Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AER251W5.425ON40739316560.0
Ecym_55245.425ON4153997344e-93
KLTH0F16280g5.425ON4732783347e-34
Suva_2.5345.425ON4522493126e-31
Kwal_55.214685.425ON4652323119e-31
ZYRO0F09812g5.425ON4162333072e-30
YDR363W (ESC2)5.425ON4562533064e-30
Smik_4.6285.425ON4582493031e-29
SAKL0G02266g5.425ON4842342933e-28
NCAS0F033105.425ON4422452881e-27
Skud_4.6315.425ON4582462881e-27
NDAI0B056005.425ON4572532872e-27
KAFR0E038705.425ON3962392711e-25
TBLA0A037105.425ON4612342661e-24
KLLA0E21275g5.425ON3922242613e-24
CAGL0A02706g5.425ON3692292514e-23
Kpol_1027.265.425ON4432522457e-22
TPHA0E018105.425ON4532582102e-17
KNAG0C049805.425ON3452221692e-12
TDEL0E020005.425ON436591552e-10
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AER251W
         (407 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AER251W Chr5 (1099999..1101222) [1224 bp, 407 aa] {ON} Syntenic ...   642   0.0  
Ecym_5524 Chr5 (1062240..1063487) [1248 bp, 415 aa] {ON} similar...   287   4e-93
KLTH0F16280g Chr6 complement(1321305..1322726) [1422 bp, 473 aa]...   133   7e-34
Suva_2.534 Chr2 (956062..957420) [1359 bp, 452 aa] {ON} YDR363W ...   124   6e-31
Kwal_55.21468 s55 complement(851687..853084) [1398 bp, 465 aa] {...   124   9e-31
ZYRO0F09812g Chr6 (797169..798419) [1251 bp, 416 aa] {ON} weakly...   122   2e-30
YDR363W Chr4 (1199183..1200553) [1371 bp, 456 aa] {ON}  ESC2Sumo...   122   4e-30
Smik_4.628 Chr4 (1125627..1127003) [1377 bp, 458 aa] {ON} YDR363...   121   1e-29
SAKL0G02266g Chr7 (190967..192421) [1455 bp, 484 aa] {ON} some s...   117   3e-28
NCAS0F03310 Chr6 (670533..671861) [1329 bp, 442 aa] {ON} Anc_5.4...   115   1e-27
Skud_4.631 Chr4 (1128086..1129462) [1377 bp, 458 aa] {ON} YDR363...   115   1e-27
NDAI0B05600 Chr2 (1369512..1370885) [1374 bp, 457 aa] {ON} Anc_5...   115   2e-27
KAFR0E03870 Chr5 (768042..769232) [1191 bp, 396 aa] {ON} Anc_5.4...   108   1e-25
TBLA0A03710 Chr1 (928023..929408) [1386 bp, 461 aa] {ON} Anc_5.4...   107   1e-24
KLLA0E21275g Chr5 complement(1900927..1902105) [1179 bp, 392 aa]...   105   3e-24
CAGL0A02706g Chr1 (290595..291704) [1110 bp, 369 aa] {ON} simila...   101   4e-23
Kpol_1027.26 s1027 complement(53549..54880) [1332 bp, 443 aa] {O...    99   7e-22
TPHA0E01810 Chr5 complement(364173..365534) [1362 bp, 453 aa] {O...    86   2e-17
KNAG0C04980 Chr3 complement(958989..960026) [1038 bp, 345 aa] {O...    70   2e-12
TDEL0E02000 Chr5 complement(379082..380392) [1311 bp, 436 aa] {O...    64   2e-10

>AER251W Chr5 (1099999..1101222) [1224 bp, 407 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR363W (ESC2)
          Length = 407

 Score =  642 bits (1656), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/393 (82%), Positives = 324/393 (82%)

Query: 1   MGEFNEYDDIDDFFCNDISPLHDEADEFGSTDIALPSQLYGKGPKPRAGESKALRDRNKE 60
           MGEFNEYDDIDDFFCNDISPLHDEADEFGSTDIALPSQLYGKGPKPRAGESKALRDRNKE
Sbjct: 1   MGEFNEYDDIDDFFCNDISPLHDEADEFGSTDIALPSQLYGKGPKPRAGESKALRDRNKE 60

Query: 61  SGSGTESEAKGDTLATKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPVRPAKRKR 120
           SGSGTESEAKGDTLATK                                  PVRPAKRKR
Sbjct: 61  SGSGTESEAKGDTLATKRGRSSWRRGASESSRSSSLGSSSPSDSSSGRSLSPVRPAKRKR 120

Query: 121 TDEQQPESEANRFLAEMERDIELSXXXXXXXXXXXXXXRDTDARVYNVGFISRIEGSRNR 180
           TDEQQPESEANRFLAEMERDIELS              RDTDARVYNVGFISRIEGSRNR
Sbjct: 121 TDEQQPESEANRFLAEMERDIELSAGPGGGETATGKGGRDTDARVYNVGFISRIEGSRNR 180

Query: 181 RVNVKVTGQKQXXXXXXXXXXXXSKQHNIRKSLKPKYQADQVKIYREGVEVFKFMTCDSF 240
           RVNVKVTGQKQ            SKQHNIRKSLKPKYQADQVKIYREGVEVFKFMTCDSF
Sbjct: 181 RVNVKVTGQKQFATFLAIALAAFSKQHNIRKSLKPKYQADQVKIYREGVEVFKFMTCDSF 240

Query: 241 NIEEPYNASATDIEVYIVPVDEATAFEQEWKRKFEERVRMLSNSSFLEVMXXXXXXXXXF 300
           NIEEPYNASATDIEVYIVPVDEATAFEQEWKRKFEERVRMLSNSSFLEVM         F
Sbjct: 241 NIEEPYNASATDIEVYIVPVDEATAFEQEWKRKFEERVRMLSNSSFLEVMDDIEDDNDDF 300

