Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AER250C5.423ON37437419210.0
Ecym_55235.423ON38137512411e-170
SAKL0G02222g5.423ON37837412201e-167
NCAS0F032905.423ON40437312141e-166
Kpol_1031.235.423ON37937411801e-161
NDAI0B055905.423ON38037411801e-161
Skud_8.1735.423ON37837411791e-161
YHR112C5.423ON37837411761e-161
Smik_8.1905.423ON42037411791e-160
Suva_15.3085.423ON37837411741e-160
CAGL0I01276g5.423ON38037211671e-159
KNAG0C049905.423ON38037611551e-157
KLLA0E21319g5.423ON38037511481e-156
KAFR0E038605.423ON37837411411e-155
TBLA0B03020singletonON37937211281e-153
CAGL0K05665gsingletonON37937411261e-153
TBLA0A036805.423ON38436911251e-153
NDAI0F00140singletonON37837510861e-147
ZYRO0F09768g5.423ON37337410801e-146
ZYRO0F15664gsingletonON37337410781e-146
TDEL0G00140singletonON38137510611e-143
KNAG0F01580singletonON37937310591e-143
KLTH0E16566g5.423ON38136910331e-139
Kwal_55.222215.423ON38036910311e-139
TDEL0G04970singletonON38137510031e-134
NDAI0B00595singletonON3783759671e-129
TPHA0A06070na 1ON3733599471e-126
CAGL0H06369g7.97ON3913983296e-34
NCAS0F015207.97ON4293983132e-31
SAKL0B09614g7.97ON3923963103e-31
KAFR0K007607.97ON3924033078e-31
YAL012W (CYS3)7.97ON3944003051e-30
Skud_1.497.97ON3944003042e-30
Kpol_1044.107.97ON3913923023e-30
Smik_1.557.97ON3943993015e-30
TBLA0E022407.97ON3873953015e-30
ZYRO0D05742g7.97ON3913973015e-30
Suva_1.567.97ON3954003015e-30
TDEL0H035307.97ON3913953006e-30
TPHA0L005707.97ON3913982953e-29
KNAG0D047407.97ON3903972953e-29
KLLA0F07909g7.97ON3913962953e-29
KLTH0D02728g7.97ON3924002954e-29
NDAI0H024007.97ON3934022883e-28
Ecym_26297.97ON3923972866e-28
AEL341W7.97ON3933962691e-25
ZYRO0G19162g8.145ON4552582261e-19
CAGL0L06094g8.145ON4502532031e-16
Skud_19.6singletonON4013462021e-16
TDEL0B046608.145ON4642531985e-16
Smik_7.898.145ON4652571951e-15
YGL184C (STR3)8.145ON4652571889e-15
SAKL0H24882g8.145ON4592531881e-14
Suva_7.798.145ON4652571862e-14
Suva_17.6singletonON4012581842e-14
TDEL0D06630singletonON4022481807e-14
KLTH0E06644g8.145ON4604071817e-14
Skud_7.888.145ON4652571791e-13
Smik_7.375na 1ON4012561782e-13
Kwal_47.172218.145ON4632561745e-13
Ecym_84058.145ON4722611738e-13
ACL059C8.145ON4532491683e-12
KLLA0C17028g8.145ON4602671683e-12
NDAI0D028804.53ON4474511622e-11
YFR055W (IRC7)na 1ON3403421541e-10
TPHA0F004204.53ON4424321481e-09
NCAS0A058104.53ON4474551481e-09
ZYRO0G22198g4.53ON4454031452e-09
Ecym_83654.53ON4444491382e-08
KNAG0I029204.53ON4454381345e-08
Kpol_1041.444.53ON4444361301e-07
Smik_10.4234.354ON6392461302e-07
SAKL0G18172g4.354ON6732551302e-07
Suva_12.2214.354ON6392461275e-07
KLTH0D03652g4.53ON4444341231e-06
Skud_10.3534.354ON6402461231e-06
TBLA0C044004.53ON4452941221e-06
ADL031W4.53ON4672901222e-06
KLLA0D04037g4.53ON4444251212e-06
AER164C4.354ON6452511212e-06
YJR130C (STR2)4.354ON6392421213e-06
Smik_13.554.354ON6992511161e-05
SAKL0H23892g4.53ON4423001132e-05
Kwal_26.74374.53ON4442991122e-05
TDEL0E05710singletonON5562561123e-05
KAFR0F030704.53ON4453091113e-05
Kwal_14.791na 2ON5712421105e-05
KLTH0D17930g4.354ON6522841105e-05
TPHA0L003304.354ON7172521089e-05
YML082W4.354ON6492401081e-04
YLL058Wna 2ON5752491071e-04
Kwal_47.166444.354ON6522891062e-04
KLTH0G00418gsingletonON5682421062e-04
NCAS0A062704.354ON6592431062e-04
Skud_12.10na 2ON5712501052e-04
Ecym_51694.354ON6812441043e-04
CAGL0D06402g4.53ON4424391024e-04
Skud_13.594.354ON6492521025e-04
Suva_13.684.354ON6882481017e-04
Smik_12.3na 2ON5662011017e-04
KLLA0B04378g4.354ON688244990.001
Kwal_26.7197singletonOFF8765870.003
Suva_10.8na 2ON572249950.003
TDEL0E056204.53ON446452950.004
Suva_10.3974.53ON444294940.004
ZYRO0B08338g4.354ON640254940.005
CAGL0M00550g4.354ON569250940.005
Skud_12.3844.53ON444449920.008
Kpol_1028.804.354ON689252910.011
YLR303W (MET17)4.53ON444390890.016
Smik_12.3834.53ON444292890.016
TDEL0D006104.354ON652259890.018
NDAI0D032604.354ON696293830.11
KAFR0E043904.370ON1431103751.1
KAFR0E04410na 3ON1436103732.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AER250C
         (374 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AER250C Chr5 complement(1098456..1099580) [1125 bp, 374 aa] {ON}...   744   0.0  
Ecym_5523 Chr5 complement(1060537..1061682) [1146 bp, 381 aa] {O...   482   e-170
SAKL0G02222g Chr7 complement(186449..187585) [1137 bp, 378 aa] {...   474   e-167
NCAS0F03290 Chr6 complement(667618..668832) [1215 bp, 404 aa] {O...   472   e-166
Kpol_1031.23 s1031 complement(55637..56776) [1140 bp, 379 aa] {O...   459   e-161
NDAI0B05590 Chr2 complement(1367293..1368435) [1143 bp, 380 aa] ...   459   e-161
Skud_8.173 Chr8 complement(308322..309458) [1137 bp, 378 aa] {ON...   458   e-161
YHR112C Chr8 complement(334527..335663) [1137 bp, 378 aa] {ON} P...   457   e-161
Smik_8.190 Chr8 complement(310892..312154) [1263 bp, 420 aa] {ON...   458   e-160
Suva_15.308 Chr15 complement(536926..538062) [1137 bp, 378 aa] {...   456   e-160
CAGL0I01276g Chr9 complement(104391..105533) [1143 bp, 380 aa] {...   454   e-159
KNAG0C04990 Chr3 (960378..961520) [1143 bp, 380 aa] {ON} Anc_5.4...   449   e-157
KLLA0E21319g Chr5 (1904841..1905983) [1143 bp, 380 aa] {ON} high...   446   e-156
KAFR0E03860 Chr5 complement(766029..767165) [1137 bp, 378 aa] {O...   444   e-155
TBLA0B03020 Chr2 complement(700483..701622) [1140 bp, 379 aa] {O...   439   e-153
CAGL0K05665g Chr11 complement(552804..553943) [1140 bp, 379 aa] ...   438   e-153
TBLA0A03680 Chr1 complement(919740..920894) [1155 bp, 384 aa] {O...   437   e-153
NDAI0F00140 Chr6 (15124..16260) [1137 bp, 378 aa] {ON}                422   e-147
ZYRO0F09768g Chr6 complement(793824..794945) [1122 bp, 373 aa] {...   420   e-146
ZYRO0F15664g Chr6 (1286078..1287199) [1122 bp, 373 aa] {ON} high...   419   e-146
TDEL0G00140 Chr7 complement(20315..21460) [1146 bp, 381 aa] {ON}      413   e-143
KNAG0F01580 Chr6 complement(282872..284011) [1140 bp, 379 aa] {O...   412   e-143
KLTH0E16566g Chr5 (1468783..1469928) [1146 bp, 381 aa] {ON} simi...   402   e-139
Kwal_55.22221 s55 (1160724..1161866) [1143 bp, 380 aa] {ON} YHR1...   401   e-139
TDEL0G04970 Chr7 complement(925785..926930) [1146 bp, 381 aa] {O...   390   e-134
NDAI0B00595 Chr2 (131225..132361) [1137 bp, 378 aa] {ON}              377   e-129
TPHA0A06070 Chr1 complement(1370008..1371129) [1122 bp, 373 aa] ...   369   e-126
CAGL0H06369g Chr8 (627708..628883) [1176 bp, 391 aa] {ON} highly...   131   6e-34
NCAS0F01520 Chr6 complement(303410..304699) [1290 bp, 429 aa] {O...   125   2e-31
SAKL0B09614g Chr2 complement(813507..814685) [1179 bp, 392 aa] {...   124   3e-31
KAFR0K00760 Chr11 (171591..172769) [1179 bp, 392 aa] {ON} Anc_7....   122   8e-31
YAL012W Chr1 (130799..131983) [1185 bp, 394 aa] {ON}  CYS3Cystat...   122   1e-30
Skud_1.49 Chr1 (106029..107213) [1185 bp, 394 aa] {ON} YAL012W (...   121   2e-30
Kpol_1044.10 s1044 (19232..20407) [1176 bp, 391 aa] {ON} (19232....   120   3e-30
Smik_1.55 Chr1 (113765..114949) [1185 bp, 394 aa] {ON} YAL012W (...   120   5e-30
TBLA0E02240 Chr5 (554046..555209) [1164 bp, 387 aa] {ON} Anc_7.9...   120   5e-30
ZYRO0D05742g Chr4 (489953..491128) [1176 bp, 391 aa] {ON} highly...   120   5e-30
Suva_1.56 Chr1 (107030..108217) [1188 bp, 395 aa] {ON} YAL012W (...   120   5e-30
TDEL0H03530 Chr8 complement(586031..587206) [1176 bp, 391 aa] {O...   120   6e-30
TPHA0L00570 Chr12 (97933..99108) [1176 bp, 391 aa] {ON} Anc_7.97...   118   3e-29
KNAG0D04740 Chr4 complement(851405..852577) [1173 bp, 390 aa] {O...   118   3e-29
KLLA0F07909g Chr6 (742468..743643) [1176 bp, 391 aa] {ON} highly...   118   3e-29
KLTH0D02728g Chr4 (267019..268197) [1179 bp, 392 aa] {ON} highly...   118   4e-29
NDAI0H02400 Chr8 complement(582916..584097) [1182 bp, 393 aa] {O...   115   3e-28
Ecym_2629 Chr2 complement(1216179..1217357) [1179 bp, 392 aa] {O...   114   6e-28
AEL341W Chr5 (9428..10609) [1182 bp, 393 aa] {ON} Syntenic homol...   108   1e-25
ZYRO0G19162g Chr7 (1590120..1591487) [1368 bp, 455 aa] {ON} simi...    92   1e-19
CAGL0L06094g Chr12 (693250..694602) [1353 bp, 450 aa] {ON} simil...    83   1e-16
Skud_19.6 Chr19 complement(5562..6767) [1206 bp, 401 aa] {ON} YF...    82   1e-16
TDEL0B04660 Chr2 complement(828468..829862) [1395 bp, 464 aa] {O...    81   5e-16
Smik_7.89 Chr7 complement(149314..150711) [1398 bp, 465 aa] {ON}...    80   1e-15
YGL184C Chr7 complement(154615..156012) [1398 bp, 465 aa] {ON}  ...    77   9e-15
SAKL0H24882g Chr8 (2167623..2169002) [1380 bp, 459 aa] {ON} high...    77   1e-14
Suva_7.79 Chr7 complement(150082..151479) [1398 bp, 465 aa] {ON}...    76   2e-14
Suva_17.6 Chr17 (9922..11127) [1206 bp, 401 aa] {ON} YFR055W (REAL)    75   2e-14
TDEL0D06630 Chr4 complement(1200459..1201667) [1209 bp, 402 aa] ...    74   7e-14
KLTH0E06644g Chr5 complement(608116..609498) [1383 bp, 460 aa] {...    74   7e-14
Skud_7.88 Chr7 complement(160235..161632) [1398 bp, 465 aa] {ON}...    74   1e-13
Smik_7.375 Chr7 (620194..621399) [1206 bp, 401 aa] {ON} YFR055W ...    73   2e-13
Kwal_47.17221 s47 complement(306099..307490) [1392 bp, 463 aa] {...    72   5e-13
Ecym_8405 Chr8 (839466..840884) [1419 bp, 472 aa] {ON} similar t...    71   8e-13
ACL059C Chr3 complement(259732..261093) [1362 bp, 453 aa] {ON} S...    69   3e-12
KLLA0C17028g Chr3 complement(1487806..1489188) [1383 bp, 460 aa]...    69   3e-12
NDAI0D02880 Chr4 (669487..670830) [1344 bp, 447 aa] {ON} Anc_4.53      67   2e-11
YFR055W Chr6 (264204..265226) [1023 bp, 340 aa] {ON}  IRC7Beta-l...    64   1e-10
TPHA0F00420 Chr6 complement(103419..104747) [1329 bp, 442 aa] {O...    62   1e-09
NCAS0A05810 Chr1 (1143717..1145060) [1344 bp, 447 aa] {ON} Anc_4...    62   1e-09
ZYRO0G22198g Chr7 complement(1827527..1828864) [1338 bp, 445 aa]...    60   2e-09
Ecym_8365 Chr8 complement(732418..733752) [1335 bp, 444 aa] {ON}...    58   2e-08
KNAG0I02920 Chr9 (573008..574345) [1338 bp, 445 aa] {ON} Anc_4.5...    56   5e-08
Kpol_1041.44 s1041 (117344..118678) [1335 bp, 444 aa] {ON} (1173...    55   1e-07
Smik_10.423 Chr10 complement(654265..656184) [1920 bp, 639 aa] {...    55   2e-07
SAKL0G18172g Chr7 complement(1572652..1574673) [2022 bp, 673 aa]...    55   2e-07
Suva_12.221 Chr12 complement(344667..346586) [1920 bp, 639 aa] {...    54   5e-07
KLTH0D03652g Chr4 complement(358612..359946) [1335 bp, 444 aa] {...    52   1e-06
Skud_10.353 Chr10 complement(623771..625693) [1923 bp, 640 aa] {...    52   1e-06
TBLA0C04400 Chr3 (1062021..1063358) [1338 bp, 445 aa] {ON} Anc_4...    52   1e-06
ADL031W Chr4 (645776..647179) [1404 bp, 467 aa] {ON} Syntenic ho...    52   2e-06
KLLA0D04037g Chr4 (336499..337833) [1335 bp, 444 aa] {ON} highly...    51   2e-06
AER164C Chr5 complement(944867..946804) [1938 bp, 645 aa] {ON} S...    51   2e-06
YJR130C Chr10 complement(665218..667137) [1920 bp, 639 aa] {ON} ...    51   3e-06
Smik_13.55 Chr13 (99421..101520) [2100 bp, 699 aa] {ON} YJR130C ...    49   1e-05
SAKL0H23892g Chr8 (2059083..2060411) [1329 bp, 442 aa] {ON} high...    48   2e-05
Kwal_26.7437 s26 complement(365889..367223) [1335 bp, 444 aa] {O...    48   2e-05
TDEL0E05710 Chr5 complement(1062353..1064023) [1671 bp, 556 aa] ...    48   3e-05
KAFR0F03070 Chr6 (610571..611908) [1338 bp, 445 aa] {ON} Anc_4.5...    47   3e-05
Kwal_14.791 s14 complement(49074..50789) [1716 bp, 571 aa] {ON} ...    47   5e-05
KLTH0D17930g Chr4 (1486259..1488217) [1959 bp, 652 aa] {ON} simi...    47   5e-05
TPHA0L00330 Chr12 (43495..45648) [2154 bp, 717 aa] {ON} Anc_4.35...    46   9e-05
YML082W Chr13 (101862..103811) [1950 bp, 649 aa] {ON} Putative p...    46   1e-04
YLL058W Chr12 (23569..25296) [1728 bp, 575 aa] {ON} Putative pro...    46   1e-04
Kwal_47.16644 s47 complement(41349..43307) [1959 bp, 652 aa] {ON...    45   2e-04
KLTH0G00418g Chr7 complement(23130..24836) [1707 bp, 568 aa] {ON...    45   2e-04
NCAS0A06270 Chr1 complement(1239445..1241424) [1980 bp, 659 aa] ...    45   2e-04
Skud_12.10 Chr12 (10565..12280) [1716 bp, 571 aa] {ON} YLL058W (...    45   2e-04
Ecym_5169 Chr5 complement(353237..355282) [2046 bp, 681 aa] {ON}...    45   3e-04
CAGL0D06402g Chr4 (602973..604301) [1329 bp, 442 aa] {ON} highly...    44   4e-04
Skud_13.59 Chr13 (101194..103143) [1950 bp, 649 aa] {ON} YML082W...    44   5e-04
Suva_13.68 Chr13 (103103..105169) [2067 bp, 688 aa] {ON} YML082W...    44   7e-04
Smik_12.3 Chr12 (6081..7781) [1701 bp, 566 aa] {ON} YLL058W (REAL)     44   7e-04
KLLA0B04378g Chr2 (390701..392767) [2067 bp, 688 aa] {ON} simila...    43   0.001
Kwal_26.7197 s26 (258929..259192) [264 bp, 87 aa] {OFF} YAL012W ...    38   0.003
Suva_10.8 Chr10 (9213..10931) [1719 bp, 572 aa] {ON} YLL058W (REAL)    41   0.003
TDEL0E05620 Chr5 complement(1043585..1044925) [1341 bp, 446 aa] ...    41   0.004
Suva_10.397 Chr10 (693647..694981) [1335 bp, 444 aa] {ON} YLR303...    41   0.004
ZYRO0B08338g Chr2 complement(649933..651855) [1923 bp, 640 aa] {...    41   0.005
CAGL0M00550g Chr13 (66078..67787) [1710 bp, 569 aa] {ON} similar...    41   0.005
Skud_12.384 Chr12 (673748..675082) [1335 bp, 444 aa] {ON} YLR303...    40   0.008
Kpol_1028.80 s1028 (179685..181754) [2070 bp, 689 aa] {ON} (1796...    40   0.011
YLR303W Chr12 (732542..733876) [1335 bp, 444 aa] {ON}  MET17Meth...    39   0.016
Smik_12.383 Chr12 (670676..672010) [1335 bp, 444 aa] {ON} YLR303...    39   0.016
TDEL0D00610 Chr4 (109396..111354) [1959 bp, 652 aa] {ON} Anc_4.3...    39   0.018
NDAI0D03260 Chr4 complement(774579..776669) [2091 bp, 696 aa] {O...    37   0.11 
KAFR0E04390 Chr5 complement(879422..883717) [4296 bp, 1431 aa] {...    33   1.1  
KAFR0E04410 Chr5 complement(886158..890468) [4311 bp, 1436 aa] {...    33   2.0  

>AER250C Chr5 complement(1098456..1099580) [1125 bp, 374 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR112C
          Length = 374

 Score =  744 bits (1921), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/374 (96%), Positives = 362/374 (96%)

Query: 1   MVELCTSLIHADDNSNRVNDVAPPINVTTTFRYSEDDLIPAVERTADTAGSNGHFYSRVS 60
           MVELCTSLIHADDNSNRVNDVAPPINVTTTFRYSEDDLIPAVERTADTAGSNGHFYSRVS
Sbjct: 1   MVELCTSLIHADDNSNRVNDVAPPINVTTTFRYSEDDLIPAVERTADTAGSNGHFYSRVS 60

Query: 61  HPNGARCEVLLAEALGGEAVVYSSGLAAFGAALTHFNPKRLFIGRGYHGCHGVADIWVRN 120
           HPNGARCEVLLAEALGGEAVVYSSGLAAFGAALTHFNPKRLFIGRGYHGCHGVADIWVRN
Sbjct: 61  HPNGARCEVLLAEALGGEAVVYSSGLAAFGAALTHFNPKRLFIGRGYHGCHGVADIWVRN 120

Query: 121 HGLQKLSLEEVSERSEPGDLVHIESPINPYGTLVDVXXXXXXXXXXXXYVVLDATFAPPP 180
           HGLQKLSLEEVSERSEPGDLVHIESPINPYGTLVDV            YVVLDATFAPPP
Sbjct: 121 HGLQKLSLEEVSERSEPGDLVHIESPINPYGTLVDVAGIAAAAHEKGAYVVLDATFAPPP 180

Query: 181 LQDRWEQGADVVVHSCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTNIANLEAYL 240
           LQDRWEQGADVVVHSCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTNIANLEAYL
Sbjct: 181 LQDRWEQGADVVVHSCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTNIANLEAYL 240

Query: 241 LIRSMRTMEMRVVRQSTSATKVVAYLESHKAEFGGVLVKVFHSSLQTEPYVQQYLRGGNA 300
           LIRSMRTMEMRVVRQSTSATKVVAYLESHKAEFGGVLVKVFHSSLQTEPYVQQYLRGGNA
Sbjct: 241 LIRSMRTMEMRVVRQSTSATKVVAYLESHKAEFGGVLVKVFHSSLQTEPYVQQYLRGGNA 300

Query: 301 PVFSILLRTVEQCKRLPSLLKLFHHATSLGGVESLIEWRAMSDTTVEQNLLRISVGCESP 360
           PVFSILLRTVEQCKRLPSLLKLFHHATSLGGVESLIEWRAMSDTTVEQNLLRISVGCESP
Sbjct: 301 PVFSILLRTVEQCKRLPSLLKLFHHATSLGGVESLIEWRAMSDTTVEQNLLRISVGCESP 360

Query: 361 EDLIADLAGAFRQL 374
           EDLIADLAGAFRQL
Sbjct: 361 EDLIADLAGAFRQL 374

>Ecym_5523 Chr5 complement(1060537..1061682) [1146 bp, 381 aa] {ON}
           similar to Ashbya gossypii AER250C
          Length = 381

 Score =  482 bits (1241), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 229/375 (61%), Positives = 284/375 (75%), Gaps = 1/375 (0%)

Query: 1   MVELCTSLIHADDN-SNRVNDVAPPINVTTTFRYSEDDLIPAVERTADTAGSNGHFYSRV 59
           M  L T LIHADD  S+ V DVAPPINV+TTFRY  D+L+         A      YSR 
Sbjct: 1   MAGLSTLLIHADDGVSDHVTDVAPPINVSTTFRYDNDNLVLPEGDCDGYATEGAPVYSRE 60

