             V RH+++ DVVL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+
Sbjct: 576  KVYRHIKNRDVVLMNRQPTLHKASMMGHKVRVLPNEKTLRLHYANTGAYNADFDGDEMNM 635

Query: 519  HVPQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFVQM 578
            H PQ E ARAEA+NL    +  LTP SG P+    QD I+    ++ KDSFF R  + Q 
Sbjct: 636  HFPQNENARAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQY 695

Query: 579  LSMM---SDGNL---QFDIPPPAIMRPHYLWTGKQLFSLLIKPNKKSPVI--INLDAKNK 630
            +       DG+    +    PP I +P+ LWTGKQ+ + ++  N   P +  INL +KNK
Sbjct: 696  IYGCIRPEDGHTTRSKIVTLPPTIFKPYPLWTGKQIITTVLL-NVTPPDMPGINLISKNK 754

Query: 631  VYIAPKNKAYPNEMSANDGYVVIRGSNILSGVMDKSVLGDGKKHSVFYTILRDFGPQEAT 690
            +    KN+ +     + +  V+ +   +L G++DKS  G   K+ + +++   +GP+ A 
Sbjct: 755  I----KNEYWGK--GSLESEVLFKDGALLCGILDKSQYG-ASKYGIVHSLHEVYGPEVAA 807

Query: 691  QAMNRMAKLCARYLGNRGFSIGISDVTPGVELKATKEEMVEI-------AYAKCDEL--- 740
            + ++ + +L   Y+    F+ G+ D+    E    + ++++        A A+   L   
Sbjct: 808  KVLSVLGRLFTNYITATAFTCGMDDLRLTAEGNKWRTDILKTSVDTGRQAAAEVTNLDKE 867

Query: 741  -----IDLYKRGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVCIRELDNLNAPL---- 791
                  +L KR + E     N+   L+A     ++ +  +V   C+ +      P     
Sbjct: 868  TPSDDPELLKRLQ-EILRDNNKSGILDAVTSSKVNVITSQVVSKCVPDGTMKKFPCNSMQ 926

Query: 792  IMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSF 851
             MA  G+KGSN+NVSQ++ ++GQQ + G RVP     ++LP F        + G+V+  F
Sbjct: 927  AMALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGRF 986

Query: 852  FSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIV 911
            +SG+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN++R +   ++
Sbjct: 987  YSGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSIRDADGTLI 1046

Query: 912  QFTYGGDGLDPLNMEGNAKPVNFNRSWDHANNITYNHDDKGMLPYQILEETNAILHPLEQ 971
            QF YGG   D +++   +    F    D+   +   ++   ++ +  +E   + L   ++
Sbjct: 1047 QFMYGG---DAVDITKESHMTQFEFCLDNYYALLKKYNPSALIEHLDVE---SALKYSKK 1100

Query: 972  QLSRYDNVGNPLAPGLENEELYIDQHDAEREFYQSLRTYMSEKARKLADITKSRGLKELY 1031
             L                   Y  +H  E  + QS++         LA  + ++ L    
Sbjct: 1101 TLK------------------YRKKHSKEPHYKQSMKY-----DPVLAKYSPAKYLG--- 1134

Query: 1032 HAPALELQLMDLDASCPEVDVKSVNQLCKISSKLVRTFLDIAISKYRKAKVEPGTAVGAI 1091
               ++     D   S  + + K       ++ K  R  + +   KY ++ + PG AVG I
Sbjct: 1135 ---SVSENFQDKLESFLDENSKLFKSTDGVNEKKFRALMQL---KYMRSLINPGEAVGII 1188

Query: 1092 GAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINATLVNDDDE 1150
             + S+GEP TQMTL TFHFAG  + NVTLG+PR++EI+  AS  I TP +   + +D  +
Sbjct: 1189 ASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRLREIVMTASAAIKTPQMTLPIWDDVSD 1248

Query: 1151 RAARVVKGRVEKTLLSDVI 1169
              A      + K LLS+VI
Sbjct: 1249 EQADTFCKSISKVLLSEVI 1267

 Score = 85.9 bits (211), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 50/162 (30%), Positives = 86/162 (53%), Gaps = 2/162 (1%)

Query: 1270 VVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVVGYKTKT-NHFLEVYDVLGIE 1328
            +++ +P I R V    ++GKR L+ EG   + +   +  +     T N    V    G+E
Sbjct: 1498 IIRQIPRIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIDVDGITSNDVAAVLKTYGVE 1557

Query: 1329 AARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1388
            AAR +I++EI+   S + +SV  RH+ LL D+MT +G  L   R G+     S +++ S+
Sbjct: 1558 AARNTIVNEINNVFSRYAISVSFRHLDLLADMMTRQGTYLAFNRQGMETSTSSFMKM-SY 1616

Query: 1389 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMTIGTGSFKVV 1430
            E T   L  A    +++ ++  S  I++G+   +GTGSF V+
Sbjct: 1617 ETTCQFLTKAVLDNEREQLDSPSARIVVGKLNNVGTGSFDVL 1658

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 52/116 (44%), Gaps = 3/116 (2%)

Query: 13  ISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGVSSSQAECSTCHG 72
           I+ ++F  L+A +I   S  +I    + D  +   P  GG  D  +G       CSTC  
Sbjct: 11  ITSVDFGILTAKEIRNLSAKQITNPTVLD--NLGHPVSGGLYDLALGAFLRNL-CSTCGL 67

Query: 73  TLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNEEDKRQFLSELR 128
               C GH GHI+L +P ++  +F      L++ C  C    L   +  ++  +LR
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRASCLFCHHFRLKSVEVHRYACKLR 123

>NDAI0H01200 Chr8 complement(280165..285174) [5010 bp, 1669 aa] {ON}
            Anc_7.51
          Length = 1669

 Score =  419 bits (1077), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 314/980 (32%), Positives = 489/980 (49%), Gaps = 149/980 (15%)

Query: 264  PPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK------AGLEKG-ISINN---- 311
            PP   R PS +  +   ++++ L   L++I+ T+ LI+      + L+K  +S+++    
Sbjct: 366  PPTRFRLPSKLGDEIHENSQNQL---LSKILTTALLIRDLNDEMSKLQKDKVSVDDRRVI 422

Query: 312  ---MMEQWDYLQMAVAMYINSDSVNPALMPGGNGGGKTKPIRGFCQRLKGKQGRFRGNLS 368
               +M  +  +Q  V  +I+S          G  GGK  PI G  Q L+ K+G FR ++ 
Sbjct: 423  FSRLMNAFVTIQNDVNAFIDSTKAQ------GTTGGKV-PIPGVKQALEKKEGLFRKHMM 475

Query: 369  GKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKHKLQQLIVNGANVHPG 428
            GKRV+++ R+VISPDPN+  +E+ VP   A  LT+PE VT YN  +L+Q ++NG +  PG
Sbjct: 476  GKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAELRQAVINGPDKWPG 535

Query: 429  ANYLLKKNEEARR----NLRYGDRIKLAKNLQ----------IGDVVERHLEDGDVVLFN 474
            A  +  +NE+        +    R  LA  L           +   V RH+++ D+V+ N
Sbjct: 536  AAQI--QNEDGSLVSLVGMSAEQRKALANQLMTPSSNVGTHTLNKKVYRHIKNRDIVIMN 593

Query: 475  RQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINL 533
            RQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ E ARAEA NL
Sbjct: 594  RQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNENARAEAFNL 653

Query: 534  MGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFVQMLSMM---SDGNL--- 587
                +  LTP SG P+    QD I+    ++ KDSFF R  + Q +       DG+    
Sbjct: 654  ANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGCIRPEDGHATRP 713

Query: 588  QFDIPPPAIMRPHYLWTGKQLFS-LLIKPNKKSPVIINLDAKNKVYIAPKNKAYPNEMSA 646
            +    PP I +P  LWTGKQ+ S +L+         INL + NK+    KN+ +    S+
Sbjct: 714  KLITLPPTIYKPVPLWTGKQIISTVLLNVTPADMPGINLTSSNKI----KNEYWGK--SS 767