Query: 301 LVNEYEKALVNARSLNETELAVREGTPADESSQLLKIVLLGSDNKKVFIHVRPTTTLLKV 360
           LVNEYEKALVNARSLNETELAVREGTPADESSQLLKIVLLGSDNKKVFIHVRPTTTLLKV
Sbjct: 301 LVNEYEKALVNARSLNETELAVREGTPADESSQLLKIVLLGSDNKKVFIHVRPTTTLLKV 360

Query: 361 AEHYRVAKELPPTVQLSLMFDHEEIDLDDTICN 393
           AEHYRVAKELPPTVQLSLMFDHEEIDLDDTICN
Sbjct: 361 AEHYRVAKELPPTVQLSLMFDHEEIDLDDTICN 393

>Ecym_5524 Chr5 (1062240..1063487) [1248 bp, 415 aa] {ON} similar to
           Ashbya gossypii AER251W
          Length = 415

 Score =  287 bits (734), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 166/399 (41%), Positives = 229/399 (57%), Gaps = 8/399 (2%)

Query: 1   MGEFNEYDDIDDFFCNDISPLHDEADEFGSTDIALPSQLYGKGPKPRAGESKALRDRNKE 60
           M + +EYDDIDDFFCND+SP     D FG+ DIA+P+ L+    K R   S   ++ +  
Sbjct: 1   MSKASEYDDIDDFFCNDLSPSLSADDGFGTADIAVPTTLFMNKSKVRGSVSSFSKECSDG 60

Query: 61  SGSGTESEAKGDTLATKXXXXXXXXX--XXXXXXXXXXXXXXXXXXXXXXXXXPVRPAKR 118
                  +  G    ++                                    PVRPAKR
Sbjct: 61  RDQANSEDEDGFRFRSRQRGRKERNSPGYGSISRSNSRSRRSRSRSLSSDSLSPVRPAKR 120

Query: 119 KRTDEQ-QPESEANRFLAEMERDIE--LSXXXXXXXXXXXXXXRDTDARVYNVGFISRIE 175
            R  E  Q ES+ N+FLAE+E++ E   S              ++    +YNVGFIS++E
Sbjct: 121 SRNVEHSQEESDTNKFLAEIEQEAERASSLHNNGSLKNGSSNNKEIGTNIYNVGFISKLE 180

Query: 176 GSRNRRVNVKVTGQKQXXXXXXXXXXXXSKQHNIRKSLKPKYQADQVKIYREGVEVFKFM 235
           GS N+R+NV++TG+K+             K++ I  SL  KYQ D VKIYREGVE+FKFM
Sbjct: 181 GSTNKRINVRITGKKKFSAFLPIALKTFVKEYKIAASLHDKYQIDNVKIYREGVEIFKFM 240

Query: 236 TCDSFNIEEPYNASATDIEVYIVPVDEATAFEQEWKRKFEERVRMLSNSSFLEVMXXXXX 295
           TCDSFNI E Y +S+ DIEVYIVP + A+ FE +WK+K E +++ +S S+    +     
Sbjct: 241 TCDSFNIAEAYASSSIDIEVYIVPNELASEFEIQWKQKIETKMKRVSISASPVDLDSDGI 300

Query: 296 X--XXXFLVNEYEKALVNARSLNETELAV-REGTPADESSQLLKIVLLGSDNKKVFIHVR 352
                 F VNEYEK L NARSL+ETE+    + +  D+ ++L+K+VLLGSDNKKV+++V+
Sbjct: 301 EFGNDDFRVNEYEKDLANARSLDETEIQYSNQISKPDDGNELIKVVLLGSDNKKVYVNVK 360

Query: 353 PTTTLLKVAEHYRVAKELPPTVQLSLMFDHEEIDLDDTI 391
           PTTT  K+AEHYR  K+LPPT +L L FDH++ID  +TI
Sbjct: 361 PTTTFEKLAEHYRRIKKLPPTTKLILSFDHDDIDPSNTI 399

>KLTH0F16280g Chr6 complement(1321305..1322726) [1422 bp, 473 aa]
           {ON} some similarities with uniprot|Q06340 YDR363W
           Saccharomyces cerevisiae ESC2 Protein involved in
           mating- type locus silencing interacts with Sir2p
          Length = 473

 Score =  133 bits (334), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 83/278 (29%), Positives = 131/278 (47%), Gaps = 14/278 (5%)

Query: 116 AKRKRTDEQQPESEANRFLAEMERDIELSXXXXXXXXXXXXXXRDTDARVYNVGFISRIE 175
           A R  +  Q  + E ++F  E+ER+   +                   R+YN+ FIS +E
Sbjct: 194 AVRTNSLPQHEKDEDDKFFEELEREASRTASTVKESSPAVAQ------RIYNIKFISDLE 247

Query: 176 GSRNRRVNVKVTGQKQXXXXXXXXXXXXSKQHNIRKSLKPKYQADQVKIYREGVEVFKFM 235
           GS  RR+NVKV G++              K++ I  +L P Y+ D+V +YR+GV++  FM
Sbjct: 248 GSAGRRINVKVKGKQSFDQILPVALKTIIKEYKIPDALHPIYETDKVTLYRDGVKILNFM 307

Query: 236 TCDSFNIEEPYNASATDIEVYIVPVDEATAFEQEWKRKFEERVRMLSNSSFLEVMXXXXX 295
            C+S  I   +    +D+ + I+    +   EQ ++  +E+     SN   +        
Sbjct: 308 NCNSLQIPLEFKGEVSDVCLTII----SKGQEQNFEALYEQSKH--SNHELVPAFIEPGT 361