Query: 60  SHPNGARCEVLLAEALGGEAVVYSSGLAAFGAALTHFNPKRLFIGRGYHGCHGVADIWVR 119
            HPN  RC  +L+ AL G AV Y+SGL+AFGAALTH+NPKRLFIG+ YHGCH +ADIWVR
Sbjct: 61  GHPNSNRCGSILSHALNGYAVAYNSGLSAFGAALTHYNPKRLFIGQSYHGCHKLADIWVR 120

Query: 120 NHGLQKLSLEEVSERSEPGDLVHIESPINPYGTLVDVXXXXXXXXXXXXYVVLDATFAPP 179
           N+GL KL L+E+ ER++PGD+VHIESP+NPYGT VD+             V++D+TFAPP
Sbjct: 121 NYGLLKLGLDEIEERAQPGDMVHIESPMNPYGTAVDIEEYVSKGHKKGAIVMIDSTFAPP 180

Query: 180 PLQDRWEQGADVVVHSCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTNIANLEAY 239
           PLQ+ WE G D+++HSCTKY GGHSDLLGGV  V+D AV RQL  DR+YLGTNIANL++Y
Sbjct: 181 PLQNAWEFGVDILMHSCTKYLGGHSDLLGGVLVVKDKAVFRQLVADRIYLGTNIANLDSY 240

Query: 240 LLIRSMRTMEMRVVRQSTSATKVVAYLESHKAEFGGVLVKVFHSSLQTEPYVQQYLRGGN 299
           LLIRS+RT+E+RV++QS +ATK+VAYL+ H +EF  VL ++ H+SLQ E +V++ L GG+
Sbjct: 241 LLIRSLRTLELRVMKQSDTATKLVAYLKQHISEFSDVLSEIRHTSLQQEEFVKKQLAGGH 300

Query: 300 APVFSILLRTVEQCKRLPSLLKLFHHATSLGGVESLIEWRAMSDTTVEQNLLRISVGCES 359
            PVFSI+L+TV+QC+ LP  LK FHHATS GGVESLIEWRA+SD  +E+ L+R+SVGCE 
Sbjct: 301 TPVFSIMLKTVDQCRELPKKLKFFHHATSFGGVESLIEWRALSDPEIEKTLVRVSVGCED 360

Query: 360 PEDLIADLAGAFRQL 374
             DLI DLA A R L
Sbjct: 361 HNDLINDLANALRYL 375

>SAKL0G02222g Chr7 complement(186449..187585) [1137 bp, 378 aa] {ON}
           highly similar to uniprot|P38716 Saccharomyces
           cerevisiae YHR112C Hypothetical ORF
          Length = 378

 Score =  474 bits (1220), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 217/374 (58%), Positives = 282/374 (75%)

Query: 1   MVELCTSLIHADDNSNRVNDVAPPINVTTTFRYSEDDLIPAVERTADTAGSNGHFYSRVS 60
           MV L T+LIHADD  NRV D+  PINV TTFRY  ++LI   +R           YSR++
Sbjct: 1   MVSLPTTLIHADDKDNRVTDIVSPINVATTFRYDNNNLIAWNDRENYDFLETTPVYSRLA 60

Query: 61  HPNGARCEVLLAEALGGEAVVYSSGLAAFGAALTHFNPKRLFIGRGYHGCHGVADIWVRN 120
           HPN  R E + +E LGG AV+YSSGLAA+ A LTH+NPK+LFIG+ YHGCHG+ADI+ RN
Sbjct: 61  HPNATRLESIFSEILGGHAVIYSSGLAAYFATLTHYNPKKLFIGQSYHGCHGIADIFTRN 120

Query: 121 HGLQKLSLEEVSERSEPGDLVHIESPINPYGTLVDVXXXXXXXXXXXXYVVLDATFAPPP 180
           +G+++  L+ + E +  GD+VH+E+P+NP+GT  D+             +V+D+TFAPPP
Sbjct: 121 NGMKQYPLDRIEELASEGDIVHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAPPP 180

Query: 181 LQDRWEQGADVVVHSCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTNIANLEAYL 240
           LQD W+ GADVV+HSCTKYFGGHSDLL GV  V+   VA++++ DR+YLGTNIANLE+YL
Sbjct: 181 LQDVWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVAKKMKNDRIYLGTNIANLESYL 240

Query: 241 LIRSMRTMEMRVVRQSTSATKVVAYLESHKAEFGGVLVKVFHSSLQTEPYVQQYLRGGNA 300
           L+RS+RT EMRV +QS +AT +V YL+ HK+EF  VL K++HSSLQTE +V++ L GG  
Sbjct: 241 LLRSLRTFEMRVRKQSENATALVKYLDDHKSEFNKVLDKIYHSSLQTEDFVKKQLEGGYG 300

Query: 301 PVFSILLRTVEQCKRLPSLLKLFHHATSLGGVESLIEWRAMSDTTVEQNLLRISVGCESP 360
           PVFSI+L++  QCK+LP  L+LF HATSLGGVESL+EWRA++D  +EQ L+R+SVGCE  
Sbjct: 301 PVFSIVLKSKVQCKKLPGKLELFQHATSLGGVESLVEWRALTDPYIEQTLIRVSVGCEGV 360

Query: 361 EDLIADLAGAFRQL 374
           EDLI DLAGA +QL
Sbjct: 361 EDLIKDLAGALKQL 374

>NCAS0F03290 Chr6 complement(667618..668832) [1215 bp, 404 aa] {ON}
           Anc_5.423 YHR112C
          Length = 404

 Score =  472 bits (1214), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 213/373 (57%), Positives = 279/373 (74%)

Query: 2   VELCTSLIHADDNSNRVNDVAPPINVTTTFRYSEDDLIPAVERTADTAGSNGHFYSRVSH 61
           + L T+LIH DD  NRV+DVAPPINVTTTFRY  +DLIP  ER           YSR+ H
Sbjct: 28  IHLSTTLIHGDDKDNRVSDVAPPINVTTTFRYDPNDLIPWSERENLDFMDKTPIYSRLGH 87

Query: 62  PNGARCEVLLAEALGGEAVVYSSGLAAFGAALTHFNPKRLFIGRGYHGCHGVADIWVRNH 121
           PN  R E + +E L G AV+YSSG++AF AA+ H+NPKRLF+G+ YHGC  +A+I  RN+
Sbjct: 88  PNSTRLESIFSEVLNGHAVIYSSGVSAFFAAMVHYNPKRLFMGQSYHGCRAIANILTRNY 147

Query: 122 GLQKLSLEEVSERSEPGDLVHIESPINPYGTLVDVXXXXXXXXXXXXYVVLDATFAPPPL 181
            +++  LE++ + ++ GD+VH+E+P+NPYGT +D+             + +D+TFAPPPL
Sbjct: 148 NVEQHPLEDIEKYAQKGDIVHLETPVNPYGTSLDISEFARRAHAKGALLCVDSTFAPPPL 207

Query: 182 QDRWEQGADVVVHSCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTNIANLEAYLL 241
           QD WE  AD+V+HS TKYFGGHSDLL GV  V+D  VARQLR DR+YLGTN+ANLE+YLL
Sbjct: 208 QDVWEFDADIVMHSATKYFGGHSDLLSGVLVVKDEDVARQLRDDRIYLGTNVANLESYLL 267

Query: 242 IRSMRTMEMRVVRQSTSATKVVAYLESHKAEFGGVLVKVFHSSLQTEPYVQQYLRGGNAP 301
           +RS+RT +MR+ RQS +ATKVV +L  +K +FG VL K++HSSLQTEP+V++ L+GG  P
Sbjct: 268 LRSLRTFKMRIERQSENATKVVKFLNDNKGKFGNVLDKIYHSSLQTEPFVKKQLKGGYDP 327

Query: 302 VFSILLRTVEQCKRLPSLLKLFHHATSLGGVESLIEWRAMSDTTVEQNLLRISVGCESPE 361
           VFSI L+  EQCK+ P LLK FHHATSLGG+ESL+EWRAM+D  ++Q L+RIS+GCE  +
Sbjct: 328 VFSITLKNKEQCKKFPLLLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRISIGCEDAD 387

Query: 362 DLIADLAGAFRQL 374
           DLI DL+ A  +L
Sbjct: 388 DLINDLSAALNKL 400

>Kpol_1031.23 s1031 complement(55637..56776) [1140 bp, 379 aa] {ON}
           complement(55637..56776) [1140 nt, 380 aa]
          Length = 379

 Score =  459 bits (1180), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 213/374 (56%), Positives = 276/374 (73%)

Query: 1   MVELCTSLIHADDNSNRVNDVAPPINVTTTFRYSEDDLIPAVERTADTAGSNGHFYSRVS 60
           MVEL T LIHADD +NRV DVAPPINVTTTFRY E DLIP +ER   +       YSR  
Sbjct: 1   MVELSTLLIHADDKNNRVTDVAPPINVTTTFRYEEQDLIPIIEREDMSFLDERPVYSREG 60

Query: 61  HPNGARCEVLLAEALGGEAVVYSSGLAAFGAALTHFNPKRLFIGRGYHGCHGVADIWVRN 120
           HPNG R E L +E LGG AV+YSSGL+A+ AA+  FNPKR+F+ + YHGC  +A+++ RN
Sbjct: 61  HPNGTRLETLFSEYLGGHAVIYSSGLSAYFAAIMSFNPKRIFMSQNYHGCIAIAEMFQRN 120

Query: 121 HGLQKLSLEEVSERSEPGDLVHIESPINPYGTLVDVXXXXXXXXXXXXYVVLDATFAPPP 180
             ++K +L+E+ + +E GD+VH+ESP+NP+GT  D+             +++D TFAPPP
Sbjct: 121 GMVKKYTLDEIEQYAEKGDIVHLESPVNPFGTSYDIEAFAKRAHAKGALLLVDGTFAPPP 180

Query: 181 LQDRWEQGADVVVHSCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTNIANLEAYL 240
           LQ+ W+ GAD+V+HS TKYFGGHSDLLGGV  V+D      L++DR+ LGTNIANLE+YL
Sbjct: 181 LQNVWDFGADIVMHSATKYFGGHSDLLGGVLVVKDKKRQELLKEDRINLGTNIANLESYL 240

Query: 241 LIRSMRTMEMRVVRQSTSATKVVAYLESHKAEFGGVLVKVFHSSLQTEPYVQQYLRGGNA 300
           L+RS+RT EMR+++QS + TK+V YL+ +K ++G VL  + HSSLQ E +V++ L+GG  
Sbjct: 241 LLRSLRTFEMRIMKQSENVTKIVKYLDENKGKYGKVLRDITHSSLQKEDFVKKQLKGGYN 300

Query: 301 PVFSILLRTVEQCKRLPSLLKLFHHATSLGGVESLIEWRAMSDTTVEQNLLRISVGCESP 360
           PVFSI L TVEQCK   S LK F HATSLGGVESL+EWRA+SD  ++Q L+R+SVGCES 
Sbjct: 301 PVFSITLNTVEQCKSFASQLKYFQHATSLGGVESLVEWRALSDPHIDQTLVRVSVGCESA 360

Query: 361 EDLIADLAGAFRQL 374
           +DLI DLA A + L
Sbjct: 361 DDLIKDLASALQNL 374

>NDAI0B05590 Chr2 complement(1367293..1368435) [1143 bp, 380 aa]
           {ON} Anc_5.423
          Length = 380

 Score =  459 bits (1180), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 203/374 (54%), Positives = 279/374 (74%)

Query: 1   MVELCTSLIHADDNSNRVNDVAPPINVTTTFRYSEDDLIPAVERTADTAGSNGHFYSRVS 60
           M  L T+LIH+DD  NRV+DVAPPINVTTTFRY  DDL+P  ER           YSR++
Sbjct: 1   MAHLSTALIHSDDKDNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTPIYSRLA 60

Query: 61  HPNGARCEVLLAEALGGEAVVYSSGLAAFGAALTHFNPKRLFIGRGYHGCHGVADIWVRN 120
           HPN  R E + +E L G AV+YSSGLAAF AA+ H+NPKR+FIG+ YHG   +A+I  RN
Sbjct: 61  HPNSTRLESIFSEILDGHAVIYSSGLAAFFAAMIHYNPKRIFIGQSYHGVRAIANILTRN 120

Query: 121 HGLQKLSLEEVSERSEPGDLVHIESPINPYGTLVDVXXXXXXXXXXXXYVVLDATFAPPP 180
              ++ +L+E+ + ++PGD+VH+E+P+NP+GT +D+             +++D+TFAPPP
Sbjct: 121 FQTKQHTLDEIEQFAQPGDIVHLETPVNPFGTSLDLEDFAKKAHEKGALLLVDSTFAPPP 180

Query: 181 LQDRWEQGADVVVHSCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTNIANLEAYL 240
           LQ+ W+   D+++HS TKYFGGHSDLL GV  V++ AVARQLR DR+YLGTN+ANLE+++
Sbjct: 181 LQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYLGTNVANLESFM 240

Query: 241 LIRSMRTMEMRVVRQSTSATKVVAYLESHKAEFGGVLVKVFHSSLQTEPYVQQYLRGGNA 300
           L+RS+RT EMR+++QS +ATK+V++L+S++ ++  VL  + HSSLQ E +V++ L+GG  
Sbjct: 241 LLRSLRTFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQKESFVKKQLKGGYG 300

Query: 301 PVFSILLRTVEQCKRLPSLLKLFHHATSLGGVESLIEWRAMSDTTVEQNLLRISVGCESP 360
           PVFSI L   EQCK+ P +LK FHHATSLGG+ESL+EWRAM+D  +EQ L+R+S+GCE+ 
Sbjct: 301 PVFSISLMNKEQCKKFPPMLKYFHHATSLGGIESLVEWRAMTDPYIEQTLIRVSIGCENA 360

Query: 361 EDLIADLAGAFRQL 374
           +DLI DLA A   L
Sbjct: 361 DDLIQDLANALETL 374

>Skud_8.173 Chr8 complement(308322..309458) [1137 bp, 378 aa] {ON}
           YHR112C (REAL)
          Length = 378

 Score =  458 bits (1179), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 208/374 (55%), Positives = 275/374 (73%)

Query: 1   MVELCTSLIHADDNSNRVNDVAPPINVTTTFRYSEDDLIPAVERTADTAGSNGHFYSRVS 60
           MV L T LIH DD  NRV DVAPPINV+TTFRY +DDLIP  ER           YSR++
Sbjct: 1   MVNLSTVLIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLA 60

Query: 61  HPNGARCEVLLAEALGGEAVVYSSGLAAFGAALTHFNPKRLFIGRGYHGCHGVADIWVRN 120
           HPN  R E + +E L G AV+YSSGLAAF AA+ H+NPK++FIG+ YHG   + +I  RN
Sbjct: 61  HPNSTRLESVFSEILDGYAVIYSSGLAAFYAAMVHYNPKKIFIGQSYHGVRAITNILARN 120

Query: 121 HGLQKLSLEEVSERSEPGDLVHIESPINPYGTLVDVXXXXXXXXXXXXYVVLDATFAPPP 180
           + +++  LE++ + +  GD+VH+ESP+NPYGT  D+             +++D+TFA PP
Sbjct: 121 YDVKQYPLEDIEKYASEGDIVHLESPVNPYGTSYDIESLAHRAHTKGALLIVDSTFASPP 180

Query: 181 LQDRWEQGADVVVHSCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTNIANLEAYL 240
           LQ  W  GADVV++S TKYFGGHSDLL GV  V+D AV+RQL+ DR+YLGTN+ANLE+++
Sbjct: 181 LQYAWNFGADVVLYSATKYFGGHSDLLSGVLVVKDEAVSRQLKDDRIYLGTNVANLESFM 240

Query: 241 LIRSMRTMEMRVVRQSTSATKVVAYLESHKAEFGGVLVKVFHSSLQTEPYVQQYLRGGNA 300
           L+RS+RT EMR+ +QS +ATK+V +L  H++EF  VL  ++HSSLQTE +V++ L GG  
Sbjct: 241 LLRSLRTYEMRITKQSENATKLVKFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYG 300

Query: 301 PVFSILLRTVEQCKRLPSLLKLFHHATSLGGVESLIEWRAMSDTTVEQNLLRISVGCESP 360
           PVF+I+L   EQCK+LP  LK FHHATSLGG+ESL+EWRAM+D  ++Q L+R+SVGCES 
Sbjct: 301 PVFAIILHNKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESA 360

Query: 361 EDLIADLAGAFRQL 374
           EDLI DL+ A ++L
Sbjct: 361 EDLIKDLSSALKEL 374

>YHR112C Chr8 complement(334527..335663) [1137 bp, 378 aa] {ON}
           Protein of unknown function; localizes to the cytoplasm
           and nucleus; overexpression affects protein trafficking
           through the endocytic pathway
          Length = 378

 Score =  457 bits (1176), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 208/374 (55%), Positives = 277/374 (74%)

Query: 1   MVELCTSLIHADDNSNRVNDVAPPINVTTTFRYSEDDLIPAVERTADTAGSNGHFYSRVS 60
           MV+L T+LIH DD  NRV DVAPPINV+TTFRY +DDLIP  ER           YSR++
Sbjct: 1   MVDLSTALIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLA 60

Query: 61  HPNGARCEVLLAEALGGEAVVYSSGLAAFGAALTHFNPKRLFIGRGYHGCHGVADIWVRN 120
           HPN  R E + +E L G AV+YSSGLAAF AA+ H+NPK++FIG+ YHG   +A+I  RN
Sbjct: 61  HPNSTRLESIFSEILDGYAVIYSSGLAAFYAAMVHYNPKKIFIGQSYHGVRAIANILTRN 120

Query: 121 HGLQKLSLEEVSERSEPGDLVHIESPINPYGTLVDVXXXXXXXXXXXXYVVLDATFAPPP 180
           +G+++  LE++ + +  GD+VH+ESP+NPYGT  D+             +++D+TFA PP
Sbjct: 121 YGIEQHPLEDIEKCASEGDIVHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFASPP 180

Query: 181 LQDRWEQGADVVVHSCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTNIANLEAYL 240
           LQ  W  GAD+V++S TKYFGGHSDLL GV  V++ A +RQL+ DR+YLGTN+ANLE+++
Sbjct: 181 LQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLGTNVANLESFM 240

Query: 241 LIRSMRTMEMRVVRQSTSATKVVAYLESHKAEFGGVLVKVFHSSLQTEPYVQQYLRGGNA 300
           L+RS+RT EMR+ +QS +ATK+V +L  H++EF  VL  ++HSSLQTE +V++ L GG  
Sbjct: 241 LLRSLRTYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYG 300

Query: 301 PVFSILLRTVEQCKRLPSLLKLFHHATSLGGVESLIEWRAMSDTTVEQNLLRISVGCESP 360
           PVF+I L T EQCK+LP  LK FHHATSLGG+ESL+EWRAM+D  ++Q L+R+SVGCES 
Sbjct: 301 PVFAITLYTKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESA 360

Query: 361 EDLIADLAGAFRQL 374
            DLI DLA A ++L
Sbjct: 361 NDLIKDLASALKEL 374

>Smik_8.190 Chr8 complement(310892..312154) [1263 bp, 420 aa] {ON}
           YHR112C (REAL)
          Length = 420

 Score =  458 bits (1179), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 207/374 (55%), Positives = 277/374 (74%)

Query: 1   MVELCTSLIHADDNSNRVNDVAPPINVTTTFRYSEDDLIPAVERTADTAGSNGHFYSRVS 60
           MV+L TSLIH DD  NRV DVAPPINV+TTFRY +DDL+P  ER           YSR++
Sbjct: 43  MVDLSTSLIHGDDKDNRVTDVAPPINVSTTFRYDDDDLVPWTERENLDFMEKKPIYSRLA 102

Query: 61  HPNGARCEVLLAEALGGEAVVYSSGLAAFGAALTHFNPKRLFIGRGYHGCHGVADIWVRN 120
           HPN  R E + +E L G AV+YSSGLAAF AA+ H+NPKR+FIG+ YHG   +A+I  RN
Sbjct: 103 HPNSTRLESIFSEILDGYAVIYSSGLAAFYAAMVHYNPKRIFIGQSYHGVRAIANILSRN 162

Query: 121 HGLQKLSLEEVSERSEPGDLVHIESPINPYGTLVDVXXXXXXXXXXXXYVVLDATFAPPP 180
           + +++  LE++ + +  GD+VH+E+P+NPYGT  D+             +++D+TFA PP
Sbjct: 163 YDIKQYPLEDIEKYASEGDIVHLETPVNPYGTSSDIESLAHRAHAKGALLIVDSTFASPP 222

Query: 181 LQDRWEQGADVVVHSCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTNIANLEAYL 240
           LQ  W  GAD+V++S TKYFGGHSDLL GV  V++   +RQL+ DR+YLGTN+ANLE+++
Sbjct: 223 LQYVWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEETSRQLKDDRIYLGTNVANLESFM 282

Query: 241 LIRSMRTMEMRVVRQSTSATKVVAYLESHKAEFGGVLVKVFHSSLQTEPYVQQYLRGGNA 300
           L+RS+RT EMR+ +QS +ATK+V +L  H++EFG VL K++HSSLQ E +V++ L GG  
Sbjct: 283 LLRSLRTYEMRITKQSENATKLVKFLSDHQSEFGKVLKKIYHSSLQREEFVKKQLVGGYG 342

Query: 301 PVFSILLRTVEQCKRLPSLLKLFHHATSLGGVESLIEWRAMSDTTVEQNLLRISVGCESP 360
           PVF+I L+T EQCK+LP  LK FHHATSLGG+ESL+EWRAM+D  ++Q L+R+SVGCES 
Sbjct: 343 PVFAITLQTKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESA 402

Query: 361 EDLIADLAGAFRQL 374
            DLI DLA A ++L
Sbjct: 403 NDLIKDLASALKEL 416

>Suva_15.308 Chr15 complement(536926..538062) [1137 bp, 378 aa] {ON}
           YHR112C (REAL)
          Length = 378

 Score =  456 bits (1174), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 209/374 (55%), Positives = 277/374 (74%)

Query: 1   MVELCTSLIHADDNSNRVNDVAPPINVTTTFRYSEDDLIPAVERTADTAGSNGHFYSRVS 60
           MV+L T+LIHADD  NRV DVAPPINV+TTFRY +DDLIP  ER           YSR++
Sbjct: 1   MVDLSTALIHADDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRPVYSRLA 60

Query: 61  HPNGARCEVLLAEALGGEAVVYSSGLAAFGAALTHFNPKRLFIGRGYHGCHGVADIWVRN 120
           HPN  R E + ++ L G AVVYSSGLAAF AA+ H+NPK++FIG+ YHG   +A+I  RN
Sbjct: 61  HPNSTRLESVFSDILDGYAVVYSSGLAAFFAAMVHYNPKKIFIGQSYHGVRAIANILTRN 120

Query: 121 HGLQKLSLEEVSERSEPGDLVHIESPINPYGTLVDVXXXXXXXXXXXXYVVLDATFAPPP 180
           + +++  LE++   +  GD+VH+ESP+NPYGT  D+             ++LD+TFA PP
Sbjct: 121 YDIKQHPLEDIERYAAEGDIVHLESPVNPYGTSYDIESFARRAHAKGALLILDSTFASPP 180

Query: 181 LQDRWEQGADVVVHSCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTNIANLEAYL 240
           LQ  W  GAD+V++S TKYFGGHSDLL GV  V+D AV+R+L+ DR+YLGTN+ANLE+++
Sbjct: 181 LQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIYLGTNVANLESFM 240

Query: 241 LIRSMRTMEMRVVRQSTSATKVVAYLESHKAEFGGVLVKVFHSSLQTEPYVQQYLRGGNA 300
           L+RS+RT E+R+ +QS +ATK+V +L  H++EF  VL  ++HSSLQTE +V++ L GG  
Sbjct: 241 LLRSLRTYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYG 300

Query: 301 PVFSILLRTVEQCKRLPSLLKLFHHATSLGGVESLIEWRAMSDTTVEQNLLRISVGCESP 360
           PVF+I LRT EQCK  P  LK FHHATSLGG+ESL+EWRAM+D  ++Q L+R+SVGCES 
Sbjct: 301 PVFAITLRTKEQCKVFPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESA 360

Query: 361 EDLIADLAGAFRQL 374
           +DLI DLA A ++L
Sbjct: 361 DDLIRDLASALKEL 374

>CAGL0I01276g Chr9 complement(104391..105533) [1143 bp, 380 aa] {ON}
           highly similar to uniprot|P38716 Saccharomyces
           cerevisiae YHR112c
          Length = 380

 Score =  454 bits (1167), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 211/372 (56%), Positives = 276/372 (74%)

Query: 3   ELCTSLIHADDNSNRVNDVAPPINVTTTFRYSEDDLIPAVERTADTAGSNGHFYSRVSHP 62
           +L T+LIH DD  NRV DVAPPINV TTFRY E+DL+P  ER           YSR+ HP
Sbjct: 5   DLATTLIHGDDIKNRVPDVAPPINVATTFRYDENDLVPWNEREDLEFMDRTPIYSRLGHP 64

Query: 63  NGARCEVLLAEALGGEAVVYSSGLAAFGAALTHFNPKRLFIGRGYHGCHGVADIWVRNHG 122
           N  R E + +E L G AV+YSSGLAAF AA+THFNPK+LFIG+ YHG HG+ADI  RN+G
Sbjct: 65  NATRLESIFSEILEGHAVIYSSGLAAFHAAMTHFNPKQLFIGQSYHGVHGIADILSRNYG 124

Query: 123 LQKLSLEEVSERSEPGDLVHIESPINPYGTLVDVXXXXXXXXXXXXYVVLDATFAPPPLQ 182
           L + SL+++ E ++ GD+VHIE+P+NP+GT  D+             +++D+TFAPPPLQ
Sbjct: 125 LIQRSLDDIEEYAQKGDIVHIETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFAPPPLQ 184

Query: 183 DRWEQGADVVVHSCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTNIANLEAYLLI 242
             W  GAD+++HS TK+FGGHSDLL GV   +D  V+++L+ DR+YLGTN+ANLE++LL+
Sbjct: 185 YAWNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYLGTNVANLESHLLL 244

Query: 243 RSMRTMEMRVVRQSTSATKVVAYLESHKAEFGGVLVKVFHSSLQTEPYVQQYLRGGNAPV 302
           RS+RT EMR+++QS + TK+V +L S++ ++  VL +VFHSSLQ E +V++ L GG  PV
Sbjct: 245 RSLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSLQDESFVKKQLIGGYTPV 304

Query: 303 FSILLRTVEQCKRLPSLLKLFHHATSLGGVESLIEWRAMSDTTVEQNLLRISVGCESPED 362
           FSI L   EQCK+LP  LK FHHATSLGGVESLIEWRAM+D  ++Q L+R S+GCES +D
Sbjct: 305 FSITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWRAMTDPYIDQTLIRFSIGCESADD 364

Query: 363 LIADLAGAFRQL 374
           LIADL  AF +L
Sbjct: 365 LIADLDAAFIEL 376

>KNAG0C04990 Chr3 (960378..961520) [1143 bp, 380 aa] {ON} Anc_5.423
           YHR112C
          Length = 380

 Score =  449 bits (1155), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 215/376 (57%), Positives = 275/376 (73%), Gaps = 2/376 (0%)

Query: 1   MVELCTSLIHADDNSNRVNDVAPPINVTTTFRYSEDDLIPAVERTADTAGSNGHFYSRVS 60
           M  L T+LIHADD  NRV DVAPPINV+TT+RY +DDL+P  +R +         YSR++
Sbjct: 1   MEHLATTLIHADDRDNRVPDVAPPINVSTTYRYDKDDLVPWRDRESLEFMDKRPIYSRLA 60

Query: 61  HPNGARCEVLLAEALGGEAVVYSSGLAAFGAALTHFNPKRLFIGRGYHGCHGVADIWVRN 120
           HPN  R E L ++ LGG AVVY+SGLAAF AAL H+NPKRLFI + YHGC  +A I  R 
Sbjct: 61  HPNSTRLESLFSQILGGHAVVYNSGLAAFFAALIHYNPKRLFIDQSYHGCRAIAHILTRT 120

Query: 121 HGLQKLSLEEVSERSEPGDLVHIESPINPYGTLV-DVXXXXXXXXXXXXYVVLDATFAPP 179
            G+Q+ SL++V + ++PGD+VH+ESP+NP GT+  D+             +++D+TFAPP
Sbjct: 121 TGMQQCSLDDVPQMAQPGDVVHLESPVNPLGTVPRDMSLLAEQAHERGAVLIVDSTFAPP 180

Query: 180 PLQDRWEQGADVVVHSCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTNIANLEAY 239
           PLQD W  G D+V+HS TKYFGGHSDLL GV   RD   A  LR DR+YLGTN+ANLEAY
Sbjct: 181 PLQDPWRFGCDMVMHSATKYFGGHSDLLSGVLVTRDQQTAGALRDDRIYLGTNVANLEAY 240

Query: 240 LLIRSMRTMEMRVVRQSTSATKVVAYLESHKAEFGGVLVKVFHSSLQT-EPYVQQYLRGG 298
           LL+RS+RT E+R+ RQST+ T VVAYL  H+ ++  VL K++HSSLQT EP+V + L GG
Sbjct: 241 LLLRSLRTFELRIQRQSTNCTAVVAYLNDHRGDWPLVLDKLYHSSLQTGEPWVAEQLEGG 300

Query: 299 NAPVFSILLRTVEQCKRLPSLLKLFHHATSLGGVESLIEWRAMSDTTVEQNLLRISVGCE 358
           + PVF++ LR+++QCKR P LL  F HATSLGGVESL+EWRAM+D  ++Q L+R+SVGCE
Sbjct: 301 HPPVFALTLRSIDQCKRFPQLLHYFQHATSLGGVESLVEWRAMTDPHIDQTLVRVSVGCE 360

Query: 359 SPEDLIADLAGAFRQL 374
           + EDLIADL  A   L
Sbjct: 361 NAEDLIADLTTALNAL 376

>KLLA0E21319g Chr5 (1904841..1905983) [1143 bp, 380 aa] {ON} highly
           similar to uniprot|P38716 Saccharomyces cerevisiae
           YHR112C Hypothetical ORF
          Length = 380

 Score =  446 bits (1148), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 211/375 (56%), Positives = 273/375 (72%), Gaps = 2/375 (0%)

Query: 2   VELCTSLIHADDNSNRVNDVAPPINVTTTFRYSEDDLIPAVERTADTAGSNGHFYSRVSH 61
           + L T L+HADD  NRV D+  PINV TTFRY E DLIP  ER   +       YSR++H
Sbjct: 1   MSLSTELVHADDKHNRVTDIVSPINVATTFRYEEVDLIPWNEREDFSVLEKKPIYSRLAH 60

Query: 62  PNGARCEVLLAEALGGEAVVYSSGLAAFGAALTHFNPKRLFIGRGYHGCHGVADIWVRNH 121
           PN  R E +L++ L GEAVVY++GLAA+ A LT++NPKRLFIG GYHGC  +ADI  RN 
Sbjct: 61  PNSLRVESVLSKVLEGEAVVYANGLAAYFAMLTYYNPKRLFIGEGYHGCRSIADIHTRNW 120

Query: 122 GLQ--KLSLEEVSERSEPGDLVHIESPINPYGTLVDVXXXXXXXXXXXXYVVLDATFAPP 179
            L+  KL ++E+ + +  GD+VHIE+P+NPYGT  D+             +V+D+TFAPP
Sbjct: 121 NLEQHKLEIDEILQHAGKGDVVHIETPVNPYGTSFDIKAFADATHSKGAILVIDSTFAPP 180

Query: 180 PLQDRWEQGADVVVHSCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTNIANLEAY 239
           PLQ+ W+ G DV++HS TKYFGGHSDLL GV AV+D  VA +LR DR+YLGTNIANLEA+
Sbjct: 181 PLQNPWDFGVDVILHSATKYFGGHSDLLAGVLAVKDKEVASKLRTDRIYLGTNIANLEAF 240

Query: 240 LLIRSMRTMEMRVVRQSTSATKVVAYLESHKAEFGGVLVKVFHSSLQTEPYVQQYLRGGN 299
           LL+RS+RT EMR+  QS +ATK+V+YL  HK++F GVL  VFHSSLQTEP+V++ L+GG 
Sbjct: 241 LLLRSLRTFEMRIQTQSENATKLVSYLIEHKSDFEGVLEGVFHSSLQTEPFVKEQLKGGY 300

Query: 300 APVFSILLRTVEQCKRLPSLLKLFHHATSLGGVESLIEWRAMSDTTVEQNLLRISVGCES 359
            PVF++ L + EQC++ P LL  F HATSLGGVESL+EWRA++D  +   L+R+SVG E+
Sbjct: 301 GPVFAVTLNSKEQCRKFPQLLTCFQHATSLGGVESLVEWRALTDPYIIPTLIRVSVGVEN 360

Query: 360 PEDLIADLAGAFRQL 374
            +DLI D A A + L
Sbjct: 361 VDDLIKDFANALKTL 375

>KAFR0E03860 Chr5 complement(766029..767165) [1137 bp, 378 aa] {ON}
           Anc_5.423 YHR112C
          Length = 378

 Score =  444 bits (1141), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 202/374 (54%), Positives = 276/374 (73%)

Query: 1   MVELCTSLIHADDNSNRVNDVAPPINVTTTFRYSEDDLIPAVERTADTAGSNGHFYSRVS 60
           M  L TSLIHADD  NRV+DVAPPINV+TT+RY E DLIP  ER           YSR++
Sbjct: 1   MTHLGTSLIHADDKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKPVYSRLA 60

Query: 61  HPNGARCEVLLAEALGGEAVVYSSGLAAFGAALTHFNPKRLFIGRGYHGCHGVADIWVRN 120
           HPN  R E L +E L G AV+YSSG AAF AA+ H+NPK++F+G+ YHG   +A+I  RN
Sbjct: 61  HPNATRLESLFSEILEGHAVIYSSGCAAFYAAMVHYNPKKIFMGQCYHGLRAIANIMTRN 120

Query: 121 HGLQKLSLEEVSERSEPGDLVHIESPINPYGTLVDVXXXXXXXXXXXXYVVLDATFAPPP 180
           +G+++ +L+++ + ++ GD+V +ESP+NPYGT +D+             V++D+TFAPPP
Sbjct: 121 YGVEQYTLDDIEKYAQEGDIVEVESPMNPYGTSIDIKSIAEKAHSKGAIVLVDSTFAPPP 180

Query: 181 LQDRWEQGADVVVHSCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTNIANLEAYL 240
           LQ  W+ GADVV+HS TKYFGGHSDLL GV  V+D  V ++LR DR+YLGTN+ NLE+Y+
Sbjct: 181 LQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTNVGNLESYM 240

Query: 241 LIRSMRTMEMRVVRQSTSATKVVAYLESHKAEFGGVLVKVFHSSLQTEPYVQQYLRGGNA 300
           L+RS+R+ E+R+++QS +ATKVV +L  +K  F  VL +V+HSSLQ E +V++ L GG  
Sbjct: 241 LLRSLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQKEAFVKKQLVGGYG 300

Query: 301 PVFSILLRTVEQCKRLPSLLKLFHHATSLGGVESLIEWRAMSDTTVEQNLLRISVGCESP 360
           PVFS+ L+T++QCK+ P  LK FHHATSLGGVESL+EWRAM+D  ++Q L+R+S+G E+ 
Sbjct: 301 PVFSMSLQTIDQCKKFPGKLKYFHHATSLGGVESLVEWRAMTDPYIDQTLIRVSIGVENA 360

Query: 361 EDLIADLAGAFRQL 374
           +DLI DL  A ++L
Sbjct: 361 DDLIKDLETALQEL 374

>TBLA0B03020 Chr2 complement(700483..701622) [1140 bp, 379 aa] {ON} 
          Length = 379

 Score =  439 bits (1128), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 203/372 (54%), Positives = 271/372 (72%), Gaps = 1/372 (0%)

Query: 1   MVELCTSLIHADDNSNRVNDVAPPINVTTTFRYSEDDLIPAVERTADTAG-SNGHFYSRV 59
           MV L T+LIH+DD +NRV DVAPPINV++TFRY  ++LIPA E     A       YSR 
Sbjct: 1   MVHLATTLIHSDDKNNRVTDVAPPINVSSTFRYDNNNLIPANEVDDFLASIEQSPVYSRE 60

Query: 60  SHPNGARCEVLLAEALGGEAVVYSSGLAAFGAALTHFNPKRLFIGRGYHGCHGVADIWVR 119
           SHPN +R + +L++ LGG AV+Y+SG +AF A + H+NPKR F+  GY G H +AD+  R
Sbjct: 61  SHPNSSRVQSILSDLLGGHAVIYNSGCSAFHAVMCHYNPKRFFMDGGYFGVHAIADLITR 120

Query: 120 NHGLQKLSLEEVSERSEPGDLVHIESPINPYGTLVDVXXXXXXXXXXXXYVVLDATFAPP 179
           N+GL++ SL+E+ E ++PGDLVH+ESP+NP+GT  D+             + +D+T APP
Sbjct: 121 NYGLEQHSLDEIEEFAQPGDLVHLESPLNPFGTASDIKALADRVHSKGAILSIDSTLAPP 180

Query: 180 PLQDRWEQGADVVVHSCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTNIANLEAY 239
           PLQ+ W  GAD+V+HS TKYFGGHSDLL GV AV+    A +L +DR++LGTNI NLE+Y
Sbjct: 181 PLQNVWNFGADIVLHSATKYFGGHSDLLAGVLAVKTKEQANELIEDRIHLGTNIGNLESY 240

Query: 240 LLIRSMRTMEMRVVRQSTSATKVVAYLESHKAEFGGVLVKVFHSSLQTEPYVQQYLRGGN 299
           LL+RS+RT EMR+++QS +ATK+V YL +HK    G L ++FH+SLQ E ++ + L GG+
Sbjct: 241 LLLRSLRTYEMRIMKQSDNATKIVKYLHNHKESLKGSLKEIFHTSLQNESFINKQLSGGH 300

Query: 300 APVFSILLRTVEQCKRLPSLLKLFHHATSLGGVESLIEWRAMSDTTVEQNLLRISVGCES 359
             VFSI+L ++ QCK+LP  LK F HATSLGG+ESLIEWRAMSD  ++Q L+R+SVGCE+
Sbjct: 301 GAVFSIILNSINQCKKLPLHLKYFQHATSLGGIESLIEWRAMSDDKIDQCLIRVSVGCEN 360

Query: 360 PEDLIADLAGAF 371
            EDLI DL  A 
Sbjct: 361 VEDLIKDLENAL 372

>CAGL0K05665g Chr11 complement(552804..553943) [1140 bp, 379 aa]
           {ON} highly similar to uniprot|P38716 Saccharomyces
           cerevisiae YHR112c
          Length = 379

 Score =  438 bits (1126), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 195/374 (52%), Positives = 276/374 (73%)

Query: 1   MVELCTSLIHADDNSNRVNDVAPPINVTTTFRYSEDDLIPAVERTADTAGSNGHFYSRVS 60
           MVEL T LIH DD  NRV+DVAPPINV+TT+RY+E+DLIP  +R           YSR  
Sbjct: 1   MVELATKLIHDDDKHNRVSDVAPPINVSTTYRYAEEDLIPWAQRENFDFMDEAPVYSREG 60

Query: 61  HPNGARCEVLLAEALGGEAVVYSSGLAAFGAALTHFNPKRLFIGRGYHGCHGVADIWVRN 120
           HPN  R E + ++ L G AV+Y+SGLAAF AA+ H+NPK++F+G+ YHG H ++D++ RN
Sbjct: 61  HPNCTRLETIFSDILEGHAVLYASGLAAFFAAMMHYNPKQVFLGQCYHGVHCISDMFTRN 120

Query: 121 HGLQKLSLEEVSERSEPGDLVHIESPINPYGTLVDVXXXXXXXXXXXXYVVLDATFAPPP 180
             +Q+ +LE+++E ++ GD+VH+ESP+NP+GT++DV             V++D+TFAPPP
Sbjct: 121 FNVQQRTLEDIAEFAKKGDVVHLESPVNPFGTVIDVKKLADLAHSKGAIVIIDSTFAPPP 180

Query: 181 LQDRWEQGADVVVHSCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTNIANLEAYL 240
           LQ  W+ GAD+++HS TKYFGGHSDLLGG+   +D  ++R L++DR+ LG+ I NLE+YL
Sbjct: 181 LQYAWDLGADMIMHSATKYFGGHSDLLGGILVTKDKEISRALKEDRINLGSMIGNLESYL 240

Query: 241 LIRSMRTMEMRVVRQSTSATKVVAYLESHKAEFGGVLVKVFHSSLQTEPYVQQYLRGGNA 300
           L+RS+RT EMR+++QS +  K+V YL  +K ++  VL  ++HSS+Q++ +V+  L GG  
Sbjct: 241 LMRSLRTYEMRIMKQSENVVKIVKYLNDNKEKYPNVLGDIYHSSIQSDAFVKDQLVGGYN 300

Query: 301 PVFSILLRTVEQCKRLPSLLKLFHHATSLGGVESLIEWRAMSDTTVEQNLLRISVGCESP 360
            VFS  L++ EQCK+ P  LK FHHATSLGG+ESLIEWRA+SD  ++Q L+R+SVGCES 
Sbjct: 301 SVFSFCLKSEEQCKKFPDKLKYFHHATSLGGIESLIEWRALSDDKIDQKLMRVSVGCESA 360

Query: 361 EDLIADLAGAFRQL 374
           +DLI DL+ A ++L
Sbjct: 361 KDLIDDLSQALQEL 374

>TBLA0A03680 Chr1 complement(919740..920894) [1155 bp, 384 aa] {ON}
           Anc_5.423 YHR112C
          Length = 384

 Score =  437 bits (1125), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 202/369 (54%), Positives = 272/369 (73%)

Query: 3   ELCTSLIHADDNSNRVNDVAPPINVTTTFRYSEDDLIPAVERTADTAGSNGHFYSRVSHP 62
           +L T LIH DD +NRV DVAPPIN+ TTFRY  +DLIP  ER   +       YSR++HP
Sbjct: 8   DLETLLIHGDDVNNRVTDVAPPINIATTFRYDNEDLIPWNERGDLSFMETKPIYSRLAHP 67

Query: 63  NGARCEVLLAEALGGEAVVYSSGLAAFGAALTHFNPKRLFIGRGYHGCHGVADIWVRNHG 122
           N +R E L ++ L G AV+Y+SG++AF AA+T+FNPKR+F+G+ YHGC    +I  RN  
Sbjct: 68  NSSRLETLFSKILDGNAVIYNSGVSAFFAAMTYFNPKRVFLGQNYHGCTAAVNILERNGT 127

Query: 123 LQKLSLEEVSERSEPGDLVHIESPINPYGTLVDVXXXXXXXXXXXXYVVLDATFAPPPLQ 182
           L+K + +E+ E ++ GD+VH+ESP+NPYGT  D+             V++D+TFAPPPLQ
Sbjct: 128 LKKHTHKEIEEFAQKGDIVHLESPVNPYGTSYDIEEFVKKAHSKGVLVMIDSTFAPPPLQ 187

Query: 183 DRWEQGADVVVHSCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTNIANLEAYLLI 242
             W+   D+V+HS TK+FGGHSDLL GV  V+D  +A+ LR+DR+YLGTNIANLE+YLL+
Sbjct: 188 YVWDFDVDIVMHSATKFFGGHSDLLSGVLVVKDENIAKDLREDRIYLGTNIANLESYLLL 247

Query: 243 RSMRTMEMRVVRQSTSATKVVAYLESHKAEFGGVLVKVFHSSLQTEPYVQQYLRGGNAPV 302
           RS+RT EMR+++QSTSAT++V +L  ++ +F  VL +++HSSLQ E +V++ L+GG  PV
Sbjct: 248 RSLRTFEMRILKQSTSATQIVKFLNDNRHKFNKVLKEIYHSSLQKEDFVKKQLKGGYTPV 307

Query: 303 FSILLRTVEQCKRLPSLLKLFHHATSLGGVESLIEWRAMSDTTVEQNLLRISVGCESPED 362
           FSI+L   EQCK LP+LLK F HATSLGGVESLIEWRA++D  + Q L+R+SVGCE+ +D
Sbjct: 308 FSIVLHNKEQCKALPNLLKYFIHATSLGGVESLIEWRALTDPYIIQTLIRVSVGCENTQD 367

Query: 363 LIADLAGAF 371
           LI DL  A 
Sbjct: 368 LINDLDQAL 376

>NDAI0F00140 Chr6 (15124..16260) [1137 bp, 378 aa] {ON} 
          Length = 378

 Score =  422 bits (1086), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 195/375 (52%), Positives = 269/375 (71%), Gaps = 1/375 (0%)

Query: 1   MVELCTSLIHADDNSNRVNDVAPPINVTTTFRYSEDDLIPAVE-RTADTAGSNGHFYSRV 59
           M  L T+LIH DD  NRV DVAPPINV+TTFR+  ++LIPA E +    +      Y+R 
Sbjct: 1   MAHLSTALIHGDDKLNRVTDVAPPINVSTTFRFDNNNLIPANEVKDFLQSIDENPVYARE 60

Query: 60  SHPNGARCEVLLAEALGGEAVVYSSGLAAFGAALTHFNPKRLFIGRGYHGCHGVADIWVR 119
           SHPN +R + +L++ LGG AV+Y+SG +AF A + H+NPKR F+  GY G H +AD+  R
Sbjct: 61  SHPNSSRVQAVLSDLLGGHAVIYNSGCSAFHALMCHYNPKRFFMDGGYFGVHAIADLITR 120