Query: 647  NDGYVVIRGSNILSGVMDKSVLGDGKKHSVFYTILRDFGPQEATQAMNRMAKLCARYLGN 706
            N+  V+ +   +L G++DKS  G   K  + +++   +GP  A + ++ + +L   Y+ +
Sbjct: 768  NENEVLFKNGELLCGILDKSQYG-ASKFGIVHSLHEVYGPSIAAKVLSVLGRLFTNYIMS 826

Query: 707  RGFSIGISDVTPGVE--------LKAT----KEEMVEIAYAKCDELID---LYKRGKLET 751
              F+ G+ D+    E        LK +    +E   E+     D   D   L KR + E 
Sbjct: 827  TAFTCGMDDLRLSEEGNKWRSDILKTSVDTGREAAAEVTNLDKDTAADDAELLKRLE-EI 885

Query: 752  QPGCNEEQTLEA----KIGGLLSKVREE-VGDVCIRELDNLNAPLIMATCGSKGSNLNVS 806
                N+   L+A    K+  + SKV  + V D  +++    N+   MA  G+KGSN+NVS
Sbjct: 886  LRDNNKSGILDAVTSSKVNSITSKVVSKCVPDGTMKKFP-YNSMQAMALSGAKGSNVNVS 944

Query: 807  QMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAIS 866
            Q++ ++GQQ + G RVP     ++LP F        + G+++  F+SG+ P E+ FH ++
Sbjct: 945  QIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYIKGRFYSGIKPQEYYFHCMA 1004

Query: 867  GREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFTYGGDGLDPLNME 926
            GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR     ++QF YGGD +D +  E
Sbjct: 1005 GREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSVRDGDGTLIQFLYGGDAVD-VTKE 1063

Query: 927  GNAKPVNFNRSWDHANNITYNHDDKGMLPYQILEETNAILHPLEQQLSRYDNVGNPLAPG 986
             +    +F                        L+  +A+L           N  NP A  
Sbjct: 1064 SHMTEFDF-----------------------CLDNYDALL-----------NKYNPSA-- 1087

Query: 987  LENEELYIDQHDAEREFYQSLRTYMSEKARKLADITKSRGLKELYHAPALELQLMDLDAS 1046
                   I+  D E     S +T  + K          +  KE +H  A +   + L   
Sbjct: 1088 ------LIEHLDVETALKYSKKTLKNRK----------KHAKEAHHKNATKYDPV-LSKF 1130

Query: 1047 CPEVDVKSVNQ--------LCKISSKLVRTFLDIAISKYR--------KAKVEPGTAVGA 1090
             P   + SV++            +SKL ++  +++  K+R        ++ + PG AVG 
Sbjct: 1131 NPAKYLGSVSEKFQDKLESYLDKNSKLFKSHDNVSEKKFRALMQLKYMRSLINPGEAVGI 1190

Query: 1091 IGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINATLVNDDD 1149
            I + S+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   +  D  
Sbjct: 1191 IASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPIWQDVS 1250

Query: 1150 ERAARVVKGRVEKTLLSDVI 1169
            +  A      + K +LS+VI
Sbjct: 1251 DEQADTFCKSISKVVLSEVI 1270

 Score = 86.3 bits (212), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 86/162 (53%), Gaps = 2/162 (1%)

Query: 1270 VVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVVGYKTKT-NHFLEVYDVLGIE 1328
            +++ +P I R V    ++GKR L+ EG     +   +  +     T N    V    G+E
Sbjct: 1502 IIREVPHIDRCVHPEPENGKRVLVTEGVNFEAMWDQEAFIDVDGITSNDVASVLKTYGVE 1561

Query: 1329 AARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1388
            AAR +I++EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1562 AARNTIVNEINNVFSRYAISVSYRHLDLIADMMTRQGTYLAFNRQGMESSTSSLMKM-SY 1620

Query: 1389 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMTIGTGSFKVV 1430
            E T   L  A    +++ +E  S  I++G+   +GTGSF ++
Sbjct: 1621 ETTLQFLTKAVLDNEREELESPSARIVMGKLNNVGTGSFDIL 1662

 Score = 46.6 bits (109), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 54/116 (46%), Gaps = 3/116 (2%)

Query: 13  ISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGVSSSQAECSTCHG 72
           I+ ++F  L++ +I   S  +I    + D  +   P  GG  D  +G       CS+C  
Sbjct: 11  ITSVDFGILTSEEIRQLSAKQITNPTVLD--NLGHPISGGLYDLSLGAFLRNL-CSSCGL 67

Query: 73  TLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNEEDKRQFLSELR 128
               C GH GHI+L +P ++  +F      L++ C  C  L L + +  +F  +LR
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRTSCLFCHHLKLKQIEVHRFACKLR 123

>NCAS0F00730 Chr6 complement(143500..148524) [5025 bp, 1674 aa] {ON}
            Anc_7.51 YOR341W
          Length = 1674

 Score =  416 bits (1069), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 294/921 (31%), Positives = 458/921 (49%), Gaps = 123/921 (13%)

Query: 304  EKGISINNMMEQWDYLQMAVAMYINSDSVNPALMPGGNGGGKTKPIRGFCQRLKGKQGRF 363
            ++ I  + +M  +  +Q  V  +I+S          G  GGK  PI G  Q L+ K+G F
Sbjct: 423  DRRIIFSRLMNAFVTIQNDVNAFIDSTKAQ------GTAGGKL-PIPGVKQALEKKEGLF 475

Query: 364  RGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKHKLQQLIVNGA 423
            R ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LT+PE VT YN  +L+Q ++NG 
Sbjct: 476  RKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAELRQAVINGP 535

Query: 424  NVHPGANYLLKKNEEARR----NLRYGDRIKLAKNLQ----------IGDVVERHLEDGD 469
            +  PGA  +  +NE+        +    R  LA  L           +   V RH+++ D
Sbjct: 536  DKWPGATQI--QNEDGSLVSLIGMSTEQRKALANQLMTPSSNITTHTLNKKVYRHIKNRD 593

Query: 470  VVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQTEEARA 528
            +V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ E ARA
Sbjct: 594  IVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNENARA 653

Query: 529  EAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFVQMLSMM---SDG 585
            EA NL    +  LTP SG P+    QD I+    ++ KDSFF R  + Q +       DG
Sbjct: 654  EASNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGCIRPEDG 713

Query: 586  NL---QFDIPPPAIMRPHYLWTGKQLFS-LLIKPNKKSPVIINLDAKNKVYIAPKNKAYP 641
            +    +    PP I +P  LWTGKQ+ S +L+     +   INL + NK+    KN+ + 
Sbjct: 714  HATRSKLITMPPTIHKPVPLWTGKQIISTVLLNITPANMPGINLKSSNKI----KNEYWG 769

Query: 642  NEMSANDGYVVIRGSNILSGVMDKSVLGDGKKHSVFYTILRDFGPQEATQAMNRMAKLCA 701
                 N+  V+ +   +L G++DKS  G   K  + +++   +GP  A + ++ + +L  
Sbjct: 770  TGSQENE--VLFKNGELLCGILDKSQYG-ASKFGIVHSLHEVYGPSVAAKVLSVLGRLFT 826

Query: 702  RYLGNRGFSIGISDVTPGVE--------LKAT----KEEMVEIAYAKCDELI---DLYKR 746
             Y+ +  F+ G+ D+    E        LK +    +E   E+     D      +L KR
Sbjct: 827  NYIMSTAFTCGMDDLRLTEEGNKWRSDILKTSVDTGREAAAEVTNLDKDTPANDPELLKR 886

Query: 747  GKLETQPGCNEEQTLEA----KIGGLLSKVREE-VGDVCIRELDNLNAPLIMATCGSKGS 801
             + E     N+   L+A    K+  + SKV  + V D  +++    N+   MA  G+KGS
Sbjct: 887  LQ-EILRDNNKSGILDAVTSSKVNSITSKVVSKCVPDGTMKKFP-YNSMQAMALSGAKGS 944