Query: 296 XXXXFLVNEYEKALVNARSLNETELAVREGTPADESSQLLKIVLLGSDNKKVFIHVRPTT 355
               F V EYEK L N      T  +V+   P       ++I L+  DNKK+ +  RP T
Sbjct: 362 ETPDFTVEEYEKELRNVDFNKNT--SVQNQPPPQSVDDNIRIALMSQDNKKIIVTARPET 419

Query: 356 TLLKVAEHYRVAKELPPTVQLSLMFDHEEIDLDDTICN 393
           T   +AEHY+    LPP  Q+ L FD+EE+ LD  + +
Sbjct: 420 TFAALAEHYQKLTSLPPQQQVLLFFDNEELHLDSKVSD 457

>Suva_2.534 Chr2 (956062..957420) [1359 bp, 452 aa] {ON} YDR363W
           (REAL)
          Length = 452

 Score =  124 bits (312), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 75/249 (30%), Positives = 130/249 (52%), Gaps = 15/249 (6%)

Query: 160 DTDARVYNVGFISRIEGSRNRRVNVKVTGQKQXXXXXXXXXXXXSKQHNIRKSLKPKYQA 219
           D   RVYN+ F S++EG+ N+ V VKV G+ +             K + I K +K  Y+ 
Sbjct: 190 DQPKRVYNIKFFSKLEGTINKAVQVKVLGKYEFSRILPAALDGLMKSYKIPKVMKDIYKE 249

Query: 220 DQVKIYREGVEVFKFMTCDSFNIEEPYNASATDIEVYIVPVDEATAFEQEWKRKFEERVR 279
           + V +Y    ++ KFMTC+S +I + +    +DI++ IV  +    FE   + K +E   
Sbjct: 250 ENVTLYWNNAKLLKFMTCNSLHIPQDFENEISDIDITIVSKEYEKNFEATLESKLKEEET 309

Query: 280 MLSNSSFLEVMXXXXXXXXXFLVNEYEKALVNARSLNET-----------ELAVREGTPA 328
            L      E+             +E+ +     R++ ET           E ++REG   
Sbjct: 310 ALFAKERQEMEMKLEKKRNEREESEFREFEFELRNVEETEELKANETFMNEHSLREGNSV 369

Query: 329 DESS----QLLKIVLLGSDNKKVFIHVRPTTTLLKVAEHYRVAKELPPTVQLSLMFDHEE 384
            E++    +++KI L+G DNKK++++VR +T   KVAE+YR+ K+LP   ++ L+FDH+E
Sbjct: 370 KENNGGNEKVMKIALMGQDNKKIYVNVRNSTPFFKVAEYYRIQKQLPQKARIKLLFDHDE 429

Query: 385 IDLDDTICN 393
           ++L++ I +
Sbjct: 430 LNLNECIAD 438

>Kwal_55.21468 s55 complement(851687..853084) [1398 bp, 465 aa] {ON}
           YDR363W (ESC2) - establishes silent chromatin [contig
           130] FULL
          Length = 465

 Score =  124 bits (311), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 76/232 (32%), Positives = 117/232 (50%), Gaps = 11/232 (4%)

Query: 161 TDARVYNVGFISRIEGSRNRRVNVKVTGQKQXXXXXXXXXXXXSKQHNIRKSLKPKYQAD 220
           T  RVYN+ F+S +EGS N ++NVKV G+               K++ + K LKP YQ +
Sbjct: 228 TAKRVYNIKFLSNLEGSLNDKINVKVKGKHAFSEILPIALKTLIKEYKVSKDLKPFYQPE 287

Query: 221 QVKIYREGVEVFKFMTCDSFNIEEPYNASATDIEVYIVPVDEATAFEQEWKRKFEERVRM 280
            V +YR G+++  FM C+S +I   Y    +D+ + +V  D     EQE+ +  E+    
Sbjct: 288 NVSLYRNGLKILNFMNCNSLHIPLNYEGEVSDVSMTLVSRDR----EQEYVKTLEQSRHA 343

Query: 281 LSNSSFLEVMXXXXXXXXXFLVNEYEKALVNARSLNETELAVREGTPADESSQ-LLKIVL 339
             + S  E           F + E+EK L    S     L   E TP  E++   +KI L
Sbjct: 344 TPDLSREET----SPKIPGFSIEEFEKDLEGFESGESNNLL--EDTPQTENNHGTIKIAL 397

Query: 340 LGSDNKKVFIHVRPTTTLLKVAEHYRVAKELPPTVQLSLMFDHEEIDLDDTI 391
           +  DNKK++++VR TTT+  + EHYR  K L    +   +FD+E++ L   I
Sbjct: 398 MAQDNKKIYVNVRQTTTIAMLGEHYRTTKNLSSIERFKFVFDNEDLQLSTKI 449

>ZYRO0F09812g Chr6 (797169..798419) [1251 bp, 416 aa] {ON} weakly
           similar to uniprot|Q06340 YDR363W Saccharomyces
           cerevisiae ESC2 Protein involved in mating- type locus
           silencing interacts with Sir2p
          Length = 416

 Score =  122 bits (307), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 73/233 (31%), Positives = 121/233 (51%), Gaps = 17/233 (7%)

Query: 164 RVYNVGFISRIEGSRNRRVNVKVTGQKQXXXXXXXXXXXXSKQHNIRKSLKPKYQADQVK 223
           R+YNV F+S+++GS ++ V +KV G+               +++ I   +K  Y  + V 
Sbjct: 180 RIYNVRFLSKLDGSIDKAVQIKVLGKYDFASMLPSVLNGFIREYKIPNVMKKIYSQENVT 239