Query: 120 NHGLQKLSLEEVSERSEPGDLVHIESPINPYGTLVDVXXXXXXXXXXXXYVVLDATFAPP 179
           N+GL++ SL+E+ E ++ GD+VH+E+P+NP+GT  D+             + +DAT APP
Sbjct: 121 NYGLEQHSLDEIEEFAQAGDIVHLETPLNPFGTSSDIEALAKRVHDKGAILSIDATLAPP 180

Query: 180 PLQDRWEQGADVVVHSCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTNIANLEAY 239
           PLQD W+ GAD+++HS TKYFGGHSDLL GV  V+    A +L +DR++LGTNI NLE+Y
Sbjct: 181 PLQDAWKFGADIILHSATKYFGGHSDLLAGVLVVKTKEQAYELIEDRIHLGTNIGNLESY 240

Query: 240 LLIRSMRTMEMRVVRQSTSATKVVAYLESHKAEFGGVLVKVFHSSLQTEPYVQQYLRGGN 299
           LL+RS+RT EMR+++Q  +  KV+ YL  +K++F  VL K++HSSLQ + +VQ+ L G  
Sbjct: 241 LLLRSLRTYEMRIMKQENNTRKVITYLNENKSKFNKVLNKIYHSSLQDDDFVQKQLSGLY 300

Query: 300 APVFSILLRTVEQCKRLPSLLKLFHHATSLGGVESLIEWRAMSDTTVEQNLLRISVGCES 359
            PVF+I L +++QCK LP  LK F HATSLGGVESLIEWRAMSD+ ++Q L+R+S+GCE+
Sbjct: 301 CPVFAITLHSIDQCKELPLYLKYFQHATSLGGVESLIEWRAMSDSDIDQCLIRVSIGCEN 360

Query: 360 PEDLIADLAGAFRQL 374
            +DLI DL  A + L
Sbjct: 361 ADDLIKDLENALQIL 375

>ZYRO0F09768g Chr6 complement(793824..794945) [1122 bp, 373 aa] {ON}
           highly similar to uniprot|P38716 Saccharomyces
           cerevisiae YHR112C Hypothetical ORF
          Length = 373

 Score =  420 bits (1080), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 195/374 (52%), Positives = 266/374 (71%), Gaps = 1/374 (0%)

Query: 1   MVELCTSLIHADDNSNRVNDVAPPINVTTTFRYSEDDLIPAVERTADTAGSNGHFYSRVS 60
           MV+L T L+H DD  NRV DVAPPINV +TFRY  D+LIP  ++           YSR  
Sbjct: 1   MVDLETLLLHGDDEHNRVTDVAPPINVASTFRYDNDNLIPWRDQPNLDFLDENPVYSREG 60

Query: 61  HPNGARCEVLLAEALGGEAVVYSSGLAAFGAALTHFNPKRLFIGRGYHGCHGVADIWVRN 120
           HPNG R E L +  LGG A+ YS GL  F   + HFNPKR+F+ + YHG  G+  I  RN
Sbjct: 61  HPNGVRLEALFSRFLGGHAICYSCGLGGFLGVMVHFNPKRVFMDQCYHGVQGIVGILKRN 120

Query: 121 HGLQKLSLEEVSERSEPGDLVHIESPINPYGTLVDVXXXXXXXXXXXXYVVLDATFAPPP 180
           +G+++  L ++ + ++ GD+VH+E+PINP+GT +D+             +++D+TFAPPP
Sbjct: 121 YGVERYGLADIEKHAQKGDIVHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAPPP 180

Query: 181 LQDRWEQGADVVVHSCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTNIANLEAYL 240
           LQ+ W+ GAD+++HS TKYF GHSDLL GV  V+D  VA +L++DR+YLG+NIANLE+YL
Sbjct: 181 LQNAWDFGADMIMHSATKYFAGHSDLLSGVLVVKDKEVASKLKEDRIYLGSNIANLESYL 240

Query: 241 LIRSMRTMEMRVVRQSTSATKVVAYLESHKAEFGGVLVKVFHSSLQTEPYVQQYLRGGNA 300
           L+RS+RT ++R+ RQ+ +ATKVV YL  HK ++   LV+++HSSLQTE +V++ L GG  
Sbjct: 241 LLRSLRTYDLRIRRQAENATKVVKYLNDHKDKYPA-LVELYHSSLQTEEFVKKQLSGGYT 299

Query: 301 PVFSILLRTVEQCKRLPSLLKLFHHATSLGGVESLIEWRAMSDTTVEQNLLRISVGCESP 360
           PVFS+  +T EQCK+  S LKLF HATSLGGVESL+EWRAM D+ ++Q L+R+S+GCES 
Sbjct: 300 PVFSLTFKTEEQCKKFCSSLKLFQHATSLGGVESLVEWRAMCDSDIDQCLVRVSIGCESA 359

Query: 361 EDLIADLAGAFRQL 374
           +DLI DL+    QL
Sbjct: 360 DDLINDLSTVLSQL 373

>ZYRO0F15664g Chr6 (1286078..1287199) [1122 bp, 373 aa] {ON} highly
           similar to uniprot|P38716 Saccharomyces cerevisiae
           YHR112C Hypothetical ORF
          Length = 373

 Score =  419 bits (1078), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 195/374 (52%), Positives = 265/374 (70%), Gaps = 1/374 (0%)

Query: 1   MVELCTSLIHADDNSNRVNDVAPPINVTTTFRYSEDDLIPAVERTADTAGSNGHFYSRVS 60
           MV+L T L+H DD  NRV DVAPPINV +TFRY  D+L+P  + T          YSR  
Sbjct: 1   MVDLATLLLHGDDEHNRVTDVAPPINVASTFRYDNDNLVPWRDITNLDCLDEYPVYSREG 60

Query: 61  HPNGARCEVLLAEALGGEAVVYSSGLAAFGAALTHFNPKRLFIGRGYHGCHGVADIWVRN 120
           HPNG R E L +  LGG AV YS GL  F +A+ HFNPKR+F+ + YHG  G+  I  RN
Sbjct: 61  HPNGVRLEALFSRFLGGHAVCYSCGLGGFLSAMVHFNPKRVFMDQCYHGVQGIVGIMKRN 120

Query: 121 HGLQKLSLEEVSERSEPGDLVHIESPINPYGTLVDVXXXXXXXXXXXXYVVLDATFAPPP 180
           +G+++  L ++ + ++ GD+VH+E+PINP+GT +D+             +++D+TFAPPP
Sbjct: 121 YGVERYGLADIEKHAQKGDIVHVETPINPFGTSLDISELARRAHAKGALLMVDSTFAPPP 180

Query: 181 LQDRWEQGADVVVHSCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTNIANLEAYL 240
           LQ+ W+ GAD+++HS TKYFGGHSDLL GV  V+D   A +L++DR+ LG+NI+NL++YL
Sbjct: 181 LQNAWDFGADMIMHSATKYFGGHSDLLSGVLVVKDKETASKLKEDRICLGSNISNLDSYL 240

Query: 241 LIRSMRTMEMRVVRQSTSATKVVAYLESHKAEFGGVLVKVFHSSLQTEPYVQQYLRGGNA 300
           L+RS+RT ++R+ RQS SATK+V YL  HK +F   L K++HSSLQ++ +V++ L GG  
Sbjct: 241 LLRSLRTYDLRIKRQSESATKIVQYLNDHKNDFPA-LDKLYHSSLQSDDFVKKQLSGGYG 299

Query: 301 PVFSILLRTVEQCKRLPSLLKLFHHATSLGGVESLIEWRAMSDTTVEQNLLRISVGCESP 360
           PVFS+ L+T EQCK+  S LKLF HATSLGGVESL+EWRAM D+ ++Q L+R+S+GCES 
Sbjct: 300 PVFSLTLKTEEQCKKFCSSLKLFQHATSLGGVESLVEWRAMCDSDIDQCLVRVSIGCESA 359

Query: 361 EDLIADLAGAFRQL 374
           EDL  DL     QL
Sbjct: 360 EDLTNDLTTVLSQL 373

>TDEL0G00140 Chr7 complement(20315..21460) [1146 bp, 381 aa] {ON} 
          Length = 381

 Score =  413 bits (1061), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 195/375 (52%), Positives = 264/375 (70%), Gaps = 1/375 (0%)

Query: 1   MVELCTSLIHADDNSNRVNDVAPPINVTTTFRYSEDDLIPAVE-RTADTAGSNGHFYSRV 59
           M  L T+ IHADD  NRV DVAPPINV+TTFRY  ++L+P VE             YSR 
Sbjct: 1   MTHLSTACIHADDIHNRVTDVAPPINVSTTFRYDNENLVPEVEIENFIETIEQTPVYSRE 60

Query: 60  SHPNGARCEVLLAEALGGEAVVYSSGLAAFGAALTHFNPKRLFIGRGYHGCHGVADIWVR 119
           SHPN  R + +L++ LGG A VY+SG++AF A + H+NPKR F+  GY G  G+A ++  
Sbjct: 61  SHPNSLRLQTVLSDILGGHATVYNSGVSAFHALIFHYNPKRFFMDDGYSGVRGIATLYQE 120

Query: 120 NHGLQKLSLEEVSERSEPGDLVHIESPINPYGTLVDVXXXXXXXXXXXXYVVLDATFAPP 179
            HGL+   L ++ E +E GDL+H+E P+NPYGT  D+             + +D+T APP
Sbjct: 121 KHGLETYKLHQIEEFAEKGDLIHLEVPLNPYGTCRDIAALAKRVHKKGAILSIDSTLAPP 180

Query: 180 PLQDRWEQGADVVVHSCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTNIANLEAY 239
           PLQD W+ GADVV+HS TKY GGHSDLL GV  V+     R+L ++R++LGTN+ NLE++
Sbjct: 181 PLQDAWDFGADVVMHSATKYLGGHSDLLAGVVVVKTMEQQRKLIRERIFLGTNVGNLESF 240

Query: 240 LLIRSMRTMEMRVVRQSTSATKVVAYLESHKAEFGGVLVKVFHSSLQTEPYVQQYLRGGN 299
           LL+RS+RT EMRV++QS +A K+V++L  +KA++  VL +V+HSSLQ E +VQ+ L GG+
Sbjct: 241 LLLRSLRTFEMRVLKQSENAAKIVSFLHENKAKYSKVLNEVYHSSLQKEAFVQRQLAGGH 300

Query: 300 APVFSILLRTVEQCKRLPSLLKLFHHATSLGGVESLIEWRAMSDTTVEQNLLRISVGCES 359
             VFS+ LR+VEQCK+LP+ L  F HATSLGGVESLIEWRA+SDT ++  L+R+S+GCE+
Sbjct: 301 GAVFSVTLRSVEQCKKLPAKLVYFQHATSLGGVESLIEWRALSDTKIDPFLVRLSIGCEN 360

Query: 360 PEDLIADLAGAFRQL 374
            +DLI DL  A + L
Sbjct: 361 ADDLIQDLDNALQVL 375

>KNAG0F01580 Chr6 complement(282872..284011) [1140 bp, 379 aa] {ON} 
          Length = 379

 Score =  412 bits (1059), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 192/373 (51%), Positives = 259/373 (69%)

Query: 1   MVELCTSLIHADDNSNRVNDVAPPINVTTTFRYSEDDLIPAVERTADTAGSNGHFYSRVS 60
           M    TS IHADD +NRV DVAPPINV+ T+RY  D+L    E+       +   YSR +
Sbjct: 1   MTHFATSAIHADDQNNRVPDVAPPINVSVTYRYDNDNLKICDEKECLEEMDSVPVYSRTA 60

Query: 61  HPNGARCEVLLAEALGGEAVVYSSGLAAFGAALTHFNPKRLFIGRGYHGCHGVADIWVRN 120
           HPN  R E +L+  L G AVVY+SG +AF AAL H+NPKRLFI   Y G H +ADI  RN
Sbjct: 61  HPNCTRLESVLSSILNGHAVVYNSGCSAFYAALVHYNPKRLFIEESYDGMHAIADIMTRN 120

Query: 121 HGLQKLSLEEVSERSEPGDLVHIESPINPYGTLVDVXXXXXXXXXXXXYVVLDATFAPPP 180
           +G+Q+ + + + + ++ GD+VH+ESP+NPYG   D+             +++D+T APPP
Sbjct: 121 YGMQQHTFDNIEKYAQVGDIVHLESPLNPYGISSDIQALADRAHAKGALLMVDSTLAPPP 180

Query: 181 LQDRWEQGADVVVHSCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTNIANLEAYL 240
           LQ+ W+ G D+++HS TKYFGGHSDLL G+   +D  V+ QL+ DR+YLGT   NLE++L
Sbjct: 181 LQNTWDFGPDIIMHSATKYFGGHSDLLAGILVTKDKDVSIQLKGDRIYLGTIPGNLESFL 240

Query: 241 LIRSMRTMEMRVVRQSTSATKVVAYLESHKAEFGGVLVKVFHSSLQTEPYVQQYLRGGNA 300
           L+RS+RTMEMRV++QS +ATK+V YL  +K  F  VL +++HSSLQ EP+V   + GG  
Sbjct: 241 LLRSLRTMEMRVLKQSENATKIVQYLVDNKETFDKVLGEIYHSSLQDEPFVAAQMSGGYT 300

Query: 301 PVFSILLRTVEQCKRLPSLLKLFHHATSLGGVESLIEWRAMSDTTVEQNLLRISVGCESP 360
           P+FS  L+T++Q K  P  LK+F HATSLGG+ESLIEWR +S+  ++Q LLRISVGCE+ 
Sbjct: 301 PLFSFKLQTIDQAKHFPEKLKIFQHATSLGGIESLIEWRVLSEPELDQTLLRISVGCENV 360

Query: 361 EDLIADLAGAFRQ 373
           +DLIADL  A +Q
Sbjct: 361 DDLIADLQNALQQ 373

>KLTH0E16566g Chr5 (1468783..1469928) [1146 bp, 381 aa] {ON} similar
           to uniprot|P38716 Saccharomyces cerevisiae YHR112C
           Hypothetical ORF
          Length = 381

 Score =  402 bits (1033), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 199/369 (53%), Positives = 256/369 (69%)

Query: 6   TSLIHADDNSNRVNDVAPPINVTTTFRYSEDDLIPAVERTADTAGSNGHFYSRVSHPNGA 65
           T+ IH DD  NRV+DVAPPINV+TTFRY ++ L PA   T      +   YSR+ HPN  
Sbjct: 6   TATIHGDDRLNRVSDVAPPINVSTTFRYDDEHLEPATISTGTHTSDSPMIYSRLGHPNAD 65

Query: 66  RCEVLLAEALGGEAVVYSSGLAAFGAALTHFNPKRLFIGRGYHGCHGVADIWVRNHGLQK 125
           R EV+L E L G  VVY+SGLAA+ A L H NPKRLF    YHGC  VA I  R  G++ 
Sbjct: 66  RLEVVLTEILDGPTVVYASGLAAYHAILIHVNPKRLFQPHCYHGCEAVAKIISRISGMEI 125

Query: 126 LSLEEVSERSEPGDLVHIESPINPYGTLVDVXXXXXXXXXXXXYVVLDATFAPPPLQDRW 185
           L LE + ++ + GDLVH+E P NPYG +V++             +++D+T APPPL++ W
Sbjct: 126 LPLENLEDKCQSGDLVHLEDPGNPYGEVVNLDEFAEKIHRAGALMLVDSTLAPPPLRNTW 185

Query: 186 EQGADVVVHSCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTNIANLEAYLLIRSM 245
           E GAD+V+HS TKYFGGHSDLL G+ +VRD  VA+QLR DR YLGT  A+LE+YLL+RS+
Sbjct: 186 EFGADIVMHSGTKYFGGHSDLLSGIVSVRDEKVAQQLRNDRTYLGTIPASLESYLLLRSL 245

Query: 246 RTMEMRVVRQSTSATKVVAYLESHKAEFGGVLVKVFHSSLQTEPYVQQYLRGGNAPVFSI 305
           RTME+RV++QS++ T++V YL SHK  +  V+  + H+SLQ E +V++ L GG  PVFS+
Sbjct: 246 RTMEIRVLKQSSNCTRLVEYLASHKDRYNSVVKDIRHASLQKEEFVKKQLPGGYGPVFSL 305

Query: 306 LLRTVEQCKRLPSLLKLFHHATSLGGVESLIEWRAMSDTTVEQNLLRISVGCESPEDLIA 365
           LL + EQCK L     LF HATSLGG ESLIEWRAMSD    +NL+R+SVG E+ EDLI 
Sbjct: 306 LLFSQEQCKLLVKNTVLFQHATSLGGAESLIEWRAMSDPFANRNLIRVSVGLENAEDLIE 365

Query: 366 DLAGAFRQL 374
           DLAG   ++
Sbjct: 366 DLAGTLEKI 374

>Kwal_55.22221 s55 (1160724..1161866) [1143 bp, 380 aa] {ON} YHR112C
           - Hypothetical ORF [contig 697] FULL
          Length = 380

 Score =  401 bits (1031), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 190/369 (51%), Positives = 263/369 (71%)

Query: 6   TSLIHADDNSNRVNDVAPPINVTTTFRYSEDDLIPAVERTADTAGSNGHFYSRVSHPNGA 65
           T+ IH+DD  NRV+DVAPPINV+TTFRY  + L+PA   T      +   YSR+ HPN  
Sbjct: 6   TNAIHSDDYLNRVSDVAPPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLGHPNAD 65

Query: 66  RCEVLLAEALGGEAVVYSSGLAAFGAALTHFNPKRLFIGRGYHGCHGVADIWVRNHGLQK 125
           R E +L++ L   AVVY+SGLAA+ A L HF PKRLF+   YHGC  VA I  R +G++ 
Sbjct: 66  RLEAVLSQLLDSHAVVYASGLAAYHAILVHFKPKRLFLPHCYHGCKEVARIISRLNGMEI 125

Query: 126 LSLEEVSERSEPGDLVHIESPINPYGTLVDVXXXXXXXXXXXXYVVLDATFAPPPLQDRW 185
           LSLE++  + + GDLVHIE PINP+G  VD+             ++LD+T  PPPL++ W
Sbjct: 126 LSLEDIEAKCQEGDLVHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGPPPLRNAW 185

Query: 186 EQGADVVVHSCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTNIANLEAYLLIRSM 245
           + GAD+++HS TKYFGGHSDLL G+  V D A+A QL+ DR YLGT  A+LE++LL+RS+
Sbjct: 186 DYGADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIPASLESFLLLRSL 245

Query: 246 RTMEMRVVRQSTSATKVVAYLESHKAEFGGVLVKVFHSSLQTEPYVQQYLRGGNAPVFSI 305
           RTM++RV RQS + T++V+YL ++  +F  V+ ++ H+SLQTE +V+Q + GG  PVF++
Sbjct: 246 RTMDIRVRRQSQNCTELVSYLANNSEKFSSVVQEIRHASLQTEAFVKQQMPGGFGPVFAL 305

Query: 306 LLRTVEQCKRLPSLLKLFHHATSLGGVESLIEWRAMSDTTVEQNLLRISVGCESPEDLIA 365
           +L++ +QC+++   +  F HATSLGGVESLIEWRAMSD T  + L+R+SVG E+ EDLIA
Sbjct: 306 ILKSEDQCRKVVKNVSFFQHATSLGGVESLIEWRAMSDPTALKTLIRVSVGLENIEDLIA 365

Query: 366 DLAGAFRQL 374
           DLAG+  ++
Sbjct: 366 DLAGSLEKI 374

>TDEL0G04970 Chr7 complement(925785..926930) [1146 bp, 381 aa] {ON} 
          Length = 381

 Score =  390 bits (1003), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 187/375 (49%), Positives = 257/375 (68%), Gaps = 1/375 (0%)

Query: 1   MVELCTSLIHADDNSNRVNDVAPPINVTTTFRYSEDDLIPAVE-RTADTAGSNGHFYSRV 59
           M  L T+ IHADD  NRV+DVAPPINVTTTFR+  D+LIP  E      A      Y+R 
Sbjct: 1   MTHLSTTSIHADDIHNRVSDVAPPINVTTTFRFDNDNLIPEAELENFIEAIEESPVYARE 60

Query: 60  SHPNGARCEVLLAEALGGEAVVYSSGLAAFGAALTHFNPKRLFIGRGYHGCHGVADIWVR 119
           +HPN  R + +L+  LGG A VY+SG +AF A +   NPKR+F+   Y G   +A +   
Sbjct: 61  THPNSIRVQSILSSILGGHAAVYNSGCSAFHALMFRLNPKRVFMDDAYGGVETIASLIKE 120

Query: 120 NHGLQKLSLEEVSERSEPGDLVHIESPINPYGTLVDVXXXXXXXXXXXXYVVLDATFAPP 179
            +GL+   L+++ E +E GDLVH+E+P+NP+G   ++             + +D+T APP
Sbjct: 121 KYGLKIFKLDQIEEFAEKGDLVHLETPLNPFGICTNIVALAERVHKKGALLSVDSTLAPP 180

Query: 180 PLQDRWEQGADVVVHSCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTNIANLEAY 239
           PLQ+ W+ GAD+V+HS TKY GGHSDLL GV  V+D    R L ++R+YLGTN+ NLE++
Sbjct: 181 PLQNAWDFGADIVMHSATKYLGGHSDLLAGVLVVKDVETQRALIKERIYLGTNLGNLESF 240

Query: 240 LLIRSMRTMEMRVVRQSTSATKVVAYLESHKAEFGGVLVKVFHSSLQTEPYVQQYLRGGN 299
           LL+RS+RT EMRV +QS +A KVV +L  + A++  VL +++HSSLQ E +VQ+ L GG+
Sbjct: 241 LLLRSLRTFEMRVTKQSENALKVVTFLHENSAKYPKVLDQLYHSSLQKEEFVQKQLAGGH 300

Query: 300 APVFSILLRTVEQCKRLPSLLKLFHHATSLGGVESLIEWRAMSDTTVEQNLLRISVGCES 359
             VFS++L++VEQ K+LP+ L  F HATSLGGVESLIEWRAMSD+T++  L+R+SVGCE+
Sbjct: 301 GAVFSMILKSVEQAKKLPTKLVYFQHATSLGGVESLIEWRAMSDSTIDPCLVRLSVGCEN 360

Query: 360 PEDLIADLAGAFRQL 374
            +DLI DL    + L
Sbjct: 361 VDDLIQDLDQGLQAL 375

>NDAI0B00595 Chr2 (131225..132361) [1137 bp, 378 aa] {ON}
          Length = 378

 Score =  377 bits (967), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 180/375 (48%), Positives = 258/375 (68%), Gaps = 1/375 (0%)

Query: 1   MVELCTSLIHADDNSNRVNDVAPPINVTTTFRYSEDDLIPAVE-RTADTAGSNGHFYSRV 59
           MV L T+LIH DD  NRV  VAPPINV+TTFR+  ++LIPA E +    +      Y++ 
Sbjct: 1   MVHLSTTLIHGDDKLNRVTYVAPPINVSTTFRFDSNNLIPANEVKDFLQSIDENPVYAKE 60