Query: 802  NLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLSPPEFL 861
            N+NVSQ++ ++GQQ + G RVP     ++LP F        + G+V+  F+SG+ P E+ 
Sbjct: 945  NVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGRFYSGIKPQEYY 1004

Query: 862  FHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFTYGGDGLD 921
            FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR +   ++QF YGGD +D
Sbjct: 1005 FHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGIHISYDNSVRDTDGTLIQFLYGGDAVD 1064

Query: 922  PLNMEGNAKPVNFNRSWDHANNITYNHDDKGMLPYQILEET------------NAILHPL 969
               +   +    F+   D+ + +   ++   ++ +  +E                I  P 
Sbjct: 1065 ---VTKESHMTEFDFCLDNYDALLNKYNPSALIEHLDVESALKYSKKSLKNRKKHIKEPH 1121

Query: 970  EQQLSRYDNVGNPLAPGLENEELYIDQHDAEREFYQSLRTYMSEKARKLADITKSRGLKE 1029
             +Q  +YD V +   P       Y+       +F   L  Y+ + ++             
Sbjct: 1122 YKQNIKYDPVLSKFNPA-----KYLGS--VSEKFQDKLEGYLDKNSK------------- 1161

Query: 1030 LYHAPALELQLMDLDASCPEVDVKSVNQLCKISSKLVRTFLDIAISKYRKAKVEPGTAVG 1089
                      L     S  E   +++ QL     K +R+ ++            PG AVG
Sbjct: 1162 ----------LFKSHDSVNEKKFRALMQL-----KYMRSLIN------------PGEAVG 1194

Query: 1090 AIGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINATLVNDD 1148
             I + S+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   + ND 
Sbjct: 1195 IIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPIWNDV 1254

Query: 1149 DERAARVVKGRVEKTLLSDVI 1169
             +  A      + K +LS+VI
Sbjct: 1255 SDEQADTFCKSISKVVLSEVI 1275

 Score = 85.5 bits (210), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 48/162 (29%), Positives = 86/162 (53%), Gaps = 2/162 (1%)

Query: 1270 VVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVVGYKTKT-NHFLEVYDVLGIE 1328
            +++ +P I R +    ++GKR L+ EG     +   +  +     T N    V    G+E
Sbjct: 1505 IIREVPHIDRCIHPEPENGKRVLVTEGVNFEAMWDQEAFIDVDGITSNDVASVLKTYGVE 1564

Query: 1329 AARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1388
            AAR +I++EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1565 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMESSTSSLMKM-SY 1623

Query: 1389 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMTIGTGSFKVV 1430
            E T   L  A    +++ +E  S  I++G+   +GTGSF ++
Sbjct: 1624 ETTLQFLTKAVLDNEREELESPSARIVMGKLNNVGTGSFDIL 1665

 Score = 47.4 bits (111), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 53/116 (45%), Gaps = 3/116 (2%)

Query: 13  ISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGVSSSQAECSTCHG 72
           I+ ++F  L++ +I   S  +I    + D  +   P  GG  D  +G       CSTC  
Sbjct: 11  ITSVDFGILTSDEIRQLSAKQITNPTVLD--NLGHPITGGLYDLSLGAFLRNL-CSTCGL 67

Query: 73  TLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNEEDKRQFLSELR 128
               C GH GHI+L +P ++  +F      L++ C  C    L   +  +F S+LR
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRTSCLFCHHFRLRSIEVHRFASKLR 123

>Smik_15.519 Chr15 (910592..915589) [4998 bp, 1665 aa] {ON} YOR341W
            (REAL)
          Length = 1665

 Score =  414 bits (1064), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 300/988 (30%), Positives = 480/988 (48%), Gaps = 141/988 (14%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI----------- 299
            + +++    +  PP   R PS + ++   ++++ L   L++++ TS LI           
Sbjct: 351  KADSFFMDVIVVPPTRFRLPSKLGEEVHENSQNQL---LSKVLTTSLLIRDLNDDLSKLQ 407

Query: 300  --KAGLE-KGISINNMMEQWDYLQMAVAMYINSDSVNPALMPGGNGGGKTKPIRGFCQRL 356
              K  LE + +  + +M  +  +Q  V  +I+S          G   GK  P+ G  Q L
Sbjct: 408  KDKVSLEDRRVIFSRLMNAFVTIQNDVNAFIDSTKAQ------GRTSGKV-PVPGVKQAL 460

Query: 357  KGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKHKLQ 416
            + K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LT+PE VT YN  +L+
Sbjct: 461  EKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFAVKLTYPEPVTAYNIAELR 520

Query: 417  QLIVNGANVHPGANYLLKKNEEARR----NLRYGDRIKLAKNL----------QIGDVVE 462
            Q ++NG +  PGA  +  +NE+        +    R  LA  L           +   V 
Sbjct: 521  QAVINGPDKWPGATQI--QNEDGSLVSLIGMSLEQRKALANQLLTPSSNVSTHTLNKKVY 578

Query: 463  RHLEDGDVVLFNRQPSLHRLSILSHYAKIRP-WRTFRLNECVCTPYNADFDGDEMNLHVP 521
            RH+++ DVVL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H P
Sbjct: 579  RHIKNRDVVLMNRQPTLHKASMMGHKVRVLPNEKTLRLHYANTGAYNADFDGDEMNMHFP 638

Query: 522  QTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFVQMLSM 581
            Q E ARAEA+NL    +  LTP SG P+    QD I+    ++ KDSFF R  + Q +  
Sbjct: 639  QNENARAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYG 698

Query: 582  M---SDGNL---QFDIPPPAIMRPHYLWTGKQLFSLLIKPNKKSPVI--INLDAKNKVYI 633
                 DG+    +    PP I +P+ LWTGKQ+ + ++  N   P +  INL +KNK+  
Sbjct: 699  CIRPEDGHTTRSKIVTLPPTIFKPYPLWTGKQIITTVLL-NVTPPDMPGINLLSKNKI-- 755

Query: 634  APKNKAYPNEMSANDGYVVIRGSNILSGVMDKSVLGDGKKHSVFYTILRDFGPQEATQAM 693
              KN+ +      N+  V+ +   +L G++DKS  G   K+ + +++   +GP+ A + +
Sbjct: 756  --KNEYWGKGSLENE--VLFKDGALLCGILDKSQYG-ASKYGIVHSLHEVYGPEVAAKVL 810

Query: 694  NRMAKLCARYLGNRGFSIGISDVTPGVE--------LKAT----KEEMVEIAYAKCDELI 741
            + + +L   Y+    F+ G+ D+    E        LK +    ++   E+     D   
Sbjct: 811  SVLGRLFTNYITATAFTCGMDDLRLTAEGNKWRTDILKTSVDTGRQAAAEVTNLDKDTPA 870

Query: 742  D---LYKRGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVCIRELDNLNAPL----IMA 794
            D   L KR + E     N+   L+A     ++ +  +V   C+ +      P      MA
Sbjct: 871  DDPELLKRLQ-EILRDNNKSGILDAVTSSKVNSITSQVVSKCVPDGTMKKFPYNSMQAMA 929

Query: 795  TCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSG 854
              G+KGSN+NVSQ++ ++GQQ + G RVP     ++LP F        + G+V+  F+SG
Sbjct: 930  LSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGRFYSG 989

Query: 855  LSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFT 914
            + P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN++R +   +VQF 
Sbjct: 990  IKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSIRDADGTLVQFM 1049

Query: 915  YGGDGLDPLNMEGNAKPVNFNRSWDHANNITYNHDDKGMLPYQILEET------------ 962
            Y   G D +++   +    F    D+   +   ++   ++ +  +E              
Sbjct: 1050 Y---GGDAIDITKESHMTQFEFCLDNYYALLKKYNPSALIEHLDVESALKYSKKTLKYRK 1106

Query: 963  NAILHPLEQQLSRYDNVGNPLAPGLENEELYIDQHDAEREFYQSLRTYMSEKARKLADIT 1022
              I  P  +Q  +YD V     P                ++  S+     +K     D  
Sbjct: 1107 KHIKEPHYKQSIKYDPVLAKYNPA---------------KYLGSVSENFQDKLESFLD-- 1149