Query: 224 IYREGVEVFKFMTCDSFNIEEPYNASATDIEVYIVPVDEATAFEQEWKRKFEERVRMLSN 283
           +Y +  ++  FMTC+S  I + +    +DI++ ++P ++   FEQ            + N
Sbjct: 240 LYWKTAKLLNFMTCNSLKIPQAFENEISDIDITVIPKEKENEFEQ------------MIN 287

Query: 284 SSFLE----VMXXXXXXXXXFLVNEYEKALVNARSLNETELAVREGTPADES-SQLLKIV 338
           S  LE                 V E+EK L N  +              DE  + L+KI 
Sbjct: 288 SRLLEDEQNPPDTAETGNLDARVEEFEKELKNVDNSTTNHETTELIDLEDEGDTDLMKIA 347

Query: 339 LLGSDNKKVFIHVRPTTTLLKVAEHYRVAKELPPTVQLSLMFDHEEIDLDDTI 391
           L+G DNKK+F++VR TT L KVAE+YR+ K+LP  + + L+FDHEE++L+++I
Sbjct: 348 LVGEDNKKIFVNVRNTTILTKVAEYYRIKKKLPKDINIKLIFDHEELNLNESI 400

>YDR363W Chr4 (1199183..1200553) [1371 bp, 456 aa] {ON}
           ESC2Sumo-like domain protein; prevents accumulation of
           toxic intermediates during replication-associated
           recombinational repair; roles in silencing, lifespan,
           chromatid cohesion and the intra-S-phase DNA damage
           checkpoint; RENi family member
          Length = 456

 Score =  122 bits (306), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 73/253 (28%), Positives = 127/253 (50%), Gaps = 23/253 (9%)

Query: 160 DTDARVYNVGFISRIEGSRNRRVNVKVTGQKQXXXXXXXXXXXXSKQHNIRKSLKPKYQA 219
           D   RVYN+ F+S++EG+ N+ V VKV G+ +             K + I K +K  Y+ 
Sbjct: 194 DQRKRVYNIKFLSKLEGTINKAVQVKVLGKYEFSKILPAALDGLMKSYKIPKVMKDIYKV 253

Query: 220 DQVKIYREGVEVFKFMTCDSFNIEEPYNASATDIEVYIVPVDEATAFE------------ 267
           + V +Y    ++  FMTC+S +I + +    +DI+V IV  +    FE            
Sbjct: 254 ENVTLYWNNAKLLTFMTCNSLHIPQDFENEVSDIDVTIVSKEYEKNFEATLESKLKEEEA 313

Query: 268 -------QEWKRKFEERVRMLSNSSFLEVMXXXXXXXXXFLVNEYEKALVNARSLNETEL 320
                  QE +RK E++      S + E             + E +  ++N + L E   
Sbjct: 314 ALLIKERQEMERKLEKKRNEQEESEYREFESELKNVEETQEIKEND-TVMNTKLLQEGGS 372

Query: 321 AVREGTPADESSQLLKIVLLGSDNKKVFIHVRPTTTLLKVAEHYRVAKELPPTVQLSLMF 380
                +  +E   +++I L+G DNKK+++HVR +T   K+AE+YR+ K+LP   ++ L+F
Sbjct: 373 LSGNSSSMEE---VMRIALMGQDNKKIYVHVRRSTPFSKIAEYYRIQKQLPQKTRVKLLF 429

Query: 381 DHEEIDLDDTICN 393
           DH+E+D+++ I +
Sbjct: 430 DHDELDMNECIAD 442

>Smik_4.628 Chr4 (1125627..1127003) [1377 bp, 458 aa] {ON} YDR363W
           (REAL)
          Length = 458

 Score =  121 bits (303), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 75/249 (30%), Positives = 129/249 (51%), Gaps = 15/249 (6%)

Query: 160 DTDARVYNVGFISRIEGSRNRRVNVKVTGQKQXXXXXXXXXXXXSKQHNIRKSLKPKYQA 219
           D   RVYN+ F+S++EG+ N+ V VKV G+ +            +K + I K +K  Y+ 
Sbjct: 196 DQRKRVYNIKFLSKLEGTINKAVQVKVLGKYEFSRILPAALDGLTKSYKIPKVMKDIYKV 255

Query: 220 DQVKIYREGVEVFKFMTCDSFNIEEPYNASATDIEVYIVPVDEATAFEQEWKRKFEERVR 279
           + V +Y +  ++  FMTC+S +I + +    +DI+V IV  +    FE   + K +E   
Sbjct: 256 ENVTLYWKNAKLLDFMTCNSLHIPQDFENEVSDIDVTIVSKEYEKNFEASLESKLKEEEA 315

Query: 280 MLSNSSFLEV---MXXXXXXXXXFLVNEYEKALVNA-----RSLNETELAVREGTPAD-- 329
            L      E+   +             E+E  L N      R+ NET + ++     D  
Sbjct: 316 ALLVKEHEEIERKLERKRNEQEESEYREFEFELRNVKEKQERTENETVINIKNLQEDDNL 375

Query: 330 -----ESSQLLKIVLLGSDNKKVFIHVRPTTTLLKVAEHYRVAKELPPTVQLSLMFDHEE 384
                +S +++KI L G DNKK++++VR +T   KVAE+YR+ K+LP   ++ L+FDH++
Sbjct: 376 LENNSDSEKVMKIALRGQDNKKIYVNVRRSTPFSKVAEYYRIQKQLPQKARIKLLFDHDK 435

Query: 385 IDLDDTICN 393
           +D+ + I +
Sbjct: 436 LDMHECIAD 444

>SAKL0G02266g Chr7 (190967..192421) [1455 bp, 484 aa] {ON} some
           similarities with uniprot|Q06340 YDR363W Saccharomyces
           cerevisiae ESC2 Protein involved in mating- type locus
           silencing interacts with Sir2p
          Length = 484