Query: 60  SHPNGARCEVLLAEALGGEAVVYSSGLAAFGAALTHFNPKRLFIGRGYHGCHGVADIWVR 119
           S+PN +R + +L++ LGG AV+Y+SG + F A + H+NPKR F+  GY G H +AD+  R
Sbjct: 61  SYPNSSRVQAVLSDLLGGHAVIYNSGCSFFHALMCHYNPKRFFMDGGYFGVHAIADLLTR 120

Query: 120 NHGLQKLSLEEVSERSEPGDLVHIESPINPYGTLVDVXXXXXXXXXXXXYVVLDATFAPP 179
           N+GL++  L+E+ E ++ GD+VH+E+P+NP+GT  D+             + +DAT A P
Sbjct: 121 NYGLEQQFLDEIEEFAQAGDIVHLETPLNPFGTSSDMEALGERVHTKGAILSIDATLASP 180

Query: 180 PLQDRWEQGADVVVHSCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTNIANLEAY 239
           PLQD W+ GAD+++HS TKY GGHSDLL GV  V+    A +L +DR++LGTNI NLE+Y
Sbjct: 181 PLQDAWKFGADIILHSATKYSGGHSDLLAGVLVVKTKEQAYELIEDRIHLGTNIGNLESY 240

Query: 240 LLIRSMRTMEMRVVRQSTSATKVVAYLESHKAEFGGVLVKVFHSSLQTEPYVQQYLRGGN 299
           LL+R + T EMR+++Q  +  KV+ YL  +K++F  V+ K++HSS Q + ++Q+ L G  
Sbjct: 241 LLLRLLSTYEMRIMKQEKNTRKVIIYLNENKSKFNKVVNKIYHSSSQDDDFIQKQLSGLY 300

Query: 300 APVFSILLRTVEQCKRLPSLLKLFHHATSLGGVESLIEWRAMSDTTVEQNLLRISVGCES 359
            PVF+I L +++QCK LP  LK F HATSLG  ESLIEWRA+SD  ++Q L+ +S+GCE+
Sbjct: 301 CPVFAITLHSIDQCKELPLHLKYFQHATSLGAAESLIEWRAVSDVDIDQCLIGVSIGCEN 360

Query: 360 PEDLIADLAGAFRQL 374
            +DLI DL  A + L
Sbjct: 361 ADDLIKDLENALQIL 375

>TPHA0A06070 Chr1 complement(1370008..1371129) [1122 bp, 373 aa]
           {ON}  YFR055W
          Length = 373

 Score =  369 bits (947), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 166/359 (46%), Positives = 250/359 (69%), Gaps = 1/359 (0%)

Query: 17  RVNDVAPPINVTTTFRYSEDDLIPAVE-RTADTAGSNGHFYSRVSHPNGARCEVLLAEAL 75
           +++D+APPINV+TT+RY E +LIPA E +   ++      YSR SH N +R + +L++ L
Sbjct: 8   KISDIAPPINVSTTYRYDEHNLIPAAEVKDFLSSIEENPVYSRESHANSSRVQKVLSKVL 67

Query: 76  GGEAVVYSSGLAAFGAALTHFNPKRLFIGRGYHGCHGVADIWVRNHGLQKLSLEEVSERS 135
            G AV+Y+SG +AF A + H+NPKR+F    Y G   +A++  RN+GL++ SL+++ + +
Sbjct: 68  NGHAVIYNSGCSAFHALMCHYNPKRIFFDESYFGIKAIANLITRNYGLKQYSLKDIDKFA 127

Query: 136 EPGDLVHIESPINPYGTLVDVXXXXXXXXXXXXYVVLDATFAPPPLQDRWEQGADVVVHS 195
           + GD++HIE+P+NP+GT +++             + +D+T APPPLQ+ ++ GAD+V+HS
Sbjct: 128 QEGDIIHIETPLNPFGTAINIKEIAVKAHAKKALLSVDSTLAPPPLQNAFDFGADIVLHS 187

Query: 196 CTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTNIANLEAYLLIRSMRTMEMRVVRQ 255
            TKY GGHSDLL GV  V+    AR L +DR++LGTNI NLE++LL+RS+RT EMR+  Q
Sbjct: 188 ATKYLGGHSDLLAGVLVVKTEKEARALIEDRIHLGTNIGNLESFLLLRSLRTYEMRLSTQ 247

Query: 256 STSATKVVAYLESHKAEFGGVLVKVFHSSLQTEPYVQQYLRGGNAPVFSILLRTVEQCKR 315
           S +  K+V +LE+++ ++  V+  ++HSSLQ E +V + L  G+  VF+++ ++ EQCK 
Sbjct: 248 SQNVVKIVNFLETNRCQYKNVIQHIYHSSLQKEVFVSEQLSKGHTAVFAVIFKSQEQCKN 307

Query: 316 LPSLLKLFHHATSLGGVESLIEWRAMSDTTVEQNLLRISVGCESPEDLIADLAGAFRQL 374
               LK F HATSLGGVESL+EWRAMSD  ++  L+R S+GCE+ EDLI DL  A  +L
Sbjct: 308 FVQYLKYFQHATSLGGVESLVEWRAMSDPDIDPCLIRFSIGCENAEDLIEDLKSALCRL 366

>CAGL0H06369g Chr8 (627708..628883) [1176 bp, 391 aa] {ON} highly
           similar to uniprot|P31373 Saccharomyces cerevisiae
           YAL012w CYS3
          Length = 391

 Score =  131 bits (329), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 120/398 (30%), Positives = 182/398 (45%), Gaps = 44/398 (11%)

Query: 3   ELCTSLIHADDNSNRVNDVAPPINVTTTFRYSEDDLIPAVERTADTAGSNGHFYSRVSHP 62
           +  T  IHA  + +    V  PI+++TTF+ SE          A   G+  + YSR  +P
Sbjct: 8   KFATKAIHAGAHEDIHGSVIEPISLSTTFKQSE---------PAKPIGT--YEYSRSQNP 56

Query: 63  NGARCEVLLAEALGGE-AVVYSSGLAAFGAALTHF--NPKRLFIGRGYHGCHGVADIWVR 119
           N    E  +A   GG+  + +SSG A     L         + IG  Y G H        
Sbjct: 57  NRENLEAAIASLEGGKYGLAFSSGSATTAVILQSLPQGSHAVSIGDVYGGTHRYFTKVAN 116

Query: 120 NHGLQKLSLEEVSER-----SEPGDLVHIESPINPYGTLVDVXXXXXXXXXXXXYVVL-- 172
            HG+       + E       +   LV IESP NP   + D+             ++L  
Sbjct: 117 AHGVDTSFTNNLIEDLPKLVKDNTKLVWIESPTNPTLKVTDIQLVAENVKKINKDILLVV 176

Query: 173 DATFAPPPLQDRWEQGADVVVHSCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTN 232
           D TF  P L +  + GAD+VVHS TKY  GHSD++ GV A     +  +L+  +  +G  
Sbjct: 177 DNTFLSPYLSNPLKFGADIVVHSATKYINGHSDVVLGVLATNSKDIYERLQFLQNAIGCI 236

Query: 233 IANLEAYLLIRSMRTMEMRVVRQSTSATKVVAYLESHKAEFGGVLVKVFHSSLQTEP--- 289
            +  +A+L  R ++T+ +RV + S +ATK+  +LES++      +V V +  LQ+ P   
Sbjct: 237 PSPFDAWLTHRGLKTLHLRVRQASLNATKIATFLESNEN-----VVAVNYPGLQSHPNYD 291

Query: 290 YVQQYLR---GGNAPVFSILLRTVEQCKRLPSLLKLFHHATSLGGVESLIE--------- 337
            V++  R   GG    F I     E   +  S  +LF  A SLGG+ESL+E         
Sbjct: 292 VVKKQHREALGGGMISFRI-KGGAEAAAKFSSSTRLFTLAESLGGIESLLEVPAVMTHGG 350

Query: 338 --WRAMSDTTVEQNLLRISVGCESPEDLIADLAGAFRQ 373
               A   + V  +L+R+SVG E  EDL+ D+  A ++
Sbjct: 351 IPKEAREASGVFDDLVRLSVGIEDGEDLLEDIKQALQK 388

>NCAS0F01520 Chr6 complement(303410..304699) [1290 bp, 429 aa] {ON}
           Anc_7.97 YAL012W
          Length = 429

 Score =  125 bits (313), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 121/398 (30%), Positives = 183/398 (45%), Gaps = 46/398 (11%)

Query: 3   ELCTSLIHADDNSNRVNDVAPPINVTTTFRYSEDDLIPAVERTADTAGSNGHFYSRVSHP 62
           +  T  IHA  +++    V  PI+++TTF+ S           A+  G   + YSR  +P
Sbjct: 45  KFATKAIHAGTHTDVHGSVIEPISLSTTFKQSS---------PANPVGI--YEYSRSQNP 93

Query: 63  NGARCEVLLAEALGGE-AVVYSSGLAAFGAALTHF--NPKRLFIGRGYHGCHGVADIWVR 119
           N    E  +A    G+  + +SSG A     L         + IG  Y G H        
Sbjct: 94  NRENLENAIAALENGKYGLAFSSGSATTATVLQSLPQGSHAISIGDVYGGTHRYFTKVAN 153

Query: 120 NHGLQKLSLEEVSER-----SEPGDLVHIESPINPYGTLVDVXXXXXXXXXXXXYVVL-- 172
            HG++     ++ +       E   LV IESP NP   + D+             ++L  
Sbjct: 154 AHGVETTFTNDLLKELPNLVKENTKLVWIESPTNPTLKVTDIQAVADAIKSLNKDIILVV 213

Query: 173 DATFAPPPLQDRWEQGADVVVHSCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTN 232
           D TF  P L +  + GAD+VVHS TKY  GHSD++ GV A  D A+  +L+  +  +G  
Sbjct: 214 DNTFLSPYLSNPLDFGADIVVHSATKYINGHSDVVLGVLATNDKALYEKLQFLQNAIGAI 273

Query: 233 IANLEAYLLIRSMRTMEMRVVRQSTSATKVVAYLESHKAEFGGVLVK-VFHSSLQT-EPY 290
            +  +++L  R ++T+ +RV + S +ATK+  +L+S        LVK V +  L T E Y
Sbjct: 274 PSPFDSWLAHRGLKTLHLRVRQASLNATKIAQFLQSSP------LVKAVNYPGLPTHENY 327

Query: 291 --VQQYLR---GGNAPVFSILLRTVEQCKRLPSLLKLFHHATSLGGVESLIE-------- 337
             VQ+  R   GG    F I   + E   +  S  +LF  A SLGG+ESL+E        
Sbjct: 328 AVVQKQHREALGGGMISFRIQGGS-EAASKFSSSTRLFTLAESLGGIESLLEVPAVMTHG 386

Query: 338 ---WRAMSDTTVEQNLLRISVGCESPEDLIADLAGAFR 372
                A   + V  +L+R+SVG E  +DL+ D+  A  
Sbjct: 387 GIPKEAREASGVYDDLVRLSVGIEDGDDLLDDIKQALE 424

>SAKL0B09614g Chr2 complement(813507..814685) [1179 bp, 392 aa] {ON}
           highly similar to uniprot|P31373 Saccharomyces
           cerevisiae YAL012W CYS3 Cystathionine gamma-lyase
           catalyzes one of the two reactions involved in the
           transsulfuration pathway that yields cysteine from
           homocysteine with the intermediary formation of
           cystathionine
          Length = 392

 Score =  124 bits (310), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 111/396 (28%), Positives = 177/396 (44%), Gaps = 42/396 (10%)

Query: 3   ELCTSLIHADDNSNRVNDVAPPINVTTTFRYSEDDLIPAVERTADTAGSNGHFYSRVSHP 62
           +  T  IHA  +++    V  PI+++TTF+           +TA       + YSR  +P
Sbjct: 8   KFATKAIHAGAHTDVHGSVIEPISLSTTFK-----------QTAPAQPVGEYEYSRSQNP 56

Query: 63  NGARCEVLLAEALGGE-AVVYSSGLAAFGAALTHF--NPKRLFIGRGYHGCHGVADIWVR 119
           N    E  +A     +  + +SSG A     L         + IG  Y G H        
Sbjct: 57  NRKNLEDAVAALENAKYGLAFSSGSATTAVVLQSLPQGSHAVSIGDVYGGTHRYFTKVAN 116

Query: 120 NHGLQKLSLEEVSER-----SEPGDLVHIESPINPYGTLVDVXXXXXXXXXXXXYVVL-- 172
            HG++      + E       E   LV IESP NP   + D+             ++L  
Sbjct: 117 AHGVETTFTNNLVEDLAQLVKENTRLVWIESPTNPTLKVTDIELVSKTIKSINKDILLVV 176

Query: 173 DATFAPPPLQDRWEQGADVVVHSCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTN 232
           D TF  P L +    GAD+VVHS TKY  GHSD++ GV A  D  +  +L+  +  +G  
Sbjct: 177 DNTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATNDKEIYERLQFLQNAIGAI 236

Query: 233 IANLEAYLLIRSMRTMEMRVVRQSTSATKVVAYLESHKAEFGGVLVKVFHSSLQTEP--- 289
            +  +A+L  R ++T+ +RV + +T+ATK+  +L   +      +V V +  L T P   
Sbjct: 237 PSPFDAWLSHRGLKTLHLRVRQAATTATKIAEFLSQSED-----VVAVNYPGLPTHPNHN 291

Query: 290 -YVQQYLRGGNAPVFSILLR-TVEQCKRLPSLLKLFHHATSLGGVESLIEWRAM------ 341
             ++Q+  G    + S  ++   E   +  S  +LF  A SLGG+ESL+E  A+      
Sbjct: 292 VVLKQHRDGLGGGMISFRIKGGAEAAAKFSSSTRLFTLAESLGGIESLLEVPAVMTHGGI 351

Query: 342 -----SDTTVEQNLLRISVGCESPEDLIADLAGAFR 372
                  + V  +L+R+S+G E  +DL+ D+  A  
Sbjct: 352 PKDQREASGVFDDLIRLSIGIEDTDDLLDDIKQALE 387

>KAFR0K00760 Chr11 (171591..172769) [1179 bp, 392 aa] {ON} Anc_7.97
           YAL012W
          Length = 392

 Score =  122 bits (307), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 115/403 (28%), Positives = 176/403 (43%), Gaps = 54/403 (13%)

Query: 3   ELCTSLIHADDNSNRVNDVAPPINVTTTFRYSEDDLIPAVERTADTAGSNGHFYSRVSHP 62
           +  T  IHA  + +    V  PI+++TTFR S           A   G+  + YSR  +P
Sbjct: 8   KFATKAIHAGAHVDVHGSVIEPISLSTTFRQSA---------PAQPIGT--YEYSRSQNP 56

Query: 63  NGARCEVLLAEALGGE-AVVYSSGLAAFGAALTHF--NPKRLFIGRGYHGCHGVADIWVR 119
           N    EV +A    G+  + +SSG A     L         + IG  Y G H        
Sbjct: 57  NRENLEVAIASLENGKYGLAFSSGSATTAVILQSLPQGSHAISIGDVYGGTHRYFTKVAN 116

Query: 120 NHGLQKLSLEEVSER-----SEPGDLVHIESPINPYGTLVDVXXXXXXXXXXXXYVVL-- 172
            HG++     ++         E   LV IESP NP   + D+             ++L  
Sbjct: 117 AHGVETSFTNDLLNDLPKLVKENTKLVWIESPTNPTLKITDIEAVSQKVKSLNKDILLVV 176

Query: 173 DATFAPPPLQDRWEQGADVVVHSCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTN 232
           D TF  P L +    GAD+VVHS TKY  GHSD++ GV A  +  +  +L+  +  +G  
Sbjct: 177 DNTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATNNKDIYERLQFLQNAIGAI 236

Query: 233 IANLEAYLLIRSMRTMEMRVVRQSTSATKVVAYLESHK----AEFGGV-------LVKVF 281
            +  +A+L  R +RT+ +RV + S SA K+  +L++++      + G+       +VK  
Sbjct: 237 PSPFDAWLTHRGLRTLHLRVRQASLSAQKIAEFLQNNENVEAVNYPGLPTHKDYDVVKKQ 296

Query: 282 HSSLQTEPYVQQYLRGGNAPVFSILLRTVEQCKRLPSLLKLFHHATSLGGVESLIE---- 337
           H        +   ++GG            E   +  S  +LF  A SLGGVESL+E    
Sbjct: 297 HREALGGGMISFRIKGG-----------AEAAAKFSSSTRLFALAESLGGVESLLEVPAV 345

Query: 338 -------WRAMSDTTVEQNLLRISVGCESPEDLIADLAGAFRQ 373
                    A   + V  NL+R+SVG E  +DL+ D+  A  +
Sbjct: 346 MTHGGIPKEAREASGVYDNLVRLSVGIEDGDDLLEDVKQALEK 388

>YAL012W Chr1 (130799..131983) [1185 bp, 394 aa] {ON}
           CYS3Cystathionine gamma-lyase, catalyzes one of the two
           reactions involved in the transsulfuration pathway that
           yields cysteine from homocysteine with the intermediary
           formation of cystathionine
          Length = 394

 Score =  122 bits (305), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 113/400 (28%), Positives = 177/400 (44%), Gaps = 45/400 (11%)

Query: 3   ELCTSLIHADDNSNRVNDVAPPINVTTTFRYSEDDLIPAVERTADTAGSNGHFYSRVSHP 62
           +  T  IHA ++ +    V  PI+++TTF+ S           A+  G+  + YSR  +P
Sbjct: 8   KFATKAIHAGEHVDVHGSVIEPISLSTTFKQSS---------PANPIGT--YEYSRSQNP 56

Query: 63  NGARCEVLLAEALGGE-AVVYSSGLAAFGAALTHF--NPKRLFIGRGYHGCHGVADIWVR 119
           N    E  +A     +  + +SSG A     L         + IG  Y G H        
Sbjct: 57  NRENLERAVAALENAQYGLAFSSGSATTATILQSLPQGSHAVSIGDVYGGTHRYFTKVAN 116

Query: 120 NHGLQKLSLEEVSER-----SEPGDLVHIESPINPYGTLVDVXXXXXXXXXXXX----YV 170
            HG++     ++         E   LV IE+P NP   + D+                 +
Sbjct: 117 AHGVETSFTNDLLNDLPQLIKENTKLVWIETPTNPTLKVTDIQKVADLIKKHAAGQDVIL 176

Query: 171 VLDATFAPPPLQDRWEQGADVVVHSCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLG 230
           V+D TF  P + +    GAD+VVHS TKY  GHSD++ GV A  +  +  +L+  +  +G
Sbjct: 177 VVDNTFLSPYISNPLNFGADIVVHSATKYINGHSDVVLGVLATNNKPLYERLQFLQNAIG 236

Query: 231 TNIANLEAYLLIRSMRTMEMRVVRQSTSATKVVAYLESHKAEFGGVLVKVFHSSLQTEPY 290
              +  +A+L  R ++T+ +RV + + SA K+  +L + K      +V V +  L+T P 
Sbjct: 237 AIPSPFDAWLTHRGLKTLHLRVRQAALSANKIAEFLAADKEN----VVAVNYPGLKTHPN 292

Query: 291 VQQYLR------GGNAPVFSILLRTVEQCKRLPSLLKLFHHATSLGGVESLIE------- 337
               L+      GG    F I     E   +  S  +LF  A SLGG+ESL+E       
Sbjct: 293 YDVVLKQHRDALGGGMISFRI-KGGAEAASKFASSTRLFTLAESLGGIESLLEVPAVMTH 351

Query: 338 ----WRAMSDTTVEQNLLRISVGCESPEDLIADLAGAFRQ 373
                 A   + V  +L+RISVG E  +DL+ D+  A +Q
Sbjct: 352 GGIPKEAREASGVFDDLVRISVGIEDTDDLLEDIKQALKQ 391

>Skud_1.49 Chr1 (106029..107213) [1185 bp, 394 aa] {ON} YAL012W
           (REAL)
          Length = 394

 Score =  121 bits (304), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 113/400 (28%), Positives = 177/400 (44%), Gaps = 45/400 (11%)

Query: 3   ELCTSLIHADDNSNRVNDVAPPINVTTTFRYSEDDLIPAVERTADTAGSNGHFYSRVSHP 62
           +  T  IHA ++ +    V  PI+++TTF+ S           A+  G+  + YSR  +P
Sbjct: 8   KFATKAIHAGEHVDVHGSVIEPISLSTTFKQSS---------PANPIGT--YEYSRSQNP 56

Query: 63  NGARCEVLLAEALGGE-AVVYSSGLAAFGAALTHF--NPKRLFIGRGYHGCHGVADIWVR 119
           N    E  +A     +  + +SSG A     L         + IG  Y G H        
Sbjct: 57  NRENLERAVAALENAQYGLAFSSGSATTATILQSLPQGAHAVSIGDVYGGTHRYFTKVAN 116

Query: 120 NHGLQKLSLEEVSER-----SEPGDLVHIESPINPYGTLVDVXXXXXXXXXXXX----YV 170
            HG++     ++         +   LV IE+P NP   + D+                 +
Sbjct: 117 AHGVETSFTNDLLTDLPQLLKDNTKLVWIETPTNPTLKVTDIQKVADLIKKHAAGQDVIL 176

Query: 171 VLDATFAPPPLQDRWEQGADVVVHSCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLG 230
           V+D TF  P + +  + GAD+VVHS TKY  GHSD++ GV A     +  +L+  +  +G
Sbjct: 177 VVDNTFLSPYISNPLDFGADIVVHSATKYINGHSDVVLGVLATNSKPLYERLQFLQNAIG 236

Query: 231 TNIANLEAYLLIRSMRTMEMRVVRQSTSATKVVAYLESHKAEFGGVLVKVFHSSLQTEPY 290
              +  +A+L  R ++T+ +RV + + SA K+  +L S K      +V V +  L+T P 
Sbjct: 237 AIPSPFDAWLTHRGLKTLHLRVRQAALSAIKIAEFLASDKEN----IVAVNYPGLKTHPN 292

Query: 291 VQQYLR------GGNAPVFSILLRTVEQCKRLPSLLKLFHHATSLGGVESLIE------- 337
               L+      GG    F I     E   +  S  +LF  A SLGG+ESL+E       
Sbjct: 293 YDVVLKQHRDALGGGMISFRI-KGGAEAASKFASSTRLFTLAESLGGIESLLEVPAVMTH 351

Query: 338 ----WRAMSDTTVEQNLLRISVGCESPEDLIADLAGAFRQ 373
                 A   + V  +L+RISVG E  +DL+ D+  A +Q
Sbjct: 352 GGIPKEAREASGVFDDLIRISVGIEDTDDLLEDVKQALKQ 391

>Kpol_1044.10 s1044 (19232..20407) [1176 bp, 391 aa] {ON}
           (19232..20407) [1176 nt, 392 aa]
          Length = 391

 Score =  120 bits (302), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 111/392 (28%), Positives = 175/392 (44%), Gaps = 34/392 (8%)