Query: 1023 KSRGLKELYHAPALELQLMDLDASCPEVDVKSVNQLCKISSKLVRTFLDIAISKYRKAKV 1082
              +G K    A                           ++ K  R  + +   KY ++ +
Sbjct: 1150 --KGSKLFKSADG-------------------------VNEKKFRALMQL---KYMRSLI 1179

Query: 1083 EPGTAVGAIGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIIN 1141
             PG AVG I + S+GEP TQMTL TFHFAG  + NVTLG+PR++EI+  AS  I TP + 
Sbjct: 1180 NPGEAVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRLREIVMTASAAIKTPQMT 1239

Query: 1142 ATLVNDDDERAARVVKGRVEKTLLSDVI 1169
              + +D  +  A      + K LLS+VI
Sbjct: 1240 LPIWDDVSDEQADTFCKSISKVLLSEVI 1267

 Score = 85.1 bits (209), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 86/162 (53%), Gaps = 2/162 (1%)

Query: 1270 VVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVVGYKTKT-NHFLEVYDVLGIE 1328
            +++ +P I R V    ++GKR L+ EG   + +   +  +     T N    V    G+E
Sbjct: 1498 IIRQIPHIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIDVDGITSNDVAAVLKTYGVE 1557

Query: 1329 AARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1388
            AAR +I++EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S +++ S+
Sbjct: 1558 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSFMKM-SY 1616

Query: 1389 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMTIGTGSFKVV 1430
            E T   L  A    +++ ++  S  I++G+   +GTGSF V+
Sbjct: 1617 ETTCQFLTKAVLDNEREQLDSPSARIVVGKLNNVGTGSFDVL 1658

 Score = 45.8 bits (107), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 52/116 (44%), Gaps = 3/116 (2%)

Query: 13  ISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGVSSSQAECSTCHG 72
           I+ ++F  L+A +I   S  +I    + D  +   P  GG  D  +G       CSTC  
Sbjct: 11  ITSVDFGILTAKEIRNLSAKQITNPTVLD--NLGHPVSGGLYDLALGAFLRNL-CSTCGL 67

Query: 73  TLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNEEDKRQFLSELR 128
               C GH GHI+L +P ++  +F      L++ C  C    L   +  ++  +LR
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRASCLFCHHFRLKSVEVHRYACKLR 123

>ADR374C Chr4 complement(1372609..1377531) [4923 bp, 1640 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YOR341W
            (RPA190)
          Length = 1640

 Score =  413 bits (1061), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 301/975 (30%), Positives = 489/975 (50%), Gaps = 115/975 (11%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI----------- 299
            + + +    +  PP   R PS +  +   + ++ L   L++I+ TS LI           
Sbjct: 331  KADMFFMEVIVVPPTRFRLPSKLGDEVHENTQNQL---LSKILTTSLLIRDLNEEMSKLQ 387

Query: 300  --KAGLE-KGISINNMMEQWDYLQMAVAMYINSDSVNPALMPGGNGGGKTKPIRGFCQRL 356
              K  LE + I  N +M  +  +Q  V  +I+S          G+ GGK  PI G  Q L
Sbjct: 388  KDKVSLEDRKIIFNRLMNAFVTIQNDVNAFIDSTKAQ------GSTGGKV-PIPGVKQAL 440

Query: 357  KGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKHKLQ 416
            + K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LT+PE VT YN  +++
Sbjct: 441  EKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTAYNIAEMR 500

Query: 417  QLIVNGANVHPGANYLLKKNEEARR----NLRYGDRIKLAKNLQ----------IGDVVE 462
            Q ++NG +  PGA  +  +NE+        +    R  LA  L           +   V 
Sbjct: 501  QAVINGPDKWPGATQI--QNEDGSLVSLVGMTSDQRKALANQLMTPSTHGSTHTLNKKVY 558

Query: 463  RHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVP 521
            RH+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H P
Sbjct: 559  RHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFP 618

Query: 522  QTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFVQMLSM 581
            Q E AR+EA  L    +  LTP SG P+    QD I+    +++KDSFF R  + Q +  
Sbjct: 619  QNENARSEAFTLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSFFTREQYQQYIYG 678

Query: 582  M---SDGNL---QFDIPPPAIMRPHYLWTGKQLFS-LLIKPNKKSPVIINLDAKNKVYIA 634
                 DG+    +    PPA+++P  LWTGKQ+ + +L+         INL +KNK+   
Sbjct: 679  CIRPEDGHASRSKIITVPPAVVKPVPLWTGKQIITTVLLNATPADIPGINLVSKNKI--- 735

Query: 635  PKNKAYPNEMSANDGYVVIRGSNILSGVMDKSVLGDGKKHSVFYTILRDFGPQEATQAMN 694
             KN+ +      N+  V+ +   +L G++DKS  G   K+ + +++   +GP  +++ ++
Sbjct: 736  -KNEYWGKSSYENE--VIFKNGALLCGILDKSQYG-ASKYGIVHSLHELYGPDVSSKVLS 791

Query: 695  RMAKLCARYLGNRGFSIGISDVTPGVELKATKEEMV----EIAYAKCDELI--------- 741
             + +L   Y+ +  F+ G+ D+    E    + +++    +I  A   E+          
Sbjct: 792  ILGRLFTNYITSTAFTCGMDDLRLTDEGNKWRIDILKKSTDIGRAAAAEVTNLGGDVRPD 851

Query: 742  --DLYKRGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVCIRELDNLNAPL----IMAT 795
              +L KR + E     N+   L+A     ++ +  EV   C+ +      P      MA 
Sbjct: 852  DAELLKRLE-EILRDDNKLGILDAVTSSKVNTITSEVVSKCVPDGTMKKFPYNSMQAMAL 910

Query: 796  CGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGL 855
             G+KGSN+NVSQ++ ++GQQ + G RVP     ++LP F       ++ G+++  F+SG+
Sbjct: 911  SGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDAKAGGYIKGRFYSGI 970

Query: 856  SPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFTY 915
             P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDNTVR     +VQF Y
Sbjct: 971  KPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNTVRDGDGTLVQFLY 1030

Query: 916  GGDGLDPLNMEGNAKPVNFNRSWDHANNITYNHDDKGMLPYQILEETNAILHPLEQQLSR 975
            GGD +D +  E +     F    D+ + +   ++   ++  Q L+  +A+ +  +   +R
Sbjct: 1031 GGDAID-VTKESHMSEFKF--CVDNYDALLKRYNPSALI--QHLDVESALKYSKKAMKNR 1085

Query: 976  YDNVGNPLAPGLENEELYIDQHDAEREFYQSLRTYMSEKARKLADITKSRGLKELYHAPA 1035
              N+  P     +  +  + +++  + F  S+     +K     D   S           
Sbjct: 1086 KKNLNLPHYARHDKYDPVLSKYNPSK-FLGSVSENFQDKLESFIDSNAS----------- 1133

Query: 1036 LELQLMDLDASCPEVDVKSVNQLCKISSKLVRTFLDIAISKYRKAKVEPGTAVGAIGAHS 1095
                L    A+  E   +++ QL                 KY ++ + PG AVG I + S
Sbjct: 1134 ----LFKGQATVNEKKFRALMQL-----------------KYMRSLINPGEAVGIIASQS 1172

Query: 1096 IGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINATLVNDDDERAAR 1154
            +GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   ++ D  +  A 
Sbjct: 1173 VGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPILPDVTDETAD 1232

Query: 1155 VVKGRVEKTLLSDVI 1169
            +      K +LS+VI
Sbjct: 1233 IFCKNTTKVILSEVI 1247

 Score = 86.3 bits (212), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 89/162 (54%), Gaps = 2/162 (1%)

Query: 1270 VVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVVGYKTKT-NHFLEVYDVLGIE 1328
            V+K +P+I R V    ++GKR L+ EG   + +   +  +     T N    V    G+E
Sbjct: 1473 VIKEVPNIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIDVNGITSNDVSAVLKTYGVE 1532

Query: 1329 AARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1388
            AAR +I++EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1533 AARNTIVNEINNVFSRYAISVSYRHLDLIADMMTRQGTYLAFNRQGMESSTSSLMKM-SY 1591