 Score =  117 bits (293), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 70/234 (29%), Positives = 116/234 (49%), Gaps = 18/234 (7%)

Query: 162 DARVYNVGFISRIEGSRNRRVNVKVTGQKQXXXXXXXXXXXXSKQHNIRKSLKPKYQADQ 221
           D R Y + FIS+++GS ++++ VK  G+               K + I K+++  Y+ D 
Sbjct: 249 DKRTYKISFISKLKGSIDKKIEVKAWGKSPFTKILPSTLDAIVKAYRIPKAIQNVYKMDN 308

Query: 222 VKIYREGVEVFKFMTCDSFNIEEPYNASATDIEVYIVPVDEATAFEQEWKRKFEERVRML 281
           V +Y  G ++  FMTC+S  I + Y    TD+++ +V  +    +E E+K   E     L
Sbjct: 309 VTLYWNGAKILNFMTCNSLRIPQNYGDEITDVDITLVSKEYEMKYEAEFKEMVENE---L 365

Query: 282 SNSSFLEVMXXXXXXXXXFLVNEYEKALVNARSLNETELA----VREGTPADESSQLLKI 337
           S SS    +         F  NEYE  L  + S   + L     +R+G+        +K+
Sbjct: 366 SGSS----VDVKNVKKDDFATNEYELQLEKSESAEPSLLKSSENIRDGS-------FIKL 414

Query: 338 VLLGSDNKKVFIHVRPTTTLLKVAEHYRVAKELPPTVQLSLMFDHEEIDLDDTI 391
            L+G DNKK+F+  R +T   K+A++Y+  K LP   +L L FDH  + L+D +
Sbjct: 415 ALVGQDNKKMFVKARSSTLFKKIADYYKDVKNLPSFTKLKLTFDHVNLSLEDRV 468

>NCAS0F03310 Chr6 (670533..671861) [1329 bp, 442 aa] {ON} Anc_5.425
           YDR363W
          Length = 442

 Score =  115 bits (288), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 70/245 (28%), Positives = 128/245 (52%), Gaps = 17/245 (6%)

Query: 164 RVYNVGFISRIEGSRNRRVNVKVTGQKQXXXXXXXXXXXXSKQHNIRKSLKPKYQADQVK 223
           RVY++ F+S+++G+ N+ V VKV G+ Q             K ++I   L+  Y+ D V 
Sbjct: 182 RVYSIRFLSQLDGTINKTVQVKVLGKFQFVKILPPTLEGLIKSYSIPTVLQKFYKVDNVT 241

Query: 224 IYREGVEVFKFMTCDSFNIEEPYNASATDIEVYIVPVDEATAFEQEWKRK--FEERVRML 281
           +Y    ++  FMTC+S NI + +    T++++ I+  ++    E E ++K   EE+   +
Sbjct: 242 LYWNNTKLLNFMTCNSLNIPQAFENEVTNVDIVIMSKEKEIENENELRKKLLLEEKAAQM 301

Query: 282 --------SNSSFLEVMXXXXXXXXXFLVNEYEKALVNARSLNETELAVREG-------T 326
                                       + E+EK L +A  L ++++   E         
Sbjct: 302 KLDLEKEREKEGEKNKPKESKNTEYAKAIAEFEKELKDATELKDSQVHGGENDGNMNIDG 361

Query: 327 PADESSQLLKIVLLGSDNKKVFIHVRPTTTLLKVAEHYRVAKELPPTVQLSLMFDHEEID 386
             +E S ++KI L+G DNKK++++VR +T   K+AE+YR+ K+LP   ++ LMFDH+E++
Sbjct: 362 SDNEKSSIMKIALVGHDNKKIYVNVRNSTPFSKLAEYYRLQKQLPQAAKIQLMFDHDELN 421

Query: 387 LDDTI 391
           L++T+
Sbjct: 422 LEETV 426

>Skud_4.631 Chr4 (1128086..1129462) [1377 bp, 458 aa] {ON} YDR363W
           (REAL)
          Length = 458

 Score =  115 bits (288), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 72/246 (29%), Positives = 123/246 (50%), Gaps = 17/246 (6%)

Query: 164 RVYNVGFISRIEGSRNRRVNVKVTGQKQXXXXXXXXXXXXSKQHNIRKSLKPKYQADQVK 223
           RVYN+ F+S++EG+ N+ V VKV G+ +             K + I K +   Y+   V 
Sbjct: 200 RVYNIKFLSKLEGTINKAVQVKVLGKYEFSRILPAALDGLVKSYKIPKVMISIYKVGNVT 259

Query: 224 IYREGVEVFKFMTCDSFNIEEPYNASATDIEVYIVPVDEATAFEQEWKRKFEERVRMLSN 283
           +Y    ++  FMTC+S NI + +    +DI+V IV  +    FE   + K +E    L  
Sbjct: 260 LYWNNAKLLNFMTCNSLNISQDFENEISDIDVTIVSKEYEKNFEATLESKLKEDEAALLV 319

Query: 284 SSFLEV---MXXXXXXXXXFLVNEYEKALVNAR---SLNETELAVR----------EGTP 327
               E+   +             E+E  L N +    L E E+ +           +G  
Sbjct: 320 KQRQEIERKLEKKRNEQEESEYREFEFELRNVKETQELEENEIIINTKPLQGNNSLKGNN 379

Query: 328 ADESSQLLKIVLLGSDNKKVFIHVRPTTTLLKVAEHYRVAKELPPTVQLSLMFDHEEIDL 387
            D + +++K+ L+G DNKK+ ++VR +T L KVAE+YR+ K LP   ++ L+FDH+E+++
Sbjct: 380 GD-TEKVIKLALMGQDNKKIHVNVRNSTPLFKVAEYYRIQKRLPQKARIRLLFDHDELNM 438