Query: 3   ELCTSLIHADDNSNRVNDVAPPINVTTTFRYSEDDLIPAVERTADTAGSNGHFYSRVSHP 62
           +  T  IHA  + +    V  PI+++TTF+ S           A   G   + YSR  +P
Sbjct: 8   KFATKAIHAGSHVDVHGSVIEPISLSTTFKQSA---------PAQPIGE--YEYSRSQNP 56

Query: 63  NGARCEVLLAEALGGE-AVVYSSGLAAFGAALTHF--NPKRLFIGRGYHGCHGVADIWVR 119
           N    E  +A    G+  + +SSG A     L         + IG  Y G H        
Sbjct: 57  NRKNLEDAIAALENGKYGLAFSSGSATTSVILQSLPQGSHAVSIGDVYGGTHRYFTKVAN 116

Query: 120 NHGLQKLSLEEVSER-----SEPGDLVHIESPINPYGTLVDVXXXXXXXXXXXXYVVL-- 172
            HG++      + E       E   LV IESP NP   + D+             ++L  
Sbjct: 117 THGVETTFTNNLVEELPQLIKENTRLVWIESPTNPTLKVTDIGLVSQTIKSLKKDIILVV 176

Query: 173 DATFAPPPLQDRWEQGADVVVHSCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTN 232
           D TF  P L +    GAD+VVHS TKY  GHSD++ GV A  D  +  +L+  +  +G  
Sbjct: 177 DNTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATNDKDIYERLQFLQNAIGAI 236

Query: 233 IANLEAYLLIRSMRTMEMRVVRQSTSATKVVAYLESHKAEFGGVLVKVFHSSLQTEPYVQ 292
            +  +++L+ R ++T+ +RV + + +ATK+  +L S++     V      SS   E   +
Sbjct: 237 PSPFDSWLVHRGLKTLHLRVRQAALNATKIAEFLASNENVI-AVNYPGLPSSENFEVVKK 295

Query: 293 QYLRGGNAPVFSILLR-TVEQCKRLPSLLKLFHHATSLGGVESLIEWRAM---------- 341
           Q+       + S  ++   E   +  S  +LF  A SLGG+ESL+E  A+          
Sbjct: 296 QHRDALGGGMISFRIKGGAEAASKFSSSTRLFTLAESLGGIESLLEVPAVMTHGGIPKEQ 355

Query: 342 -SDTTVEQNLLRISVGCESPEDLIADLAGAFR 372
              + V  +L+R+SVG E  +DL+ D+  A +
Sbjct: 356 REASGVFDDLIRLSVGIEDSDDLLDDIKQALQ 387

>Smik_1.55 Chr1 (113765..114949) [1185 bp, 394 aa] {ON} YAL012W
           (REAL)
          Length = 394

 Score =  120 bits (301), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 113/399 (28%), Positives = 175/399 (43%), Gaps = 45/399 (11%)

Query: 4   LCTSLIHADDNSNRVNDVAPPINVTTTFRYSEDDLIPAVERTADTAGSNGHFYSRVSHPN 63
             T  IHA ++ +    V  PI+++TTF+ S           A+  G+  + YSR  +PN
Sbjct: 9   FATKAIHAGEHIDVHGSVIEPISLSTTFKQSS---------PANPIGT--YEYSRSQNPN 57

Query: 64  GARCEVLLAEALGGE-AVVYSSGLAAFGAALTHF--NPKRLFIGRGYHGCHGVADIWVRN 120
               E  +A     +  + +SSG A     L         + IG  Y G H         
Sbjct: 58  RENLEKAVAALENAQYGLAFSSGSATTATILQSLPQGSHAVSIGDVYGGTHRYFTKVANA 117

Query: 121 HGLQKLSLEEVSER-----SEPGDLVHIESPINPYGTLVDVXXXXXXXXXXXX----YVV 171
           HG++     ++             LV IE+P NP   + D+                 +V
Sbjct: 118 HGVETSFTNDLLNDLPQLLKNNTKLVWIETPTNPTLKVTDIQKVADLIKKHAAGQDVILV 177

Query: 172 LDATFAPPPLQDRWEQGADVVVHSCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGT 231
           +D TF  P + +    GAD+VVHS TKY  GHSD++ GV A  +  +  +L+  +  +G 
Sbjct: 178 VDNTFLSPYISNPLNFGADIVVHSATKYINGHSDVVLGVLATNNKQLYERLQFLQNAIGA 237

Query: 232 NIANLEAYLLIRSMRTMEMRVVRQSTSATKVVAYLESHKAEFGGVLVKVFHSSLQTEPYV 291
             +  +A+L  R ++T+ +RV + + SA K+  +L S K      +V V +  L+T P  
Sbjct: 238 IPSPFDAWLTHRGLKTLHLRVRQAALSAIKIAEFLASDKEN----VVAVNYPGLKTHPNY 293

Query: 292 QQYLR------GGNAPVFSILLRTVEQCKRLPSLLKLFHHATSLGGVESLIE-------- 337
              L+      GG    F I     E   +  S  +LF  A SLGG+ESL+E        
Sbjct: 294 DVVLKQHRDALGGGMISFRI-KGGAEAASKFASSTRLFTLAESLGGIESLLEVPAVMTHG 352

Query: 338 ---WRAMSDTTVEQNLLRISVGCESPEDLIADLAGAFRQ 373
                A   + V  +L+RISVG E  +DL+ D+  A +Q
Sbjct: 353 GIPKEAREASGVYDDLVRISVGIEDTDDLLEDVKQALKQ 391

>TBLA0E02240 Chr5 (554046..555209) [1164 bp, 387 aa] {ON} Anc_7.97
           YAL012W
          Length = 387

 Score =  120 bits (301), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 113/395 (28%), Positives = 176/395 (44%), Gaps = 42/395 (10%)

Query: 3   ELCTSLIHADDNSNRVNDVAPPINVTTTFRYSEDDLIPAVERTADTAGSNGHFYSRVSHP 62
           +  T  IHA  + +    V  PI+++TTF+ S           A +     + YSR  +P
Sbjct: 8   KFATKAIHAGAHIDVHGSVIEPISLSTTFKQS-----------APSQPIGIYEYSRSQNP 56

Query: 63  NGARCEVLLAEALGGE-AVVYSSGLAAFGAALTHF--NPKRLFIGRGYHGCHGVADIWVR 119
           N    E  +A    G+  + +SSG A     L         + IG  Y G H        
Sbjct: 57  NRKNLEEAIATLENGKYGLAFSSGSATTAVILQSLPQGSHSISIGDVYGGTHRYFTKVAN 116

Query: 120 NHGLQKLS----LEEVSERSEPGD-LVHIESPINPYGTLVDVXXXXXXXXXXXX--YVVL 172
            HG++       +EE+    +P   LV IESP NP   + D+               VV+
Sbjct: 117 AHGVESTFSNNLIEELPTLVKPNTRLVWIESPTNPTLKVTDIQLVVDTVKKLNKDILVVV 176

Query: 173 DATFAPPPLQDRWEQGADVVVHSCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTN 232
           D TF  P L +    GAD+VVHS TKY  GHSD++ GV A     +  +L+  +  +G  
Sbjct: 177 DNTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATNSKEIYERLQFLQNAIGAI 236

Query: 233 IANLEAYLLIRSMRTMEMRVVRQSTSATKVVAYLESHKAEFGGVLVKVFHSSLQTEP--- 289
            +  +A+L  R ++T+ +RV + S SA K+  +L          ++ V +  L++ P   
Sbjct: 237 PSPFDAWLAHRGLKTLHLRVRQASLSAQKIAEFLAQDPN-----VIAVNYPGLESHPNRD 291

Query: 290 -YVQQYLRGGNAPVFSILLR-TVEQCKRLPSLLKLFHHATSLGGVESLIEWRAM------ 341
              +Q+  G    + S  ++   E   +     +LF  A SLGG+ESL+E  A+      
Sbjct: 292 IVKKQHRDGLGGGMISFRIKGGAEGASKFTQKTRLFTLAESLGGIESLLEVPAVMTHGGI 351

Query: 342 -----SDTTVEQNLLRISVGCESPEDLIADLAGAF 371
                  T V  +L+R+SVG E  +DL+AD+  A 
Sbjct: 352 PKEAREATGVYDDLVRLSVGIEDVDDLLADVKQAL 386

>ZYRO0D05742g Chr4 (489953..491128) [1176 bp, 391 aa] {ON} highly
           similar to uniprot|P31373 Saccharomyces cerevisiae
           YAL012W CYS3 Cystathionine gamma-lyase catalyzes one of
           the two reactions involved in the transsulfuration
           pathway that yields cysteine from homocysteine with the
           intermediary formation of cystathionine
          Length = 391

 Score =  120 bits (301), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 116/397 (29%), Positives = 180/397 (45%), Gaps = 44/397 (11%)

Query: 3   ELCTSLIHADDNSNRVNDVAPPINVTTTFRYSEDDLIPAVERTADTAGSNGHFYSRVSHP 62
           +  T  IHA  + +    V  PI+++TTF+ S           A   G   + YSR  +P
Sbjct: 8   KFATKAIHAGAHVDVHGSVIEPISLSTTFKQSA---------PAQPLGE--YEYSRSQNP 56

Query: 63  NGARCEVLLAEALGGE-AVVYSSGLAAFGAALTHF--NPKRLFIGRGYHGCHGVADIWVR 119
           N    E  +A    G+  + +SSG A     L         + IG  Y G H        
Sbjct: 57  NRKNLEDAIASLENGKHGLAFSSGSATTAVILQSLPQGSHAISIGDVYGGTHRYFTKVAN 116

Query: 120 NHGLQ----KLSLEEVSERSEPG-DLVHIESPINPYGTLVDVXXXXXXXXXXXX--YVVL 172
            HG+        ++++    +P   L+ IESP NP   + D+               VV+
Sbjct: 117 AHGVDVSFTNELVKDLPSLVKPNTKLLWIESPTNPTLQVTDIALVNKTVKELNKDILVVV 176

Query: 173 DATFAPPPLQDRWEQGADVVVHSCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTN 232
           D TF  P L +  + G DVVVHS TKY  GHSD++ GV A     +  +L+  +  +G  
Sbjct: 177 DNTFLSPYLSNPLDFGVDVVVHSATKYINGHSDVVLGVLATNSTELYERLQFLQNAIGAI 236

Query: 233 IANLEAYLLIRSMRTMEMRVVRQSTSATKVVAYLESHKAEFGGVLVKVFHSSLQTEP--- 289
            +  +A+L  R ++T+ +RV + +T+ATK+  +L+S+       ++ V +  L + P   
Sbjct: 237 PSPFDAWLAHRGLKTLHLRVRQAATTATKIAEFLQSNDR-----VIAVNYPGLASHPSHD 291

Query: 290 YVQQYLR---GGNAPVFSILLRTVEQCKRLPSLLKLFHHATSLGGVESLIEWRAM----- 341
            VQ+  R   GG    F I     E   +  S  +LF  A SLGG+ESL+E  A+     
Sbjct: 292 VVQRQHRDGLGGGMISFRI-KGGAEGAAKFSSNTRLFTLAESLGGIESLLEVPAVMTHGG 350

Query: 342 ------SDTTVEQNLLRISVGCESPEDLIADLAGAFR 372
                   + V  +L+R+SVG E  EDL+ D+  A +
Sbjct: 351 IPEDQREASGVYDDLIRLSVGIEDTEDLLEDIKQALK 387

>Suva_1.56 Chr1 (107030..108217) [1188 bp, 395 aa] {ON} YAL012W
           (REAL)
          Length = 395

 Score =  120 bits (301), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 110/400 (27%), Positives = 179/400 (44%), Gaps = 44/400 (11%)

Query: 3   ELCTSLIHADDNSNRVNDVAPPINVTTTFRYSEDDLIPAVERTADTAGSNGHFYSRVSHP 62
           +  T  IHA ++ +    V  PI+++TTF+ S           A+  G+  + YSR  +P
Sbjct: 8   KFATKAIHAGEHVDVHGSVIEPISLSTTFKQSS---------PANPIGT--YEYSRSQNP 56

Query: 63  NGARCEVLLAEALGGE-AVVYSSGLAAFGAALTHF--NPKRLFIGRGYHGCHGVADIWVR 119
           N    E  +A     +  + +SSG A     L         + IG  Y G H        
Sbjct: 57  NRENLERAVAALENAQYGLAFSSGSATTATILQSLPQGSHAVSIGDVYGGTHRYFTKVAN 116

Query: 120 NHGLQKLSLEEVSER-----SEPGDLVHIESPINPYGTLVDVXXXXX-----XXXXXXXY 169
            HG++     ++ +       +   LV IE+P NP   + D+                  
Sbjct: 117 AHGVETSFTNDLLKDLPQLLKDNTKLVWIETPTNPTLKVTDIQKVADAIKKHTAASQDVI 176

Query: 170 VVLDATFAPPPLQDRWEQGADVVVHSCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYL 229
           +V+D TF  P + +    GAD+VVHS TKY  GHSD++ GV A     +  +L+  +  +
Sbjct: 177 LVVDNTFLSPYISNPLNFGADIVVHSATKYINGHSDVVLGVLATNSKPLYERLQFLQNAI 236

Query: 230 GTNIANLEAYLLIRSMRTMEMRVVRQSTSATKVVAYLESHKAEFGGVLVKVFHSSLQTEP 289
           G   +  +A+L  R ++T+ +RV + + SA K+  +L + K      +V V +  L+T P
Sbjct: 237 GAIPSPFDAWLTHRGLKTLHLRVRQAALSAIKIAEFLAADKEN----IVAVNYPGLKTHP 292

Query: 290 ----YVQQYLRGGNAPVFSILLR-TVEQCKRLPSLLKLFHHATSLGGVESLIE------- 337
                V+Q+       + S  ++   E   +  S  +LF  A SLGG+ESL+E       
Sbjct: 293 NYDVVVKQHRDALGGGMISFRIKGGAEAASKFASSTRLFTLAESLGGIESLLEVPAVMTH 352

Query: 338 ----WRAMSDTTVEQNLLRISVGCESPEDLIADLAGAFRQ 373
                 A   + V  +L+RISVG E  +DL+ D+  A +Q
Sbjct: 353 GGIPKEAREASGVFDDLVRISVGIEDADDLLDDIKQALKQ 392

>TDEL0H03530 Chr8 complement(586031..587206) [1176 bp, 391 aa] {ON}
           Anc_7.97 YAL012W
          Length = 391

 Score =  120 bits (300), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 115/395 (29%), Positives = 176/395 (44%), Gaps = 42/395 (10%)

Query: 3   ELCTSLIHADDNSNRVNDVAPPINVTTTFRYSEDDLIPAVERTADTAGSNGHFYSRVSHP 62
           +  T  IHA  + +    V  PI+++TTF+ S     PA       A    + YSR  +P
Sbjct: 8   KFATKAIHAGAHVDIHGSVIEPISLSTTFKQSS----PA-------APLGEYEYSRSQNP 56

Query: 63  NGARCEVLLAEALGGE-AVVYSSGLAAFGAALTHF--NPKRLFIGRGYHGCHGVADIWVR 119
           N    E  LA     +  + +SSG A     L         + IG  Y G H        
Sbjct: 57  NRKNLEEALAALENAKYGLAFSSGSATTAVVLQSLPQGSHAVSIGDVYGGTHRYFTKVAN 116

Query: 120 NHGLQKLSLEEV-----SERSEPGDLVHIESPINPYGTLVDVX--XXXXXXXXXXXYVVL 172
            HG+      ++     S   E   LV IESP NP   + D+               VV+
Sbjct: 117 AHGVDTSFTNDLIKDLPSLIKENTKLVWIESPTNPTLKVTDIALVVKTAKQINKEILVVV 176

Query: 173 DATFAPPPLQDRWEQGADVVVHSCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTN 232
           D TF  P L +    G D+VVHS TKY  GHSD++ GV A  D A+  +L+  +  +G  
Sbjct: 177 DNTFLSPYLSNPLNFGVDIVVHSATKYINGHSDVVLGVLATNDKAIYEKLQFLQNAIGAI 236

Query: 233 IANLEAYLLIRSMRTMEMRVVRQSTSATKVVAYLESHKAEFGGVLVKVFHSSLQTEP--- 289
            +  +++L  R ++T+ +RV + + +ATK+  +LE         ++ V +  L + P   
Sbjct: 237 PSPFDSWLAHRGLKTLHLRVRQAALTATKIAEFLEQDSN-----VLAVNYPGLASNPDRE 291

Query: 290 YVQQYLRGG-NAPVFSILLRTVEQ-CKRLPSLLKLFHHATSLGGVESLIEWRAM------ 341
            VQ+  R G    + S  ++   Q   +  S  +LF  A SLGG+ESL+E  A+      
Sbjct: 292 IVQRQHRDGLGGGMISFRIKGGAQAAAKFSSSTRLFTLAESLGGIESLLEVPAVMTHGGI 351

Query: 342 -----SDTTVEQNLLRISVGCESPEDLIADLAGAF 371
                  + V  +L+R+SVG E  +DL+ D+  A 
Sbjct: 352 PKEQREASGVYDDLIRLSVGIEDSDDLLTDIKEAL 386

>TPHA0L00570 Chr12 (97933..99108) [1176 bp, 391 aa] {ON} Anc_7.97
           YAL012W
          Length = 391

 Score =  118 bits (295), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 115/398 (28%), Positives = 176/398 (44%), Gaps = 44/398 (11%)

Query: 3   ELCTSLIHADDNSNRVNDVAPPINVTTTFRYSEDDLIPAVERTADTAGSNGHFYSRVSHP 62
           +  T  IHA  + +    V  PI+++TTF+ S           A+  G   + YSR  +P
Sbjct: 8   KFATKAIHAGSHVDVHGSVIEPISLSTTFKQSA---------PAEPIGE--YEYSRSQNP 56

Query: 63  NGARCEVLLAEALGGE-AVVYSSGLAAFGAALTHF--NPKRLFIGRGYHGCHGVADIWVR 119
           N    E  +A    G+  + +SSG A     L     N   + IG  Y G H        
Sbjct: 57  NRKNLEDAIAALENGKYGLAFSSGSATTAIILQSLPQNSHAISIGDVYGGTHRYFSKVAN 116

Query: 120 NHGL-----QKLSLEEVSERSEPGDLVHIESPINPYGTLVDVXXXXXXXXXXXXYVVL-- 172
            HG+       L  +      E   LV IESP NP   + D+             ++L  
Sbjct: 117 THGVDTDFTNDLVADLPKLVKENTRLVWIESPTNPTLKVTDIELVAKTIKSLNKDILLVV 176

Query: 173 DATFAPPPLQDRWEQGADVVVHSCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTN 232
           D TF  P L +    GAD+VVHS TKY  GHSD++ GV A     +  +L+  +  +G  
Sbjct: 177 DNTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATNSRDIYERLQFLQNAVGAI 236

Query: 233 IANLEAYLLIRSMRTMEMRVVRQSTSATKVVAYLESHKAEFGGVLVKVFHSSLQTEP--- 289
            +  +A+L  R ++T+ +RV + + +ATK+  +L          +V V +  L T P   
Sbjct: 237 PSPFDAWLTHRGLKTLHLRVRQAALNATKIAEFLAQSDN-----VVAVNYPGLPTNPDYA 291

Query: 290 YVQQYLR---GGNAPVFSILLRTVEQCKRLPSLLKLFHHATSLGGVESLIEWRAM----- 341
            V++  R   GG    F +     E   +  S  +LF  A SLGG+ESL+E  A+     
Sbjct: 292 IVKKQHRDALGGGMISFRV-KGGAEAASKFASSTRLFTLAESLGGIESLLEVPAVMTHGG 350

Query: 342 ------SDTTVEQNLLRISVGCESPEDLIADLAGAFRQ 373
                   + V  +L+R+SVG E  +DL+ D+  A ++
Sbjct: 351 IPKEQREASGVFDDLVRLSVGIEDGDDLLEDVKAALQK 388

>KNAG0D04740 Chr4 complement(851405..852577) [1173 bp, 390 aa] {ON}
           Anc_7.97 YAL012W
          Length = 390

 Score =  118 bits (295), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 113/397 (28%), Positives = 176/397 (44%), Gaps = 44/397 (11%)

Query: 3   ELCTSLIHADDNSNRVNDVAPPINVTTTFRYSEDDLIPAVERTADTAGSNGHFYSRVSHP 62
           +  T  +HA ++++    V  PI+++TTF+ S           A+  G   + YSR  +P
Sbjct: 6   KFATLAVHAGEHTDVHGSVIEPISLSTTFKQSS---------PANPIGV--YEYSRSQNP 54

Query: 63  NGARCEVLLAEALGGE-AVVYSSGLAAFGAALTHF--NPKRLFIGRGYHGCHGVADIWVR 119
           N    E  +A     +  + +SSG AA    +         + IG  Y G H        
Sbjct: 55  NRDNLENAIAALEKAQYGLAFSSGSAATSVIMQSLPQGSHAVSIGDVYGGTHRYFTKVAN 114

Query: 120 NHGLQKLSLEEVSER-----SEPGDLVHIESPINPYGTLVDVXXXXXXXXXXXXYVVL-- 172
            HG++      + E       +   LV IESP NP   + D+             ++L  
Sbjct: 115 THGVETTFTNNLLEELPNLVKDNTRLVWIESPTNPTLKVTDIQAVSNAIKKINKDILLVV 174

Query: 173 DATFAPPPLQDRWEQGADVVVHSCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTN 232
           D TF  P L +    GAD+VVHS TKY  GHSD++ GV A     +  +L+  +  +G  
Sbjct: 175 DNTFLSPYLSNPLTFGADIVVHSATKYINGHSDVVLGVLATNSKDIYERLQFLQNAIGAI 234

Query: 233 IANLEAYLLIRSMRTMEMRVVRQSTSATKVVAYLESHKAEFGGVLVKVFHSSLQTEP--- 289
            +  +A+L  R ++T+ +RV + S +A K+  +L + K      +  V +  L+T P   
Sbjct: 235 PSPFDAWLTHRGLKTLHLRVKQASVTAQKIAEFLSASKH-----VEAVNYPGLKTHPNHA 289

Query: 290 YVQQYLR---GGNAPVFSILLRTVEQCKRLPSLLKLFHHATSLGGVESLIEWRAM----- 341
            VQ+  R   GG    F +         +  S  +LF  A SLGG+ESL+E  A+     
Sbjct: 290 VVQRQHRDALGGGMISFRV-KGGAAAAAKFSSTTRLFTLAESLGGIESLLEVPAVMTHGG 348

Query: 342 ------SDTTVEQNLLRISVGCESPEDLIADLAGAFR 372
                   + V  NL+R+SVG E  EDL+ D+  A  
Sbjct: 349 IPKESREASGVYDNLIRLSVGIEDTEDLLEDIKQALE 385

>KLLA0F07909g Chr6 (742468..743643) [1176 bp, 391 aa] {ON} highly
           similar to uniprot|P31373 Saccharomyces cerevisiae
           YAL012W CYS3 Cystathionine gamma-lyase catalyzes one of
           the two reactions involved in the transsulfuration
           pathway that yields cysteine from homocysteine with the
           intermediary formation of cystathionine
          Length = 391