Query: 1389 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMTIGTGSFKVV 1430
            E T   L  A    +++ ++  S  ++LG+  ++GTG+F ++
Sbjct: 1592 ETTCQFLTKAVLDNEREELKSPSAKLVLGKLNSVGTGAFDIL 1633

 Score = 50.1 bits (118), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 54/116 (46%), Gaps = 3/116 (2%)

Query: 13  ISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGVSSSQAECSTCHG 72
           IS ++FS +SA++I A S  +I    + D      P +GG  D  +G       C+TC  
Sbjct: 11  ISSVDFSVMSAAEIRALSVKQITNPTVLD--HLGHPIRGGLYDLSLGAFLRNL-CATCGL 67

Query: 73  TLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNEEDKRQFLSELR 128
               C GH GHI+L +P +   +F      L+S C  C    L   +  ++  +L+
Sbjct: 68  DEKFCSGHQGHIELPVPCYSPLFFNQLYIYLRSSCLYCHHFRLKAVEVHRYACKLK 123

>Suva_8.391 Chr8 (702691..707688) [4998 bp, 1665 aa] {ON} YOR341W
            (REAL)
          Length = 1665

 Score =  412 bits (1058), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 299/976 (30%), Positives = 485/976 (49%), Gaps = 117/976 (11%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI----------- 299
            + +++    +  PP   R PS +  +   ++++ L   L++++ T+ LI           
Sbjct: 351  KADSFFMDVIVVPPTRFRLPSKLGDEVHENSQNQL---LSKVLTTALLIRDLNDDLSKLQ 407

Query: 300  --KAGLE-KGISINNMMEQWDYLQMAVAMYINSDSVNPALMPGGNGGGKTKPIRGFCQRL 356
              K  LE + +  + +M  +  +Q  V  +I+S          G   GK  PI G  Q L
Sbjct: 408  KDKVSLEDRRVIFSRLMNAFVTIQNDVNAFIDSTKAQ------GRTSGKV-PIPGVKQAL 460

Query: 357  KGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKHKLQ 416
            + K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LT+PE VT YN  +L+
Sbjct: 461  EKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFAVKLTYPEPVTAYNIAELR 520

Query: 417  QLIVNGANVHPGANYLLKKNEEARR----NLRYGDRIKLAKNL----------QIGDVVE 462
            Q ++NG +  PGA  +  +NE+        +    R  LA  L           +   V 
Sbjct: 521  QAVINGPDKWPGATQI--QNEDGSLVSLIGMSLEQRKALANQLLTPSSNVSTHTLNKKVY 578

Query: 463  RHLEDGDVVLFNRQPSLHRLSILSHYAKIRP-WRTFRLNECVCTPYNADFDGDEMNLHVP 521
            RH+++ DVVL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H P
Sbjct: 579  RHIKNRDVVLMNRQPTLHKASMMGHKVRVLPNEKTLRLHYANTGAYNADFDGDEMNMHFP 638

Query: 522  QTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFVQMLSM 581
            Q E ARAEA+NL    +  LTP SG P+    QD I+    ++ KDSFF R  + Q +  
Sbjct: 639  QNENARAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYG 698

Query: 582  M---SDGNL---QFDIPPPAIMRPHYLWTGKQLFSLLIKPNKKSPVI--INLDAKNKVYI 633
                 DG+    +    PPAI +P+ LWTGKQ+ + ++  N   P +  INL + NK+  
Sbjct: 699  CIRPEDGHTTRNKIITLPPAIFKPYPLWTGKQIITTVLL-NVTPPDMPGINLISTNKI-- 755

Query: 634  APKNKAYPNEMSANDGYVVIRGSNILSGVMDKSVLGDGKKHSVFYTILRDFGPQEATQAM 693
              KN+ +      N+  V+ +   +L G++DKS  G   K+ + +++   +GP+ A + +
Sbjct: 756  --KNEYWGKGSLENE--VLFKDGALLCGILDKSQYG-ASKYGIVHSLHEVYGPEVAAKVL 810

Query: 694  NRMAKLCARYLGNRGFSIGISDVTPGVE--------LKAT----KEEMVEIAYAKCDELI 741
            + + +L   Y+    F+ G+ D+    E        LK +    ++   E+     D   
Sbjct: 811  SVLGRLFTNYITATAFTCGMDDLRLTAEGNKWRTDILKTSVDTGRQAAAEVTNLNKDTPA 870

Query: 742  D---LYKRGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVCIRELDNLNAPL----IMA 794
            D   L KR + E     N+   L+A     ++ +  +V   C+ +      P      MA
Sbjct: 871  DDAELLKRLQ-EILRDNNKSGILDAVTSSKVNVITSQVVSKCVPDGTMKKFPCNSMQAMA 929

Query: 795  TCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSG 854
              G+KGSN+NVSQ++ ++GQQ + G RVP     ++LP F        + G+V+  F+SG
Sbjct: 930  LSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGRFYSG 989

Query: 855  LSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFT 914
            + P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN++R +   +VQF 
Sbjct: 990  IKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSIRDADGTLVQFM 1049

Query: 915  YGGDGLDPLNMEGNAKPVNFNRSWDHANNITYNHDDKGMLPYQILEETNAILHPLEQQLS 974
            Y   G D +++   +    F    D+   +   ++   ++ +  +E   + L   ++ L 
Sbjct: 1050 Y---GGDAVDITKESHMTQFEFCLDNYYALLKKYNPSALIEHLDVE---SALKYSKKTLK 1103

Query: 975  RYDNVGNPLAPGLENEELYIDQHDAEREFYQSLRTYMSEKARKLADITKSRGLKELYHAP 1034
                              Y  +H  E  + Q+++         LA    ++ L       
Sbjct: 1104 ------------------YRKKHSKEPHYKQAVKY-----DPVLAKYNPAKYLG------ 1134

Query: 1035 ALELQLMDLDASCPEVDVKSVNQLCKISSKLVRTFLDIAISKYRKAKVEPGTAVGAIGAH 1094
            ++     D   S  + + K       ++ K  R  + +   KY ++ + PG AVG I + 
Sbjct: 1135 SVSENFQDKLESFLDKNSKLFKSADGVNEKKFRALMQL---KYMRSLINPGEAVGIIASQ 1191

Query: 1095 SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINATLVNDDDERAA 1153
            S+GEP TQMTL TFHFAG  + NVTLG+PR++EI+  AS  I TP +   + +D  +  A
Sbjct: 1192 SVGEPSTQMTLNTFHFAGHGAANVTLGIPRLREIVMTASSAIKTPQMTLPIWDDVSDEQA 1251

Query: 1154 RVVKGRVEKTLLSDVI 1169
                  + K LLS+VI
Sbjct: 1252 DTFCKSISKVLLSEVI 1267

 Score = 84.0 bits (206), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 48/162 (29%), Positives = 86/162 (53%), Gaps = 2/162 (1%)

Query: 1270 VVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVVGYKTKT-NHFLEVYDVLGIE 1328
            +++ +P I R V    ++GKR L+ EG   + +   +  +     T N    V    G+E
Sbjct: 1498 IIRQIPRIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIDVDGITSNDVAAVLRTYGVE 1557

Query: 1329 AARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1388
            AAR ++++EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S +++ S+
Sbjct: 1558 AARNTVVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSFMKM-SY 1616

Query: 1389 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMTIGTGSFKVV 1430
            E T   L  A    +++ ++  S  I++G+   +GTGSF V+
Sbjct: 1617 ETTCQFLTKAVLDNEREQLDSPSARIVVGRLNNVGTGSFDVL 1658

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 52/116 (44%), Gaps = 3/116 (2%)

Query: 13  ISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGVSSSQAECSTCHG 72
           I+ ++F  L+A +I   S  +I    + D  +   P  GG  D  +G       CSTC  
Sbjct: 11  ITSVDFGILTAKEIRNLSAKQITNPTVLD--NLGHPVSGGLYDLALGAFLRNL-CSTCGL 67