Query: 388 DDTICN 393
            + + +
Sbjct: 439 SECVAD 444

>NDAI0B05600 Chr2 (1369512..1370885) [1374 bp, 457 aa] {ON}
           Anc_5.425 YDR363W
          Length = 457

 Score =  115 bits (287), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 76/253 (30%), Positives = 125/253 (49%), Gaps = 34/253 (13%)

Query: 164 RVYNVGFISRIEGSRNRRVNVKVTGQKQXXXXXXXXXXXXSKQHNIRKSLKPKYQADQVK 223
           R+YN+ FIS+++G+ N+ V VKV G+ Q             K ++I   L+  Y  D V 
Sbjct: 196 RIYNIRFISKLDGTMNKCVQVKVLGKFQFQKILPAALTGLIKAYSIPSVLQKYYSVDNVS 255

Query: 224 IYREGVEVFKFMTCDSFNIEEPYNASATDIEVYIVPVD---------------------- 261
           +Y    ++  FMTC+S NI + +    T++++ ++  D                      
Sbjct: 256 LYWNHAKLLDFMTCNSLNIPQAFENEVTNVDIELISKDDEIENEKAITEKLLKDEREVSL 315

Query: 262 --EATAFEQEWKRKF-EERVRMLSNSSFLEVMXXXXXXXXXFLVNEYEKALVNARSLNET 318
             EA   E+E + K  +E  +    +   E              N Y+    +A ++NE 
Sbjct: 316 KLEAAKKEKEIQEKLAKELAKEEKENEVFEEFEHELENVSELKTNGYD---ADASTVNEA 372

Query: 319 -ELAVREGTPADESSQLLKIVLLGSDNKKVFIHVRPTTTLLKVAEHYRVAKELPPTVQLS 377
            ELA+ EG     ++ ++KI L+G DNKK+ ++VR TT   KVAE+YR+ K+LP   ++ 
Sbjct: 373 NELALEEG-----NADVMKIALVGQDNKKIHVNVRGTTPFSKVAEYYRIQKQLPQNAKIK 427

Query: 378 LMFDHEEIDLDDT 390
           L+FDHEE+ L +T
Sbjct: 428 LVFDHEELSLYET 440

>KAFR0E03870 Chr5 (768042..769232) [1191 bp, 396 aa] {ON} Anc_5.425
           YDR363W
          Length = 396

 Score =  108 bits (271), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 63/239 (26%), Positives = 121/239 (50%), Gaps = 25/239 (10%)

Query: 164 RVYNVGFISRIEGSRNRRVNVKVTGQKQXXXXXXXXXXXXSKQHNIRKSLKPKYQADQVK 223
           R+YN+ FIS+++GS N+ V VKV G+                 + I   +   Y  + V 
Sbjct: 160 RIYNIRFISKLDGSINKSVKVKVLGKFPFSKILPAALKGLIDAYKIPSIMSEIYDVENVG 219

Query: 224 IYREGVEVFKFMTCDSFNIEEPYNASATDIEVYIVP---------VDEATAFEQEWKRKF 274
           +Y    ++  FMTCDS +I   +    +++++ IV          +D+    ++E K + 
Sbjct: 220 LYWNNAKLLNFMTCDSLSIPLAFENEISNVDILIVSKEFGEKLEKLDQMKTLQEEAKLER 279

Query: 275 EERVRMLSNSSFLEVMXXXXXXXXXFLVNEYEKALVNARSLNETELAVREGTPADESSQL 334
           +E ++ +                  F++ E+E  L   R +  +   +   T  ++S  L
Sbjct: 280 QEEIKDVDEGD-------------DFVLKEFEAEL---RDVAPSNANLSLDTDGEDSEPL 323

Query: 335 LKIVLLGSDNKKVFIHVRPTTTLLKVAEHYRVAKELPPTVQLSLMFDHEEIDLDDTICN 393
           +K+ L+G DNKK++++VR +T + K+ E+Y+  K L   V++ L+FDH+E+DL++T+ +
Sbjct: 324 MKLALMGQDNKKIYVNVRSSTQISKLVEYYKKQKNLARNVKVKLLFDHDELDLNETVGD 382

>TBLA0A03710 Chr1 (928023..929408) [1386 bp, 461 aa] {ON} Anc_5.425
           YDR363W
          Length = 461

 Score =  107 bits (266), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 68/234 (29%), Positives = 124/234 (52%), Gaps = 10/234 (4%)

Query: 164 RVYNVGFISRIEGSRNRRVNVKVTGQKQXXXXXXXXXXXXSKQHNIRKSLKPKYQADQVK 223
           R+YNV FIS+IEG+ +++V VKV G+              S+++ I   LK  Y+ + V 
Sbjct: 216 RIYNVRFISKIEGTLDKKVQVKVLGKFPFSKILPPALKAFSEEYKIPNVLKQYYRVNNVT 275

Query: 224 IYREGVEVFKFMTCDSFNIEEPYNASATDIEVYIVPVDEATAFEQE----WKRKFEERVR 279
           +Y    ++  FMTC+S NI + Y    +D+E+ ++      ++E +     K+  E+ + 
Sbjct: 276 LYWNDSKLLNFMTCNSLNIPQIYENEISDVEIIVITKTNEKSYEDKINMSLKQNIEQNLA 335

Query: 280 MLSNSSFLEVMXXXXXXXXXFLVNEYEKALVNARSLNETELAVREGTPADE--SSQLLKI 337
             SN    E+            + E+EK L   + L++  +  ++    D+  +   +KI
Sbjct: 336 QKSNE-IKELRKLKVESFEHNSIQEFEKEL---KELSQDGVDTKQTANIDDIPNESHIKI 391