 Score =  118 bits (295), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 115/396 (29%), Positives = 178/396 (44%), Gaps = 44/396 (11%)

Query: 3   ELCTSLIHADDNSNRVNDVAPPINVTTTFRYSEDDLIPAVERTADTAGSNGHFYSRVSHP 62
           +  T  IHA  + +    V  PI+++TTF+           ++A       + YSR  +P
Sbjct: 8   KFATKAIHAGTHVDVHGSVIEPISLSTTFK-----------QSAPAQPIGEYEYSRSQNP 56

Query: 63  NGARCEVLLAEALGGE-AVVYSSGLAAFGAALTHF--NPKRLFIGRGYHGCHGVADIWVR 119
           N    E  +A    G+  + +SSG A     L         + IG  Y G H        
Sbjct: 57  NRKNLEDAIAALENGKYGLAFSSGSATTAVILQSLPQGSHAVSIGDVYGGTHRYFTKVAN 116

Query: 120 NHGLQ-----KLSLEEVSERSEPGDLVHIESPINPYGTLVDVXXXXXXXXXXXXYVVL-- 172
            HG++      L  E  S   E   LV IE+P NP   + D+             ++L  
Sbjct: 117 AHGVETTFTNNLVAELPSLIKENTKLVWIETPTNPTLKVTDIELVAKTAKSINKDILLVV 176

Query: 173 DATFAPPPLQDRWEQGADVVVHSCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTN 232
           D TF  P L +    GAD+VVHS TKY  GHSD++ GV A  D  +  +L+  +  +G  
Sbjct: 177 DNTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATNDKVIYEKLQFLQNAIGAI 236

Query: 233 IANLEAYLLIRSMRTMEMRVVRQSTSATKVVAYLESHKAEFGGVLVKVFHSSLQT-EPY- 290
            +  +++L+ R ++T+ +RV + S SA K+  +L S++      ++ V +  L T E Y 
Sbjct: 237 PSPFDSWLVHRGVKTLHLRVRQASLSAHKIAEFLSSNEN-----VIAVNYPGLPTHESYA 291

Query: 291 -VQQYLR---GGNAPVFSILLRTVEQCKRLPSLLKLFHHATSLGGVESLIEWRAM----- 341
            V++  R   GG    F I     E      S  +LF  A SLGG+ESL+E  A+     
Sbjct: 292 VVKKQHRDALGGGMISFRI-KGGAEAASTFSSSTRLFTLAESLGGIESLLEVPAVMTHGG 350

Query: 342 ------SDTTVEQNLLRISVGCESPEDLIADLAGAF 371
                   + V  +L+R+S+G E  +DL+ D+  A 
Sbjct: 351 IPKEQREASGVYDDLVRLSIGIEDTDDLLEDIKQAL 386

>KLTH0D02728g Chr4 (267019..268197) [1179 bp, 392 aa] {ON} highly
           similar to uniprot|P31373 Saccharomyces cerevisiae
           YAL012W CYS3 Cystathionine gamma-lyase catalyzes one of
           the two reactions involved in the transsulfuration
           pathway that yields cysteine from homocysteine with the
           intermediary formation of cystathionine
          Length = 392

 Score =  118 bits (295), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 118/400 (29%), Positives = 176/400 (44%), Gaps = 48/400 (12%)

Query: 3   ELCTSLIHADDNSNRVNDVAPPINVTTTFRYSEDDLIPAVERTADTAGSNGHFYSRVSHP 62
           +  T  IHA  +++    V  PI+++TTF+ S           A       + YSR  +P
Sbjct: 8   KFATLAIHAGAHTDVHGSVIEPISLSTTFKQS-----------APAQPIGAYEYSRSQNP 56

Query: 63  NGARCEVLLAEALGGE-AVVYSSGLAAFGAALTHF--NPKRLFIGRGYHGCHGVADIWVR 119
           N A  E  +A     +  + +SSG A     L     +   + IG  Y G H        
Sbjct: 57  NRANLEAAVAALERAQFGLAFSSGSATTAVVLQSLPTDSHAISIGDVYGGTHRYFTQVAH 116

Query: 120 NHGLQKLSLEEVSERSEP------GDLVHIESPINPYGTLVDVXXXXXXXXXXX--XYVV 171
            HG+Q  S     ER  P        LV +ESP NP   + D+               VV
Sbjct: 117 AHGVQT-SFTNDLERDLPQLVRPNTRLVWLESPTNPTLKVTDIRRVADAAHAANPDILVV 175

Query: 172 LDATFAPPPLQDRWEQGADVVVHSCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGT 231
           +D TF  P + +    GAD+VVHS TKY  GHSD++ GV A  +  +  +LR  +  +G 
Sbjct: 176 VDNTFLSPYISNPLTHGADIVVHSATKYINGHSDVVLGVLATNNEPLYERLRFLQNAIGA 235

Query: 232 NIANLEAYLLIRSMRTMEMRVVRQSTSATKVVAYLE-SHKAEFGGVLVKVFHSSLQTEP- 289
             +  +++L  R ++T+ +RV   + SA ++  +LE S + E       V +  L + P 
Sbjct: 236 VPSPFDSWLTHRGLKTLHLRVRAAAQSAQRIAKFLEASDRVE------HVNYPGLSSHPA 289

Query: 290 --YVQQYLR---GGNAPVFSILLRTVEQCKRLPSLLKLFHHATSLGGVESLIEWRAM--- 341
              VQ+  R   GG    F I         R  S  +LF  A SLGG+ESL+E  A+   
Sbjct: 290 YAVVQKQHRDALGGGMISFRI-KGGAGAAARFTSTTRLFTLAESLGGIESLVEVPAVMTH 348

Query: 342 --------SDTTVEQNLLRISVGCESPEDLIADLAGAFRQ 373
                     + V  NL+R+SVG E  +DL+ D+  A  +
Sbjct: 349 GGIPREQREASGVFDNLIRLSVGIEDIDDLLEDVRQALEK 388

>NDAI0H02400 Chr8 complement(582916..584097) [1182 bp, 393 aa] {ON}
           Anc_7.97
          Length = 393

 Score =  115 bits (288), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 110/402 (27%), Positives = 175/402 (43%), Gaps = 54/402 (13%)

Query: 3   ELCTSLIHADDNSNRVNDVAPPINVTTTFRYSEDDLIPAVERTADTAGSNGHFYSRVSHP 62
           +  T  IHA  + +    V  PI+++TTF+ S           A   G+  + YSR  +P
Sbjct: 8   KFATKAIHAGSHVDVHGSVIEPISLSTTFKQSA---------PAQPIGT--YEYSRSQNP 56

Query: 63  NGARCEVLLAEALGGE-AVVYSSGLAAFGAALTHF--NPKRLFIGRGYHGCHGVADIWVR 119
           N    E  +A    G+  + +SSG A     L     N   + IG  Y G H        
Sbjct: 57  NRENLENAIAALENGKYGLAFSSGSATTAIILQSLPQNSHAISIGDVYGGTHRYFTKVAN 116

Query: 120 NHGLQKLSLEEVSER-----SEPGDLVHIESPINPYGTLVDVXXXXXXXXXXXXYVVL-- 172
            HG++     ++ +       E   LV IESP NP   + D+             ++L  
Sbjct: 117 AHGVETTFTNDLIKDLPNLVKENTKLVWIESPTNPTLKVTDIEAVSKSIKSLNKDILLVV 176

Query: 173 DATFAPPPLQDRWEQGADVVVHSCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTN 232
           D TF  P L +    GAD+VVHS TKY  GHSD++ GV A  +  +  +L+  +  +G  
Sbjct: 177 DNTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATNNQEIYERLQFLQNAVGAI 236

Query: 233 IANLEAYLLIRSMRTMEMRVVRQSTSATKVVAYLESH----KAEFGGV-------LVKVF 281
            +  +++L  R ++T+ +RV + S +ATK+  +L ++       + G+       +VK  
Sbjct: 237 PSPFDSWLTHRGLKTLHLRVRQASLTATKIAEFLSTNPNVKAVNYPGLPTHENYDIVKKQ 296

Query: 282 HSSLQTEPYVQQYLRGGNAPVFSILLRTVEQCKRLPSLLKLFHHATSLGGVESLIEWRAM 341
           H        +   + GG+           E   +  S  +LF  A SLGG+ESL+E  A+
Sbjct: 297 HREALGGGMISFRINGGS-----------EAAAKFSSSTRLFTLAESLGGIESLLEVPAV 345

Query: 342 -----------SDTTVEQNLLRISVGCESPEDLIADLAGAFR 372
                        + V  +L+R+SVG E   DL+ D+  A  
Sbjct: 346 MTHGGIPKESREASGVYDDLIRLSVGIEDAGDLLDDIKQALE 387

>Ecym_2629 Chr2 complement(1216179..1217357) [1179 bp, 392 aa] {ON}
           similar to Ashbya gossypii AEL341W
          Length = 392

 Score =  114 bits (286), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 108/397 (27%), Positives = 178/397 (44%), Gaps = 44/397 (11%)

Query: 3   ELCTSLIHADDNSNRVNDVAPPINVTTTFRYSEDDLIPAVERTADTAGSNGHFYSRVSHP 62
           ++ T ++HA ++ +    V  PI+++TTF+ +     PAV   A       + YSR  +P
Sbjct: 8   QISTKVVHAGEHVDIHGSVIEPISLSTTFKQAS----PAVPVGA-------YEYSRSQNP 56

Query: 63  NGARCEVLLAEALGGE-AVVYSSGLAAFGAALTHF--NPKRLFIGRGYHGCHGVADIWVR 119
           N    E  +A     +  + +SSG A     L         + IG  Y G H   +    
Sbjct: 57  NRKNLEDAIAVLENAKHGLAFSSGSATTAVILQSLPQGSHAISIGDVYGGTHRYFNNVAN 116

Query: 120 NHGLQKLSLEEVSER-----SEPGDLVHIESPINPYGTLVDVXXXXXXXXXXXXYVVL-- 172
            HG++      + E       E   LV IESP NP   + D+             ++L  
Sbjct: 117 AHGVETTFTNNLVEDLPTLIRENTKLVWIESPTNPTLKVTDIQLVSQIIKSSNKDIILVV 176

Query: 173 DATFAPPPLQDRWEQGADVVVHSCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTN 232
           D TF  P L +    GAD+V+HS TKY  GHSD++ GV A     +  +L+  +  +G  
Sbjct: 177 DNTFLSPYLSNPLNFGADIVIHSATKYINGHSDVVLGVLATNSQVLYDKLQYLQNAIGAV 236

Query: 233 IANLEAYLLIRSMRTMEMRVVRQSTSATKVVAYL-ESHKAEFGGVLVKVFHSSLQTEP-- 289
            +  +A+L  R ++T+ +RV   S SA ++  +L +S K      ++ V +  L + P  
Sbjct: 237 PSPFDAWLTHRGLKTLHLRVRTASNSAQEIAEFLVKSDK------VISVNYPGLSSHPNN 290

Query: 290 --YVQQYLRGGNAPVFSILLR-TVEQCKRLPSLLKLFHHATSLGGVESLIEWRAM----- 341
               +Q+  G    + S  ++   +   +  +  +LF  A SLGG+ESL+E  A+     
Sbjct: 291 DIVKKQHRDGLGGGMISFRIKGGADGAAKFSASTRLFTLAESLGGIESLLEVPAVMTHGG 350

Query: 342 ------SDTTVEQNLLRISVGCESPEDLIADLAGAFR 372
                   + V  +L+R+SVG E   DL+ D+  A  
Sbjct: 351 IPKDQREASGVYDDLIRLSVGIEDTGDLLKDIEQALN 387

>AEL341W Chr5 (9428..10609) [1182 bp, 393 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YAL012W (CYS3)
          Length = 393

 Score =  108 bits (269), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 110/396 (27%), Positives = 176/396 (44%), Gaps = 44/396 (11%)

Query: 3   ELCTSLIHADDNSNRVNDVAPPINVTTTFRYSEDDLIPAVERTADTAGSNGHFYSRVSHP 62
           +  T  IHA  +++    V  PI+++TTF+ S            +  G+  + YSR  +P
Sbjct: 8   KFATKAIHAGAHTDLHGSVIEPISLSTTFKQSS---------PGNPVGA--YEYSRGQNP 56

Query: 63  NGARCEVLLAEALGGE-AVVYSSGLAAFGAALTHFNPK---RLFIGRGYHGCHGVADIWV 118
           N    E  +A     +  + +SSG +A  A +    P+    + IG  Y G H       
Sbjct: 57  NRQNLEEAIAALESAKYGLAFSSG-SATTAVIVQSLPQGSHAISIGDVYGGTHRYFTKVA 115

Query: 119 RNHGLQKLSLEEVSER-----SEPGDLVHIESPINPYGTLVDVXXXXXXXXXXXXYVVL- 172
             HG++      + E       +   LV IESP NP   + D+             ++L 
Sbjct: 116 NAHGVETSFTNSLLEDLPKLVRDNTRLVWIESPTNPTLQVTDIQQVADTVKALNEDIILV 175

Query: 173 -DATFAPPPLQDRWEQGADVVVHSCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGT 231
            D TF  P L +    GAD+V+HS TKY  GHSD++ G  A    ++  +L   +  +G 
Sbjct: 176 VDNTFLSPYLSNPLNFGADIVIHSATKYINGHSDVVLGALATNSTSLYERLAFLQNAIGA 235

Query: 232 NIANLEAYLLIRSMRTMEMRVVRQSTSATKVVAYLESHKAEFGGVLVKVFHSSLQTEPYV 291
             +  +A+L  R ++T+ +RV + + SA K+  YLE  +      +V V +  L +    
Sbjct: 236 IPSPFDAWLTHRGLKTLHLRVRQAAQSAQKIAEYLEQSEH-----VVSVNYPGLPSHRGY 290

Query: 292 Q----QYLRGGNAPVFSILLRTVEQCKRLPSL-LKLFHHATSLGGVESLIE--------- 337
           Q    Q+  G    + S  ++   Q   L S   +LF  A SLGG+ESL+E         
Sbjct: 291 QIAQKQHRDGLGGGMISFRVKGGAQGAALLSQSTRLFTLAESLGGIESLLEVPAVMTHAG 350

Query: 338 --WRAMSDTTVEQNLLRISVGCESPEDLIADLAGAF 371
               A   + V  +L+R+SVG E  +DL+ D+  A 
Sbjct: 351 IPKEAREASGVYDDLVRVSVGIEDTDDLLEDIKQAL 386

>ZYRO0G19162g Chr7 (1590120..1591487) [1368 bp, 455 aa] {ON} similar
           to uniprot|P53101 Saccharomyces cerevisiae YGL184C STR3
           Cystathionine beta-lyase converts cystathionine into
           homocysteine
          Length = 455

 Score = 91.7 bits (226), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 76/258 (29%), Positives = 117/258 (45%), Gaps = 30/258 (11%)

Query: 139 DLVHIESPINPYGTLVDV--XXXXXXXXXXXXYVVLDATFAPPPLQDRWEQGADVVVHSC 196
           D VHIESP NP   +VDV              YV++D T     L +    GAD V  S 
Sbjct: 144 DCVHIESPTNPMCKVVDVPRIISFVKSVSPQTYVIVDNTMMSGLLCNPLSLGADAVYESA 203

Query: 197 TKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYL-----GTNIANLEAYLLIRSMRTMEMR 251
           TK+  GH D++ GV   R+  +A     D +Y      G  +A ++++LLIR ++T+ +R
Sbjct: 204 TKFLNGHHDIMAGVVVSRNQKIA-----DAIYFVVNATGCGLAPMDSWLLIRGLKTLSVR 258

Query: 252 VVRQSTSATKVVAYLES---HKAEFGGVLVKVFHSSLQTEPY--VQQYLRGGNAPVFSIL 306
           + +Q  +A  +  +LE     K      L++  +  LQ+ P   + +    G   V S  
Sbjct: 259 LYQQQFNAMVLAEWLEQSCGFKQSKDNSLLRTRYVGLQSHPQFSLHRSFNDGPGAVLSFE 318

Query: 307 LRTVEQCKRLPS--LLKLFHHATSLGGVESLIEWR-AMSDTTVEQN----------LLRI 353
             +    +R+ S   LK++    S G V SLI    +MS  +++ N          L+R+
Sbjct: 319 TGSTPLSRRIVSSKALKIWSVTVSFGCVNSLISLPCSMSHASIDPNVRKEREFPEDLIRL 378

Query: 354 SVGCESPEDLIADLAGAF 371
            VG E   DL  DL  A 
Sbjct: 379 CVGIEDIVDLQKDLLAAM 396

>CAGL0L06094g Chr12 (693250..694602) [1353 bp, 450 aa] {ON} similar
           to uniprot|P53101 Saccharomyces cerevisiae YGL184c
          Length = 450

 Score = 82.8 bits (203), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 66/253 (26%), Positives = 119/253 (47%), Gaps = 20/253 (7%)

Query: 139 DLVHIESPINPYGTLVDV--XXXXXXXXXXXXYVVLDATFAPPPLQDRWEQGADVVVHSC 196
           D++ +ESP NP   ++D+               +V+D T       +  + GADVV  S 
Sbjct: 135 DIIVLESPTNPLCKIIDIPHLIKFIRKYSPETLIVIDNTMMSGLNCNPLKFGADVVYESA 194

Query: 197 TKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTNIANLEAYLLIRSMRTMEMRVVRQS 256
           TKY  GH D++ GV   ++  +A ++       G+ +  ++++LLIR ++T+ +R+ +Q 
Sbjct: 195 TKYLNGHHDIMAGVIIAKNKLLAEKIYFLINSTGSGLNPMDSWLLIRGLKTLSIRLHKQQ 254

Query: 257 TSATKVVAYLES---HKAEFGGVLVKVFHSSLQTEP--YVQQYLRGGNAPVFSILLRTVE 311
            +A  +  +LE     K       +K  +  L++ P   + +    G   V S+   ++ 
Sbjct: 255 LNALAISHWLEEGCGFKTHNNNNNLKTRYIGLKSHPDYELHRSFNKGPGAVISLQTGSIP 314

Query: 312 QCKRL--PSLLKLFHHATSLGGVESLIEWRA-MSDTTVE----------QNLLRISVGCE 358
             K++    LLKL++   S G V SLI     MS  +++          ++L+R+  G E
Sbjct: 315 ISKKIVASKLLKLWNVTVSFGCVNSLISMPCLMSHASIDPELRKERQFPEDLIRLCCGIE 374

Query: 359 SPEDLIADLAGAF 371
             + L  DL GAF
Sbjct: 375 DVKALQEDLLGAF 387

>Skud_19.6 Chr19 complement(5562..6767) [1206 bp, 401 aa] {ON}
           YFR055W (REAL)
          Length = 401

 Score = 82.4 bits (202), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 92/346 (26%), Positives = 139/346 (40%), Gaps = 37/346 (10%)

Query: 55  FYSRVSHPNGARCEVLLAEALGGEAVVYS-SGLAAFGAAL--------------THFNPK 99
           FY     P  A  E       GG   V S SGL +   AL              + + P 
Sbjct: 56  FYGTAGSPTIANLEDAWTHLTGGAGTVLSPSGLGSISLALLTLAKAGDHILITDSVYVPT 115

Query: 100 RLFIGRGYHGCHGV-ADIWVRNHGLQKLSLEEVSERSEPGD-LVHIESPINPYGTLVDVX 157
           R+        C G+ A   +          E++ +  +P   ++ +ESP +    + D+ 
Sbjct: 116 RML-------CDGLLAKFGIETEYYDPSVGEDIKKLIKPNTTVIFLESPGSGTMEIQDIP 168

Query: 158 XXXXXXXXXXXYVVLDATFAPPPLQDRWEQGADVVVHSCTKYFGGHSDLLGGVHAVRDAA 217
                        +LD T+A P   D    G D+ + + TKY GGHSDLL G+ +  +  
Sbjct: 169 ALVSVAKKHGIKTILDNTWATPLFFDAHGHGIDISLEAGTKYLGGHSDLLIGLTSANEEC 228

Query: 218 VARQLRQDRVYLGTNIANLEAYLLIRSMRTMEMRVVRQSTSATKVVAYLESHKAEFGGVL 277
               LR     +       +  L +R MRT+ +R+      A  + A+LE  + E   VL
Sbjct: 229 WP-LLRSTYDAMAMLPGADDCLLALRGMRTLHLRLKEAERKALDLAAWLED-RDEVEKVL 286

Query: 278 VKVFHSSLQTEPYVQQYLRGGNAPVFSILLR---TVEQCKRLPSLLKLFHHATSLGGVES 334
              F      E +V+ Y   G++ +FSI+L+   T    + +   +K+FH   S GG ES
Sbjct: 287 HPAFKDCPGHEYWVRDY--KGSSGLFSIVLKDGYTRTGLENMVEKMKVFHLGFSWGGYES 344

Query: 335 LI------EWRAMSDTTVEQNLLRISVGCESPEDLIADLAGAFRQL 374
           LI        R  ++       LRI VG E   DL  DL   F +L
Sbjct: 345 LITPVNPARQRKAANWPHRGFALRIQVGLEELTDLKRDLELGFERL 390

>TDEL0B04660 Chr2 complement(828468..829862) [1395 bp, 464 aa] {ON}
           Anc_8.145 YGL184C
          Length = 464

 Score = 80.9 bits (198), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 68/253 (26%), Positives = 115/253 (45%), Gaps = 20/253 (7%)

Query: 139 DLVHIESPINPYGTLVDV--XXXXXXXXXXXXYVVLDATFAPPPLQDRWEQGADVVVHSC 196
           D V +ESP NP   +VDV               V++D T       +  E G DVV  S 
Sbjct: 151 DCVLLESPTNPLCKVVDVPQLVAYVKRISPSTVVIVDNTMMSGLQCNPLEYGCDVVYESA 210

Query: 197 TKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTNIANLEAYLLIRSMRTMEMRVVRQS 256
           TKY  GH D++GG+   + A +A+++       G+ ++ ++++LL R ++T+ +R+ +Q 
Sbjct: 211 TKYLNGHHDIMGGIIVGKTAEIAQEIYYVVNATGSGLSPMDSWLLNRGLKTLGVRMYQQQ 270

Query: 257 TSATKVVAYLES---HKAEFGGVLVKVFHSSLQTEP--YVQQYLRGGNAPVFSILLRTVE 311
            ++  +  +LE     K       +K  +  L+T P   + +    G   V S    ++E
Sbjct: 271 YNSMVIAQWLEESCGFKPTEKNSALKTRYVGLKTNPGFELHRSFNKGPGAVLSFETGSLE 330

Query: 312 QCKRL--PSLLKLFHHATSLGGVESLIEWRA-MSDTTVE----------QNLLRISVGCE 358
             +R+      +LF    S G V SLI     MS  +++          ++L+R+ VG E
Sbjct: 331 HSQRIVASKAFQLFSVTVSFGCVNSLISLPCKMSHASIDPEVRKQREFPEDLIRLCVGIE 390