Query: 73  TLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNEEDKRQFLSELR 128
               C GH GHI+L +P ++  +F      L++ C  C    L   +  ++  +L+
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRASCLFCHHFRLKSVEVHRYACKLK 123

>SAKL0B10736g Chr2 (925889..930841) [4953 bp, 1650 aa] {ON} highly
            similar to uniprot|P10964 Saccharomyces cerevisiae
            YOR341W RPA190 RNA polymerase I subunit largest subunit
            of RNA polymerase I
          Length = 1650

 Score =  407 bits (1046), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 302/975 (30%), Positives = 488/975 (50%), Gaps = 115/975 (11%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK------AGLE 304
            + + +    +  PP   R PS +  +   + ++ L   L++I+ TS LI+      + L+
Sbjct: 340  KADMFFMEVVVVPPTRFRLPSKLGDEVHENTQNQL---LSKILTTSLLIRDLNDEMSKLQ 396

Query: 305  KG--------ISINNMMEQWDYLQMAVAMYINSDSVNPALMPGGNGGGKTKPIRGFCQRL 356
            K         +  N +M  +  +Q  V  +I+           GN GGK  PI G  Q L
Sbjct: 397  KDKVSVDDRKVIFNRLMNAFVTIQNDVNAFIDVTKAQ------GNTGGKV-PIPGVKQAL 449

Query: 357  KGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKHKLQ 416
            + K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LT+PE VT YN  +L+
Sbjct: 450  EKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTAYNIAELR 509

Query: 417  QLIVNGANVHPGANYLLKKNEEARR----NLRYGDRIKLAKNLQ----------IGDVVE 462
            Q ++NG +  PGA  +  +NE+        +    R  LA  L           +   V 
Sbjct: 510  QAVINGPDKWPGATQI--QNEDGSLVSLIGMTLEQRKALANQLMTPSTHNSTHILNKKVY 567

Query: 463  RHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVP 521
            RH+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H P
Sbjct: 568  RHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFP 627

Query: 522  QTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFVQMLSM 581
            Q E ARAEA NL    +  LTP SG P+    QD I+    ++ KDSFF R  + Q +  
Sbjct: 628  QNENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYG 687

Query: 582  M---SDGNL---QFDIPPPAIMRPHYLWTGKQLFSLLIKPNKKSPVI--INLDAKNKVYI 633
                 DG+    +    PPA+++P  LWTGKQ+ + ++  N   P +  INL +KNK+  
Sbjct: 688  CIRPEDGHATRNKIVTVPPAVVKPVPLWTGKQIITTVLL-NSTPPEMPGINLISKNKI-- 744

Query: 634  APKNKAYPNEMSANDGYVVIRGSNILSGVMDKSVLGDGKKHSVFYTILRDFGPQEATQAM 693
              KN+ +     +N+  V+ +   +L G++DKS  G   K  + +++   +GP  A + +
Sbjct: 745  --KNEYWGE--GSNESEVIFKNGELLCGILDKSQYG-ASKFGIVHSLHEVYGPDIAGKVL 799

Query: 694  NRMAKLCARYLGNRGFSIGISDVTPGVELKATKEEM----VEIAYAKCDELIDLYKRGKL 749
            + + +L   Y+    F+ G+ D+    E    + E+    V+I  A   E+ +L    K 
Sbjct: 800  SVLGRLFTNYITATAFTCGMDDLRLTEEGNKWRTEILKTSVDIGRAAAAEVTNLEGDVKA 859

Query: 750  ----------ETQPGCNEEQTLEAKIGGLLSKVREEVGDVCIRELDNLNAPL----IMAT 795
                      E     N+   L+A     ++ +  +V   C+ +      P      MA 
Sbjct: 860  DDPELLKRLEEILRDDNKLGILDAVTSSKVNVITSQVVSKCVPDGTMKKFPYNSMQAMAL 919

Query: 796  CGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGL 855
             G+KGSN+NVSQ++ ++GQQ + G RVP     ++LP F       ++ G+++  F+SG+
Sbjct: 920  SGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDARAGGYIKGRFYSGI 979

Query: 856  SPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFTY 915
             P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDNTVR     ++QF Y
Sbjct: 980  RPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNTVRDGDGTLIQFLY 1039

Query: 916  GGDGLDPLNMEGNAKPVNFNRSWDHANNITYNHDDKGMLPYQILEETNAILHPLEQQLSR 975
            GGD +D   +   +    F    D+ + +   ++   ++ +  L+  +A+ +  +   +R
Sbjct: 1040 GGDAVD---VTKESHMTEFKFCVDNYDALLKKYNPSALIEH--LDVESALKYSKKAMKNR 1094

Query: 976  YDNVGNPLAPGLENEELYIDQHDAEREFYQSLRTYMSEKARKLADITKSRGLKELYHAPA 1035
              N   P        +  + +++  + +  S+     +K  K  D + S+ LK       
Sbjct: 1095 KKNEKIPHYAHNIKYDPVLSKYNPSK-YLGSVSENFQDKLEKFID-SNSKLLK------- 1145

Query: 1036 LELQLMDLDASCPEVDVKSVNQLCKISSKLVRTFLDIAISKYRKAKVEPGTAVGAIGAHS 1095
                      S   V+ K    L ++  K +R+ ++            PG AVG I + S
Sbjct: 1146 ----------SKDNVNEKKFRALMQL--KYMRSLIN------------PGEAVGIIASQS 1181

Query: 1096 IGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINATLVNDDDERAAR 1154
            +GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   ++ D  +  A 
Sbjct: 1182 VGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPILPDVTDDQAD 1241

Query: 1155 VVKGRVEKTLLSDVI 1169
                 + K +LS+VI
Sbjct: 1242 TFCKSITKVMLSEVI 1256

 Score = 85.9 bits (211), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 87/162 (53%), Gaps = 2/162 (1%)

Query: 1270 VVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVVGYKTKT-NHFLEVYDVLGIE 1328
            V+  +P+I R V    ++GKR L+ EG   + +   +  +     T N    V    G+E
Sbjct: 1483 VITEVPNIDRCVHPEPENGKRVLVTEGVNFQSMWDQEAFIDVNGITSNDVASVLKTYGVE 1542

Query: 1329 AARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASF 1388
            AAR +I++EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1543 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMESSTSSLMKM-SY 1601

Query: 1389 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMTIGTGSFKVV 1430
            E T   L  A    +++ ++  S  I++G+   +GTGSF ++
Sbjct: 1602 ETTCQFLTKAVLDNEREELKSPSAKIVMGKLNGVGTGSFDIL 1643

 Score = 46.2 bits (108), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 52/116 (44%), Gaps = 3/116 (2%)

Query: 13  ISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGVSSSQAECSTCHG 72
           I  ++FS L+A +I   S  +I    + D  +   P  GG  D  +G       C+TC  
Sbjct: 11  IISVDFSVLTAQEIRKLSAKQITNPTVLD--NLGHPISGGLYDLSLGAFLRNL-CATCGL 67

Query: 73  TLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNEEDKRQFLSELR 128
               C GH GHI+L +P ++  +F      L+S C  C    L   +  ++  +L+
Sbjct: 68  DEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSSCLYCHHFRLKTSEVHRYACKLK 123

>KNAG0D04970 Chr4 (905179..910194) [5016 bp, 1671 aa] {ON} Anc_7.51
            YOR341W
          Length = 1671

 Score =  360 bits (923), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 237/715 (33%), Positives = 373/715 (52%), Gaps = 77/715 (10%)

Query: 264  PPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK------AGLEKG--------IS 308
            PP   R PS M ++   ++++ L   L++I+ T+ LI+      + L+K         I 
Sbjct: 367  PPTRFRLPSKMGEEIHENSQNQL---LSKILTTALLIRDLNDEMSKLQKDKVSVDDRRII 423

Query: 309  INNMMEQWDYLQMAVAMYINSDSVNPALMPGGNGGGKTKPIRGFCQRLKGKQGRFRGNLS 368
             + +M  +  +Q  V  +I+S          G+ GG   P+ G  Q L+ K+G FR ++ 
Sbjct: 424  FSRLMNGFVTIQNDVNAFIDSTKAQ------GSTGGNV-PVPGVKQALEKKEGLFRKHMM 476