Query: 338 VLLGSDNKKVFIHVRPTTTLLKVAEHYRVAKELPPTVQLSLMFDHEEIDLDDTI 391
            LL  DNKK+++ VR +T   ++  ++R  K+L  T Q+ L+FD+EE+DL++T+
Sbjct: 392 ALLTQDNKKLYVKVRNSTPFSELVNYFREQKQLGETQQIKLIFDNEELDLNETV 445

>KLLA0E21275g Chr5 complement(1900927..1902105) [1179 bp, 392 aa]
           {ON} some similarities with uniprot|Q06340 YDR363W
           Saccharomyces cerevisiae ESC2 Protein involved in
           mating- type locus silencing interacts with Sir2p
          Length = 392

 Score =  105 bits (261), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 69/224 (30%), Positives = 113/224 (50%), Gaps = 1/224 (0%)

Query: 164 RVYNVGFISRIEGSRNRRVNVKVTGQKQXXXXXXXXXXXXSKQHNIRKSLKPKYQADQVK 223
           R+YN+ FIS +EGS+++RVNVKVTG K              + + I + L+  Y   ++ 
Sbjct: 148 RIYNINFISTLEGSQDKRVNVKVTGNKTFESILPITIRTFIQSYKIPRRLRIFYTPAELV 207

Query: 224 IYREGVEVFKFMTCDSFNIEEPYNASATDIEVYIVPVDEATAFEQEWKRKFEERVRMLSN 283
           ++R GVEV  F  CDS  I +  +   T +++ IV   +A  ++ E+KR  E R++   +
Sbjct: 208 LFRAGVEVLPFSNCDSLRIPKTVSEYETTVDLVIVHSADANNYKTEYKRIRESRLQSFLD 267

Query: 284 SSFLEVMXXXXXXXXXFLVNEYEKALVNARSLNETELAVREGTPAD-ESSQLLKIVLLGS 342
            S +E                +EK L +A  L E    V +   +D ESS  +++ L+  
Sbjct: 268 ESNIEEQDPLEQPARDEKFKLFEKELESAPKLAERTDDVIDLLDSDIESSNSIRLTLIDK 327

Query: 343 DNKKVFIHVRPTTTLLKVAEHYRVAKELPPTVQLSLMFDHEEID 386
            NK+  I V P TT  ++A  Y+    L     + L+FD+EE++
Sbjct: 328 ANKRTSISVWPNTTFTEIANRYKTISSLSEDANVLLIFDNEELN 371

>CAGL0A02706g Chr1 (290595..291704) [1110 bp, 369 aa] {ON} similar
           to uniprot|Q06340 Saccharomyces cerevisiae YDR363w ESC2
          Length = 369

 Score =  101 bits (251), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 71/229 (31%), Positives = 113/229 (49%), Gaps = 27/229 (11%)

Query: 164 RVYNVGFISRIEGSRNRRVNVKVTGQKQXXXXXXXXXXXXSKQHNIRKSLKPKYQADQVK 223
           +VY V FIS ++G++ + V VK  G                + H +   ++P YQ + V 
Sbjct: 151 KVYYVQFISHVDGTKGKSVQVKALGSHPFSKLVAAALSGLMRAHRLPSVMRPLYQPESVV 210

Query: 224 IYREGVEVFKFMTCDSFNIEEPYNASATDIEVYIVPV-DEATAFEQEWKRKFEERVRMLS 282
            Y    +V  FMTCD+  + + Y +    +E+ +VPV +EA   EQE    FEE  R  +
Sbjct: 211 SYWNRAKVLGFMTCDTLRVPQRYGSDY--LEIQLVPVKEEAQYLEQEV---FEEPERAPT 265

Query: 283 NSSFLEVMXXXXXXXXXFLVNEYEKALVNARSLNETELAVREGTPADESSQLLKIVLLGS 342
                E               E+E+ L +A+        VR      ES ++L++ L G 
Sbjct: 266 PEEDAE--------------EEFERELRDAKE-------VRAPVVDLESEEVLRVALQGQ 304

Query: 343 DNKKVFIHVRPTTTLLKVAEHYRVAKELPPTVQLSLMFDHEEIDLDDTI 391
           DNKKV+++V+PTTT  ++ E+YR  K+LP + Q++L  D E +D   T+
Sbjct: 305 DNKKVYVNVKPTTTFARMIEYYRTQKQLPRSTQITLALDDEPLDPHATV 353

>Kpol_1027.26 s1027 complement(53549..54880) [1332 bp, 443 aa] {ON}
           complement(53549..54880) [1332 nt, 444 aa]
          Length = 443

 Score = 99.0 bits (245), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 64/252 (25%), Positives = 121/252 (48%), Gaps = 27/252 (10%)

Query: 164 RVYNVGFISRIEGSRNRRVNVKVTGQKQXXXXXXXXXXXXSKQHNIRKSLKPKYQADQVK 223
           R+YN+ F S+++GS ++++  +V G++Q            SK + + +  K  Y+ D V 
Sbjct: 178 RIYNITFTSKLDGSVDKKLQARVLGKQQFSEIMQPILDSYSKIYKVSRVKKRNYKTDLVT 237

Query: 224 IYREGVEVFKFMTCDSFNIEEPYNASATDIEVYIVPVDEATAFEQEWKRKFEERVRMLSN 283
           +Y +  ++  FMTC+S  I   + +  + IE+ I+  +    FE + K + E  V    N
Sbjct: 238 VYWDRAKLLPFMTCNSLKIPLEFQSEISHIELTIISKENEQQFEADIKAQLE--VDQKEN 295

Query: 284 SSFLEVMXXXXXXXXXFLVNEYEKALVNARSLNETELAVR---EGTP------------- 327
           ++  EV            ++E +K      +     + +    +GT              
Sbjct: 296 TNKTEVGSSKNFGIES-QIDENKKKYEEYENELNESIPISVPSQGTAEDPMHIDGDEENA 354

Query: 328 --------ADESSQLLKIVLLGSDNKKVFIHVRPTTTLLKVAEHYRVAKELPPTVQLSLM 379
                    D    ++K+ L+G+DNKK+F++ R TT   K+AE+Y + ++LP + ++ L+
Sbjct: 355 VDIIGKATTDLQQNIVKLALVGNDNKKIFVNARETTRFFKLAEYYILHRKLPKSTKVKLI 414

Query: 380 FDHEEIDLDDTI 391
           FD E+IDLD  +
Sbjct: 415 FDDEQIDLDSMV 426

>TPHA0E01810 Chr5 complement(364173..365534) [1362 bp, 453 aa] {ON}
           Anc_5.425 YDR363W
          Length = 453

 Score = 85.5 bits (210), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 65/258 (25%), Positives = 123/258 (47%), Gaps = 32/258 (12%)

Query: 164 RVYNVGFISRIEGSRNRRVNVKVTGQKQXXXXXXXXXXXXSKQHNIRKSLKPKYQADQVK 223
           R YN+ +IS++ GS  RR+  KV G +              K + I   L+  Y+A+ V 
Sbjct: 182 RKYNIMYISKLNGSEERRIQAKVLGTQTFAKVLPPILNTLLKVNKIPSKLRSLYKAENVT 241

Query: 224 IYREGVEVFKFMTCDSFNIEEPYNASATDIEVYIVPVDEATAFEQEWKRKF--EERVRML 281
           +Y    ++  FM CDS  I + Y    +++E+ ++  +E   FE+++K +   +E++   
Sbjct: 242 LYWNKSKLLNFMNCDSLKIPQTYQNEISELEIILISKEEEQKFEEQFKMQLLEDEQLSQK 301

Query: 282 SNSSFLEVMXXXXXXXXXFLVNEYEKALVNAR---------------------------S 314
           +  +F +           +  NEYEK L N                             S
Sbjct: 302 NIENFNDSNKPFDILNTSY--NEYEKELENWNSKDFNVTNDVLDVSNDENSSNNVKGNDS 359

Query: 315 LNETELAVREGTPADE-SSQLLKIVLLGSDNKKVFIHVRPTTTLLKVAEHYRVAKELPPT 373
           +N  E++  E +  +  +S ++KI L+ +DNKK+F++VR +T + K+ ++++  K L   
Sbjct: 360 MNLIEISDNESSIKEHGTSNVIKISLMSNDNKKIFVNVRSSTKIQKLVDYFKKCKNLTSN 419

Query: 374 VQLSLMFDHEEIDLDDTI 391
            ++ ++FDH+ + LD  I
Sbjct: 420 QRIKVIFDHDVLSLDSMI 437

>KNAG0C04980 Chr3 complement(958989..960026) [1038 bp, 345 aa] {ON}
           Anc_5.425 YDR363W
          Length = 345

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 50/222 (22%), Positives = 91/222 (40%), Gaps = 29/222 (13%)

Query: 165 VYNVGFISRIEGSRNRRVNVKVTGQKQXXXXXXXXXXXXSKQHNIRKSLKPKYQADQVKI 224
           VY V F S++EG+  + V VKV G +              +   + + L+  Y    V +
Sbjct: 131 VYRVRFQSQLEGTLGKSVQVKVIGTRPLGTVLPSVLSALVRACRVPQVLQGGYTEGAVGM 190

Query: 225 YREGVEVFKFMTCDSFNIEEPYNASATDIEVYIVPVD-EATAFEQEWKRKFEERVRMLSN 283
           YR G  V  FM C+S  + + +     +++V +  ++ E  A +    ++          
Sbjct: 191 YRGGARVLPFMNCNSLGVVQEFENEVLEVDVVLRALNLETPASDVSGGQE---------- 240

Query: 284 SSFLEVMXXXXXXXXXFLVNEYEKALVNARSLNETELAVREGTPADESSQLLKIVLLGSD 343
                              N  E A      +     A  E +P + +  L+KI LL +D
Sbjct: 241 -----------------ATNGTEAAASVPVPVPAPATAASE-SPGNPAPALMKIALLSAD 282

Query: 344 NKKVFIHVRPTTTLLKVAEHYRVAKELPPTVQLSLMFDHEEI 385
           N+++++ V   T   ++ E+YR+ + LP    L L  D E++
Sbjct: 283 NRRLYVKVHGGTPCSRLLEYYRMERGLPAGAPLQLRLDDEQV 324

>TDEL0E02000 Chr5 complement(379082..380392) [1311 bp, 436 aa] {ON}
           Anc_5.425 YDR363W
          Length = 436

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 47/59 (79%)

Query: 333 QLLKIVLLGSDNKKVFIHVRPTTTLLKVAEHYRVAKELPPTVQLSLMFDHEEIDLDDTI 391
           +++K+ L+G DN +++++VR +T   KVAE+Y++ K LP  V+L+L FDHE++DL++T+
Sbjct: 363 EVIKLALVGQDNARLYVNVRRSTPFSKVAEYYKLHKPLPMEVKLNLYFDHEKLDLNETV 421

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.366 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 34,297,833
Number of extensions: 1263109
Number of successful extensions: 2453
Number of sequences better than 10.0: 27
Number of HSP's gapped: 2484
Number of HSP's successfully gapped: 30
Length of query: 407
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 295
Effective length of database: 40,638,807
Effective search space: 11988448065
Effective search space used: 11988448065
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 67 (30.4 bits)