Query: 369  GKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKHKLQQLIVNGANVHPG 428
            GKRV+++ R+VISPDPN+  +E+ VP   A  LT+PE VT YN  +L+Q ++NG +  PG
Sbjct: 477  GKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAELRQAVINGPDKWPG 536

Query: 429  ANYLLKKNEEARR----NLRYGDRIKLAKNLQ-----------IGDVVERHLEDGDVVLF 473
            A  L  +NE+        +    R  LA  L            +   V RH+++ D+V+ 
Sbjct: 537  A--LQIQNEDGSLVSLIGMTLEQRKALANQLMTPSYVGGATHTLNKKVYRHIKNRDIVIM 594

Query: 474  NRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAIN 532
            NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ E ARAEA N
Sbjct: 595  NRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNENARAEAFN 654

Query: 533  LMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFVQMLSMM---SDGNL-- 587
            L    +  LTP SG P+    QD I+    ++ KDSFF R  + Q +       DG+   
Sbjct: 655  LANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGCIRPEDGHATR 714

Query: 588  -QFDIPPPAIMRPHYLWTGKQLFS-LLIKPNKKSPVIINLDAKNKVYIAPKNKAYPNEMS 645
             +    PPA+ +P  LWTGKQ+ + +L+         INL + NK+    KN+ +     
Sbjct: 715  PKLVTVPPAVWKPVPLWTGKQIITTVLLNVTPADMPGINLKSNNKI----KNEYWGKSSE 770

Query: 646  ANDGYVVIRGSNILSGVMDKSVLGDGKKHSVFYTILRDFGPQEATQAMNRMAKLCARYLG 705
             N+  V+ +   +L G++DK+  G   K+ + +++   +GP  A + ++ + +L   Y+ 
Sbjct: 771  ENE--VLFKNGELLCGILDKNQYG-ASKYGIVHSLHEVYGPDIAAKVLSVLGRLFTNYIM 827

Query: 706  NRGFSIGISDVTPGVE--------LKAT----KEEMVEIAYAKCDELID---LYKRGKLE 750
               F+ G+ D+    E        LK +    +E   E+   + D   D   L KR + E
Sbjct: 828  ATAFTCGMDDLRLTAEGNKWRKDILKTSVDTGREAAAEVTNLEKDTTADDPELLKRLQ-E 886

Query: 751  TQPGCNEEQTLEAKIGGLLSKVREEVGDVCIRELDNLNAPL----IMATCGSKGSNLNVS 806
                 N+   L+A     ++ +  +V   C+ +      P      MA  G+KGSN+NVS
Sbjct: 887  VLRDNNKSGILDAVTSSKVNAITSKVVSTCVPDGTMKKFPYNSMQAMALSGAKGSNVNVS 946

Query: 807  QMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAIS 866
            Q++ ++GQQ + G RVP     ++LP F        + G+V+  F+SG+ P E+ FH ++
Sbjct: 947  QIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGRFYSGIKPQEYYFHCMA 1006

Query: 867  GREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFTYGGDGLD 921
            GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR     ++QF YGGD +D
Sbjct: 1007 GREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSVRDGDGTLIQFLYGGDAVD 1061

 Score = 95.9 bits (237), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 69/110 (62%), Gaps = 4/110 (3%)

Query: 1061 ISSKLVRTFLDIAISKYRKAKVEPGTAVGAIGAHSIGEPGTQMTLKTFHFAGVASMNVTL 1120
            IS K  R  + +   KY ++ + PG AVG I + S+GEP TQMTL TFHFAG  + NVTL
Sbjct: 1166 ISEKKFRALMQL---KYMRSLINPGEAVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTL 1222

Query: 1121 GVPRIKEII-NASKVISTPIINATLVNDDDERAARVVKGRVEKTLLSDVI 1169
            G+PR++EII  AS  I TP +   +++D  ++ A      + K LLS+VI
Sbjct: 1223 GIPRMREIIMTASAAIKTPQMTLPILDDVSDQQADTFSKSISKVLLSEVI 1272

 Score = 84.3 bits (207), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 50/167 (29%), Positives = 87/167 (52%), Gaps = 12/167 (7%)

Query: 1270 VVKGLPDISRAVINIRDDGKRELLVEGYGLR------DVMTTDGVVGYKTKTNHFLEVYD 1323
            ++  +P I R V    ++GKR L+ EG   +      D +  DG+      +N    V  
Sbjct: 1501 IINQVPHIDRCVHPEPENGKRVLVTEGVNFQAMWDQEDFIDVDGIT-----SNDVSAVLK 1555

Query: 1324 VLGIEAARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVL 1383
            V G+EAAR +I++EI      + +SV  RH+ L+ D+MT +G  L   R G+     S++
Sbjct: 1556 VYGVEAARNTIVNEISNVFGRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLM 1615

Query: 1384 QLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMTIGTGSFKVV 1430
            ++ S+E T   L  A    +++ ++  S  I++G+   +GTGSF ++
Sbjct: 1616 KM-SYETTCQFLTKAVLDHERENLDSPSARIVVGKLNNVGTGSFDIL 1661

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 55/117 (47%), Gaps = 3/117 (2%)

Query: 12  RISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGVSSSQAECSTCH 71
           RIS ++F   SA ++ A S  +I    + D  +   P  GG  D  +G +  +  C++C 
Sbjct: 10  RISSVDFDVFSAKEVRALSVKQITNPTVLD--NLGHPISGGLYDLALG-AFLRNMCASCG 66

Query: 72  GTLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNEEDKRQFLSELR 128
                C GH GHI+L +P ++  +F      L+S C  C +  L   +   F  +LR
Sbjct: 67  LDEKFCPGHLGHIELPVPCYNPLFFNQLYIYLRSSCLFCYRFRLKALEVHAFAMKLR 123

>Kpol_1019.27 s1019 complement(51067..52161) [1095 bp, 364 aa] {ON}
           complement(51067..52161) [1095 nt, 365 aa]
          Length = 364

 Score = 79.7 bits (195), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 60/111 (54%), Gaps = 1/111 (0%)

Query: 11  KRISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGVSSSQAECSTC 70
           + I  ++F   S  ++ A S  +I   +  D    RA K GG  D R+G      +C TC
Sbjct: 12  RTIKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNVKCQTC 70

Query: 71  HGTLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNEEDKR 121
              +  C GHFGHI LA PVFH+G+     ++ + +C +C KLLL+E +++
Sbjct: 71  QEGMNECPGHFGHIDLAKPVFHIGFISKIKKVCECVCMHCGKLLLDEHNEQ 121

>KNAG0M02360 Chr13 complement(436455..439187) [2733 bp, 910 aa] {ON}
           Anc_2.610 YMR047C
          Length = 910

 Score = 36.6 bits (83), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 44/93 (47%), Gaps = 20/93 (21%)

Query: 223 NPLKTLNLFKQISPQDCELLGIDSTVKAGRPE-----------TYIWRYLPAP---PVCI 268
           NP  T  LF +I+P   ++L   S +KAGR +           T  +R  P P   P+ +
Sbjct: 547 NPYGTNELFAKIAPSGSQIL---SVLKAGRSKLNADVKQKASLTSAYRNAPKPLFAPIFV 603

Query: 269 RPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKA 301
           R    ++DS +SN  + +   +   +TSS  KA
Sbjct: 604 RQPAAVEDSASSNTSNRSKNGS---FTSSTTKA 633

>KLTH0F19338g Chr6 (1564555..1568427) [3873 bp, 1290 aa] {ON} similar
            to uniprot|Q92271 Saccharomyces cerevisiae YOL138C
            Hypothetical ORF
          Length = 1290

 Score = 36.6 bits (83), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 34/73 (46%), Gaps = 13/73 (17%)

Query: 90   VFHVGYFKATIQILQSICKNCAKLLLNEEDKRQFLSELRRPGIDNLRRMATLKKV----L 145
            +   G  + T++I    C+ C KLL+NE  K +F  E +R G     R   +K+      
Sbjct: 1182 ILEAGNGQCTVRIY---CERCKKLLVNESSKEKFTEEWKRTG-----RQEVMKRFGYWYC 1233

Query: 146  DQCKKQRR-CLHC 157
            D C K+   C+ C
Sbjct: 1234 DNCSKRNTLCVLC 1246

>Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON} YOL138C
            - Hypothetical ORF [contig 124] FULL
          Length = 1286

 Score = 36.2 bits (82), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 37/83 (44%), Gaps = 17/83 (20%)

Query: 90   VFHVGYFKATIQILQSICKNCAKLLLNEEDKRQFLSELRRPG------------IDNLRR 137
            +   G  + T++I    C NC KLL+NE  K +F  E +R G             D   R
Sbjct: 1177 ILGSGTGQCTVRIY---CHNCKKLLVNESSKEKFTEEWKRTGRQEAMKRFGYWYCDLCSR 1233

Query: 138  MATLKKVLDQ-CKKQRRC-LHCG 158
            M TL  + ++  KK   C L CG
Sbjct: 1234 MNTLCALCERPLKKLTMCILSCG 1256

>Kpol_1038.20 s1038 complement(43719..47660) [3942 bp, 1313 aa] {ON}
            complement(43719..47660) [3942 nt, 1314 aa]
          Length = 1313

 Score = 35.0 bits (79), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 29/57 (50%), Gaps = 4/57 (7%)

Query: 103  LQSICKNCAKLLLNEEDKRQFLSELRRPG-IDNLRRMATLKKVLDQCKKQRR-CLHC 157
            +Q  C  C KL++NE  K  F  EL+R G  D++++        D CKK    C+ C
Sbjct: 1216 VQLFCDKCGKLIVNEFSKTNFNEELKRTGNKDSMKKFGYW--YCDACKKPNSLCVLC 1270

>Kpol_1041.26 s1041 (68074..69477) [1404 bp, 467 aa] {ON}
            (68074..69477) [1404 nt, 468 aa]
          Length = 467

 Score = 34.3 bits (77), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 55/113 (48%), Gaps = 19/113 (16%)

Query: 990  EELYIDQHDAEREFYQSLRTYMSEKARKLADITKSRGLK----ELYHAPALELQLMDLDA 1045
            +EL+ID  D E+   ++L   ++E  R + DI + + +K    ELY  P +E  L   +A
Sbjct: 190  KELFIDSIDYEQ--IKNLYNSVNETRRIVEDIIQLKKIKSKANELYRLPGVEHVLQGANA 247

Query: 1046 SCPEVDVKSVNQLCKISSKLVRTFLDIAISKYRKAKVEPGTAVGAIGAHSIGE 1098
            +  +  + S+  L +I     RT           A V PG+++  + A ++GE
Sbjct: 248  T--KTVLPSIGSLTQIHEYSPRT-----------AAVAPGSSILGVNAGAVGE 287

>TPHA0H01440 Chr8 complement(322547..325174) [2628 bp, 875 aa] {ON}
           Anc_5.359
          Length = 875

 Score = 34.3 bits (77), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 26/55 (47%)

Query: 339 GGNGGGKTKPIRGFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAV 393
           G +G   + PIR F  + K  QGRF  N++ + VD        P P   +D V V
Sbjct: 227 GSSGTKGSLPIRLFTAKGKSHQGRFAMNVTRRVVDLFSELFEIPYPLPKLDIVCV 281

>KLLA0E14477g Chr5 complement(1281791..1283941) [2151 bp, 716 aa]
           {ON} weakly similar to uniprot|Q08905 Saccharomyces
           cerevisiae YOR381w FRE3 protein Ferric reductase,
           reduces siderophore-bound iron prior to uptake by
           transporters
          Length = 716

 Score = 33.9 bits (76), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 54/133 (40%), Gaps = 26/133 (19%)

Query: 228 LNLFKQISPQDCELLGIDSTVKAGRPETYIWRYLPAPPVCI---RPSVMMQDSPAS---N 281
           L  F   S  DCEL   D+T+K   P    W+  P   V I   RP    Q  P +   +
Sbjct: 430 LLWFGVFSKADCELFEEDNTIKIKVPRPKTWKPFPGAFVYIYFMRPYGFWQSHPFTILAH 489

Query: 282 EDDLTVKLTEIVWTSSLIKAGLEKGI------------SINNMMEQWDYLQMAVAMYINS 329
           +DD   K   I    + +K GL K +            SIN ++E    L+  +  Y NS
Sbjct: 490 DDDSDGKHIYIY---AKVKEGLTKSLAKSLANTSNKSQSINVLVEGPYGLEAPLKNYSNS 546

Query: 330 DSVNPALMPGGNG 342
                 ++ GGNG
Sbjct: 547 -----IIITGGNG 554

>Kwal_27.11232 s27 (697964..707974) [10011 bp, 3336 aa] {ON} YDR150W
            (NUM1) - Protein with variable number of tandem repeats
            of a 64 amino-acid polypeptide, potential Ca2+-binding
            site, and pleckstrin homology domain [contig 29] FULL
          Length = 3336

 Score = 33.9 bits (76), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 28/57 (49%), Gaps = 10/57 (17%)

Query: 99   TIQILQSICKNCAKLLLNEEDKRQFLSELRRPGIDNLRRMATLKKVLDQCKKQRRCL 155
            +I+ L + CK    LL+NE D+ +   +L  P +D + +MA          KQ  CL
Sbjct: 1510 SIEFLAAKCKEAGYLLVNERDQAELSRKLNEPTMDEMEQMA----------KQVNCL 1556

>NCAS0E01850 Chr5 (360472..361614) [1143 bp, 380 aa] {ON} Anc_7.192
           YIL019W
          Length = 380

 Score = 33.5 bits (75), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 16/29 (55%)

Query: 610 SLLIKPNKKSPVIINLDAKNKVYIAPKNK 638
           SLL+KP    P +I  D     YIAP NK
Sbjct: 96  SLLVKPKMNKPKVIKFDGPTDTYIAPSNK 124

>YAL034C Chr1 complement(80710..81951) [1242 bp, 413 aa] {ON}
            FUN19Non-essential protein of unknown function;
            expression induced in response to heat stress
          Length = 413

 Score = 32.7 bits (73), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 33/71 (46%), Gaps = 1/71 (1%)

Query: 1239 KAKSISTLASEPHENDVFFKMQH-LRRALPGIVVKGLPDISRAVINIRDDGKRELLVEGY 1297
            +AK  S  AS PH N    +  H   + +P +  K LPD S  +  +  D  + L +E  
Sbjct: 262  RAKKFSPSASTPHTNIASIEAIHDAPQYIPNVSWKKLPDYSPPLSTLPTDSNKSLKIEWK 321

Query: 1298 GLRDVMTTDGV 1308
            G    ++TD +
Sbjct: 322  GSPMDLSTDPL 332

>SAKL0B04466g Chr2 complement(393589..394710) [1122 bp, 373 aa] {ON}
           conserved hypothetical protein
          Length = 373

 Score = 32.3 bits (72), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 30/65 (46%), Gaps = 6/65 (9%)

Query: 199 GDWNQVLQHSPELERYMKRTMENLNPLKTLNLFKQISPQDCELLGIDSTVKAGRPETYIW 258
           G+W+ +  +  +   Y K T  NL  L+   L      +D E LG+     A RP T  W
Sbjct: 56  GNWSCISPNDKDTLFYDKFTYLNLGDLQA-KLLSHFRDKDAEWLGL-----ARRPSTEYW 109

Query: 259 RYLPA 263
            Y+PA
Sbjct: 110 DYVPA 114

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.136    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 151,437,519
Number of extensions: 6693039
Number of successful extensions: 17926
Number of sequences better than 10.0: 77
Number of HSP's gapped: 17975
Number of HSP's successfully gapped: 184
Length of query: 1459
Length of database: 53,481,399
Length adjustment: 122
Effective length of query: 1337
Effective length of database: 39,492,147
Effective search space: 52801000539
Effective search space used: 52801000539
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 72 (32.3 bits)