Query: 359 SPEDLIADLAGAF 371
              DL  DL  A 
Sbjct: 391 DVGDLQKDLLYAM 403

>Smik_7.89 Chr7 complement(149314..150711) [1398 bp, 465 aa] {ON}
           YGL184C (REAL)
          Length = 465

 Score = 79.7 bits (195), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 75/257 (29%), Positives = 114/257 (44%), Gaps = 26/257 (10%)

Query: 139 DLVHIESPINPYGTLVDV--XXXXXXXXXXXXYVVLDATFAP----PPLQDRWEQGADVV 192
           D V +ESP NP   +VD+               VV+D T        PLQ   + G DVV
Sbjct: 150 DCVLLESPTNPLCKVVDIPRILRFVKCISPETTVVVDNTMMSGLNCNPLQ--LDPGCDVV 207

Query: 193 VHSCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTNIANLEAYLLIRSMRTMEMRV 252
             S TKY  GH DL+GGV   + A +A +L       G  ++ ++++LL+R ++T+ +R+
Sbjct: 208 YESATKYLNGHHDLMGGVIISKTAEIAAKLYFVVNSTGAGLSPMDSWLLVRGLKTLGVRL 267

Query: 253 VRQSTSATKVVAYLES---HKAEFGGVLVKVFHSSLQTEP--YVQQYLRGGNAPVFSILL 307
            +Q  +A  +  +LE     K        K     L++ P   + Q    G   V S   
Sbjct: 268 YQQQRNAMILAHWLEDSCGFKPTETNKTTKTRFVGLRSNPDFKLHQSFNSGPGAVLSFET 327

Query: 308 RTVEQCKRLPSLLKL--FHHATSLGGVESLIEWRA-MSDTTVE----------QNLLRIS 354
            + E  KRL S  KL  +    S G V SL+     MS  +++          ++L+R+ 
Sbjct: 328 GSFEHSKRLVSSKKLSIWAVTVSFGCVNSLLSMPCKMSHASIDPELRKERDFPEDLIRLC 387

Query: 355 VGCESPEDLIADLAGAF 371
            G E+  DL  DL  A 
Sbjct: 388 CGIENIVDLKKDLLAAM 404

>YGL184C Chr7 complement(154615..156012) [1398 bp, 465 aa] {ON}
           STR3Peroxisomal cystathionine beta-lyase, converts
           cystathionine into homocysteine; may be redox regulated
           by Gto1p
          Length = 465

 Score = 77.0 bits (188), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 74/257 (28%), Positives = 114/257 (44%), Gaps = 26/257 (10%)

Query: 139 DLVHIESPINPYGTLVDV--XXXXXXXXXXXXYVVLDATFAP----PPLQDRWEQGADVV 192
           D V +ESP NP   +VD+               VV+D T        PLQ     G DVV
Sbjct: 150 DCVLLESPTNPLCKVVDIPRILRFVKCISPDTTVVVDNTMMSGLNCNPLQ--LNPGCDVV 207

Query: 193 VHSCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTNIANLEAYLLIRSMRTMEMRV 252
             S TKY  GH DL+GGV   +   +A +L       G  ++ ++++LL+R ++T+ +R+
Sbjct: 208 YESATKYLNGHHDLMGGVIISKTPEIASKLYFVINSTGAGLSPMDSWLLVRGLKTLGVRL 267

Query: 253 VRQSTSATKVVAYLES---HKAEFGGVLVKVFHSSLQTEPYVQQYLRGGNAP--VFSILL 307
            +Q  +A  +  +LE+    K        K     L++ P  + +    N P  V S   
Sbjct: 268 YQQQRNAMILAHWLENSCGFKPTRTNKATKTRFVGLRSNPDFKLHKSFNNGPGAVLSFET 327

Query: 308 RTVEQCKRLPSLLKL--FHHATSLGGVESLIEWRA-MSDTTVE----------QNLLRIS 354
            + E  KRL S  KL  +    S G V SL+     MS  +++          ++L+R+ 
Sbjct: 328 GSFEHSKRLVSSKKLSIWAVTVSFGCVNSLLSMPCKMSHASIDPELRKERDFPEDLVRLC 387

Query: 355 VGCESPEDLIADLAGAF 371
            G E+  DL  DL  A 
Sbjct: 388 CGIENIVDLKKDLLAAM 404

>SAKL0H24882g Chr8 (2167623..2169002) [1380 bp, 459 aa] {ON} highly
           similar to uniprot|P53101 Saccharomyces cerevisiae
           YGL184C STR3 Cystathionine beta-lyase converts
           cystathionine into homocysteine
          Length = 459

 Score = 77.0 bits (188), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 69/253 (27%), Positives = 113/253 (44%), Gaps = 20/253 (7%)

Query: 139 DLVHIESPINPYGTLVDV--XXXXXXXXXXXXYVVLDATFAPPPLQDRWEQGADVVVHSC 196
           D V +ESP NP   + D+              +VV+D T       +  E   DVV  S 
Sbjct: 149 DCVVLESPTNPLCKVADLPGLTKFIKQANPKCHVVVDNTMVSGLNCNPLEFQCDVVYESG 208

Query: 197 TKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTNIANLEAYLLIRSMRTMEMRVVRQS 256
           TKY  GH D++ GV   R   +A++L       G  ++ ++ +LLIR ++T+ +R+ +Q 
Sbjct: 209 TKYLNGHHDIMAGVIIGRSKEIAQELYFVINSTGCGLSPMDCWLLIRGLKTLSIRLYQQQ 268

Query: 257 TSATKVVAYLES---HKAEFGGVLVKVFHSSLQTEPYVQQY--LRGGNAPVFSILLRTVE 311
            +A  +  +L S    +      L++  +  L++ P  + +     G   V S    + E
Sbjct: 269 HNAMILARWLYSSCGFRPNSENKLLRTRYVGLKSHPQFELHRSFNKGPGAVLSFDTGSFE 328

Query: 312 QCKRLPS--LLKLFHHATSLGGVESLIEWRA-MSDTTVE----------QNLLRISVGCE 358
             KRL S   LK++    S G V SLI     MS  +++          ++L+R+  G E
Sbjct: 329 HSKRLVSSKKLKIWAVTVSFGCVNSLISMPCKMSHASIDPELRKERDFPEDLVRLCCGIE 388

Query: 359 SPEDLIADLAGAF 371
             +DL  DL  A 
Sbjct: 389 DVKDLQKDLLAAM 401

>Suva_7.79 Chr7 complement(150082..151479) [1398 bp, 465 aa] {ON}
           YGL184C (REAL)
          Length = 465

 Score = 76.3 bits (186), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 73/257 (28%), Positives = 112/257 (43%), Gaps = 26/257 (10%)

Query: 139 DLVHIESPINPYGTLVDVXXXXXXXXXXX--XYVVLDATFAP----PPLQDRWEQGADVV 192
           D V +ESP NP   +VD+               V++D T        PLQ       DVV
Sbjct: 150 DCVLLESPTNPLCKVVDIPKILRYVKCVSPDTKVIVDNTMMSGLNCNPLQ--LNPSCDVV 207

Query: 193 VHSCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTNIANLEAYLLIRSMRTMEMRV 252
             S TKY  GH DL+GGV   + A +A +L       G  ++ ++++LL+R ++T+ +R+
Sbjct: 208 YESATKYLNGHHDLMGGVIISKTAEIASKLYFVVNSTGAGLSPMDSWLLVRGLKTLGVRL 267

Query: 253 VRQSTSATKVVAYLES---HKAEFGGVLVKVFHSSLQTEP--YVQQYLRGGNAPVFSILL 307
            +Q  +A  +  +LE     K        K     L++ P   + Q    G   V S   
Sbjct: 268 HQQQRNAMILAHWLEDSCGFKPTATNKATKTRFVGLRSNPDFKLHQSFNNGPGAVLSFET 327

Query: 308 RTVEQCKRLPSLLKL--FHHATSLGGVESLIEWRA-MSDTTVE----------QNLLRIS 354
            + E  KRL S  KL  +    S G V SL+     MS  +++          ++L+R+ 
Sbjct: 328 GSFEHSKRLVSSKKLNIWAVTVSFGCVNSLLSMPCKMSHASIDPEVRKERDFPEDLVRLC 387

Query: 355 VGCESPEDLIADLAGAF 371
            G E+  DL  DL  A 
Sbjct: 388 CGIENIVDLKKDLLAAM 404

>Suva_17.6 Chr17 (9922..11127) [1206 bp, 401 aa] {ON} YFR055W (REAL)
          Length = 401

 Score = 75.5 bits (184), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 70/258 (27%), Positives = 111/258 (43%), Gaps = 18/258 (6%)

Query: 129 EEVSERSEPG-DLVHIESPINPYGTLVDVXXXXXXXXXXXXYVVLDATFAPPPLQDRWEQ 187
           E++ +  +P   ++ +ESP +    + D+              +LD T+A P   D    
Sbjct: 139 EDIEKLVKPNTSVIFLESPGSGTMEIQDIPALVSIAKKHGIRTILDNTWATPLFFDAHGH 198

Query: 188 GADVVVHSCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTNIANLEAYLLIRSMRT 247
           G D+ + + TKY GGHSD L G+ +         LR     +       +  L +R MRT
Sbjct: 199 GIDISLEAGTKYLGGHSDFLLGLTSANQECWPL-LRSTYDAMAMLPGADDCQLALRGMRT 257

Query: 248 MEMRVVRQSTSATKVVAYLESHKAEFGGVLVKVFHSSLQTEPYVQQYLRG--GNAPVFSI 305
           + +R+      A  + A+L          +  V H + +  P  + +LR   G++ +FSI
Sbjct: 258 LHLRLKEAERKALDLAAWLGKRDE-----VETVLHPAFEDCPGHKYWLRDYKGSSGLFSI 312

Query: 306 LLR---TVEQCKRLPSLLKLFHHATSLGGVESLI------EWRAMSDTTVEQNLLRISVG 356
           +L+   T    + +   +K+FH   S GG ESLI      E R   +       LRI VG
Sbjct: 313 VLKEGFTRAGLESMVEKMKIFHLGFSWGGYESLITPVKPAEQRKPHNWPHRGFALRIQVG 372

Query: 357 CESPEDLIADLAGAFRQL 374
            E   DL  DL   F +L
Sbjct: 373 LEELSDLKRDLELGFERL 390

>TDEL0D06630 Chr4 complement(1200459..1201667) [1209 bp, 402 aa]
           {ON}  YFR055W
          Length = 402

 Score = 73.9 bits (180), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 65/248 (26%), Positives = 113/248 (45%), Gaps = 21/248 (8%)

Query: 140 LVHIESPINPYGTLVDVXXXXXXXXXXXXYVVLDATFAPPPLQDRWEQGADVVVHSCTKY 199
           L+ +ESP +    + DV              VLD T+A P      + G D+ V + TKY
Sbjct: 151 LIFLESPCSQTMEIQDVPAIVKVAKKHNVKTVLDNTWATPLFFKAHDYGIDISVEAGTKY 210

Query: 200 FGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTNIANLEAYLLIRSMRTMEMRVVRQSTSA 259
            GGHSDLL G+ +  ++     LR     +G      + +L +R +RT+++RV      A
Sbjct: 211 VGGHSDLLLGLTSA-NSRCWPALRSTYDAMGMLPGADDCHLALRGLRTLQLRVKEAERKA 269

Query: 260 TKVVAYLESHKAEFGGVLVKVFHSSLQTEPYVQQYLR--GGNAPVFSILLR---TVEQCK 314
             +  +LE+        + ++ H + +  P    ++R   G+  VF+ +L+   +    K
Sbjct: 270 LILAEWLEARNE-----VERILHPAFEDCPGHSLWVRDYSGSTGVFTFILKDQFSRAGLK 324

Query: 315 RLPSLLKLFHHATSLGGVESLIEWRAMSDTTVEQ--------NLLRISVGCESPEDLIAD 366
            +   +++F    S GG ESL+    ++ T+ ++          LRI VG E  +D + D
Sbjct: 325 DMLEKMQIFKLGYSWGGYESLL--IPVNSTSRDRIRTWSHFGYALRIQVGLEDIDDQLRD 382

Query: 367 LAGAFRQL 374
           L   F +L
Sbjct: 383 LEMGFERL 390

>KLTH0E06644g Chr5 complement(608116..609498) [1383 bp, 460 aa] {ON}
           highly similar to uniprot|P53101 Saccharomyces
           cerevisiae YGL184C STR3 Cystathionine beta-lyase
           converts cystathionine into homocysteine
          Length = 460

 Score = 74.3 bits (181), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 101/407 (24%), Positives = 167/407 (41%), Gaps = 51/407 (12%)

Query: 3   ELCTSLIHADDNSNRVNDVAPPINVTTTFRYS--EDDLIPAVERTADTAGSNGHFYSRVS 60
           +L + + H D + + V    PPI  +TTF+    EDD      +  D   S     + V 
Sbjct: 9   KLVSVVQHVDQHGSSV----PPIYQSTTFKIGSLEDD----ASQPYDYTRSGNPTRTVVQ 60

Query: 61  HPNGARCEVLLAEALGGEAVVYSSGLAAFGA---ALTHFNPKR---LFIGRGYHGCHG-- 112
           H  G   +V  A+ L       SSG+ A      AL   N  R   +  G   +G     
Sbjct: 61  HQIGKLYDVDAAQVLA-----VSSGMTALDVILRALVLTNKSRVPTIIAGDDLYGGTQRL 115

Query: 113 VADIWVRNHG-------LQKLSLEEVSERSEPGDLVHIESPINPYGTLVDV--XXXXXXX 163
           +  +  RNH            +  EV ++ E  D V +ESP NP   + D+         
Sbjct: 116 LTHLESRNHARVLHVDTANYETFVEVFKQQEHVDCVLLESPTNPLLKVADLPRLTHFIKS 175

Query: 164 XXXXXYVVLDATFAPPPLQDRWEQGADVVVHSCTKYFGGHSDLLGGVHAVRDAAVARQLR 223
                 V +D T     L +  +   DVV  S TKY  GH D++ G+   +   +A+++ 
Sbjct: 176 ANEACLVAIDNTMMSGMLCNPLKFQCDVVYESATKYLNGHHDIMAGIVVTQTLKMAQEIY 235

Query: 224 QDRVYLGTNIANLEAYLLIRSMRTMEMRVVRQSTSATKVVAYLESHKAEFGGVLVK---- 279
                 G+ ++  +++LL+R ++T+ +R+ +Q  +A  +  +LE+     G   VK    
Sbjct: 236 FVINSTGSGLSPFDSWLLVRGLKTLGVRLYQQQHNAMVLAHWLENSCGFVGKKGVKGSPR 295

Query: 280 VFHSSLQTEPYVQ--QYLRGGNAPVFSILLRTVEQCKRLPS--LLKLFHHATSLGGVESL 335
                L++ P  +  +    G   V S    + E  +RL S   +K++    S G V SL
Sbjct: 296 TRFVGLKSHPQFELHKSFNAGPGAVLSFETGSYEHSRRLVSSRKIKIWAVTVSFGCVNSL 355

Query: 336 IEWRA-MSDTTVE----------QNLLRISVGCESPEDLIADLAGAF 371
           I     MS   ++          ++L+R+  G E+  DL  DL  A 
Sbjct: 356 ISMPCKMSHAAIDPALRQERDFPEDLVRLCCGIENISDLQNDLLEAM 402

>Skud_7.88 Chr7 complement(160235..161632) [1398 bp, 465 aa] {ON}
           YGL184C (REAL)
          Length = 465

 Score = 73.6 bits (179), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 72/257 (28%), Positives = 112/257 (43%), Gaps = 26/257 (10%)

Query: 139 DLVHIESPINPYGTLVDVXXXX--XXXXXXXXYVVLDATFAP----PPLQDRWEQGADVV 192
           D V +ESP NP   +VD+               V++D T        PLQ       DVV
Sbjct: 150 DCVLLESPTNPLCKVVDIPKILRFVKRISPETIVIVDNTMMSGLNCNPLQ--LNPSCDVV 207

Query: 193 VHSCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTNIANLEAYLLIRSMRTMEMRV 252
             S TKY  GH DL+GGV   +   +A +L       G  ++ ++++LL+R ++T+ +R+
Sbjct: 208 YESATKYLNGHHDLMGGVIISKTPEIASKLYFVVNSTGAGLSPMDSWLLVRGLKTLGVRL 267

Query: 253 VRQSTSATKVVAYLES---HKAEFGGVLVKVFHSSLQTEP--YVQQYLRGGNAPVFSILL 307
            +Q  +A  +  +LE+    K        K     L++ P   + Q    G   V S   
Sbjct: 268 HQQQRNAMILAHWLENSCGFKPTETNKATKTRFVGLRSNPDFKLHQSFNSGPGAVLSFET 327

Query: 308 RTVEQCKRLPSLLKL--FHHATSLGGVESLIEWRA-MSDTTVE----------QNLLRIS 354
            + E  KRL S  KL  +    S G V SL+     MS  +++          ++L+R+ 
Sbjct: 328 GSSEHSKRLVSSKKLNIWAVTVSFGCVNSLLSMPCKMSHASIDPELRKERDFPEDLVRLC 387

Query: 355 VGCESPEDLIADLAGAF 371
            G E+  DL  DL  A 
Sbjct: 388 CGIENIVDLKKDLLAAM 404

>Smik_7.375 Chr7 (620194..621399) [1206 bp, 401 aa] {ON} YFR055W
           (REAL)
          Length = 401

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 69/256 (26%), Positives = 113/256 (44%), Gaps = 14/256 (5%)

Query: 129 EEVSERSEPGD-LVHIESPINPYGTLVDVXXXXXXXXXXXXYVVLDATFAPPPLQDRWEQ 187
           E++ +  +P   ++ +ESP +    + ++              +LD T+A P   D    
Sbjct: 139 EDIEKLVKPNTTVIFLESPGSGTMEIQNIPALVSVAKKHGIKTILDNTWATPLFFDAHGH 198

Query: 188 GADVVVHSCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTNIANLEAYLLIRSMRT 247
           G D+ + + TKY GGHSDLL G+ +  +      LR     +       +  L +R MRT
Sbjct: 199 GIDISLEAGTKYLGGHSDLLLGLVSANEECWPL-LRSTYDAMAMLPGADDCLLALRGMRT 257

Query: 248 MEMRVVRQSTSATKVVAYLESHKAEFGGVLVKVFHSSLQTEPYVQQYLRGGNAPVFSILL 307
           + +R+      A  + A+ +  + E   VL   F      E +V+ Y   G++ +FSI+L
Sbjct: 258 LHLRLKEAERKALDLAAWFKK-RDEVEKVLHPAFEDCPGHEYWVRDY--KGSSGLFSIVL 314

Query: 308 R---TVEQCKRLPSLLKLFHHATSLGGVESLI------EWRAMSDTTVEQNLLRISVGCE 358
           +   T    + +   +K+F    S GG +SLI        R  +  +     LRI VG E
Sbjct: 315 KDGFTRSGLENMVDNMKVFELGYSWGGYDSLITPVNPPTQRKAAPWSHNGFALRIQVGLE 374

Query: 359 SPEDLIADLAGAFRQL 374
             EDL  DL   F +L
Sbjct: 375 ELEDLKRDLELGFERL 390

>Kwal_47.17221 s47 complement(306099..307490) [1392 bp, 463 aa] {ON}
           YGL184C (STR3) - Cystathionine beta-lyase [contig 211]
           FULL
          Length = 463

 Score = 71.6 bits (174), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 70/256 (27%), Positives = 111/256 (43%), Gaps = 24/256 (9%)

Query: 139 DLVHIESPINPYGTLVDV--XXXXXXXXXXXXYVVLDATFAPPPLQDRWEQGADVVVHSC 196
           D V +ESP NP   + D+               V +D T     L +      DVV  S 
Sbjct: 151 DCVLLESPTNPLLKVADLPRITRFVKQSNEKCVVAIDNTMMSGMLCNPLHFHCDVVYESA 210

Query: 197 TKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTNIANLEAYLLIRSMRTMEMRVVRQS 256
           TKY  GH D++ G+   R A +A ++       G  ++  +++LLIR ++T+ +R+ +Q 
Sbjct: 211 TKYLNGHHDIMAGIVVARSAQLAGEIYFMINSTGCGLSPFDSWLLIRGLKTLGVRIYQQQ 270

Query: 257 TSATKVVAYLE------SHKAEFGGVLVKVFHSSLQTEPYVQ--QYLRGGNAPVFSILLR 308
            +A  +  +LE      SH  +  G L   F   L++ P  +  +    G   V S    
Sbjct: 271 HNAMVLAHWLENSCGFVSHGKKGKGSLQTRF-VGLKSHPEFELHKSFNTGPGAVLSFETG 329

Query: 309 TVEQCKRLPS--LLKLFHHATSLGGVESLIEWRA-MSDTTVE----------QNLLRISV 355
           + E  +RL S   +KL+    S G V SLI     MS   ++          ++L+R+  
Sbjct: 330 SFEHSRRLVSSKKIKLWAVTVSFGCVNSLISMPCKMSHAAIDPALRQERDFPEDLVRLCC 389

Query: 356 GCESPEDLIADLAGAF 371
           G E+  DL  DL  A 
Sbjct: 390 GIENIVDLQNDLLEAM 405

>Ecym_8405 Chr8 (839466..840884) [1419 bp, 472 aa] {ON} similar to
           Ashbya gossypii ACL059C
          Length = 472

 Score = 71.2 bits (173), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 69/261 (26%), Positives = 116/261 (44%), Gaps = 32/261 (12%)

Query: 141 VHIESPINPYGTLVD----VXXXXXXXXXXXXYVVLDATFAPPPLQDRWEQGADVVVHSC 196
           V +ESP NP   + D    +             +V+D T       +  E GAD+V  S 
Sbjct: 161 VLLESPTNPLMKVADLPKLISFVKSHRGGSGCKIVVDNTMVSGINCNPLELGADLVYESA 220

Query: 197 TKYFGGHSDLLGGVHAVRDAAVARQLRQDRVY----LGTNIANLEAYLLIRSMRTMEMRV 252
           TK+  GH D++ GV      A + +L QD  +    +G  +A ++++LLIR ++T+ +R+
Sbjct: 221 TKFLNGHHDIMAGVI----VAASVELAQDMYFIVNSMGAGLAPMDSWLLIRGLKTLGVRM 276

Query: 253 VRQSTSATKVVAYLESH----KAEFGGVLVKVFHSSLQTEP--YVQQYLRGGNAPVFSIL 306
            +Q  +A  +  +L+        E    L   F   L++ P  ++ +    G   V SI 
Sbjct: 277 YQQQHNAMVLAHWLQDSCGFAPTEQNSQLRTRF-VGLKSHPQFHLHRSFNSGPGAVLSIE 335

Query: 307 LRTVEQCKRL--PSLLKLFHHATSLGGVESLIEWRA-MSDTTVE----------QNLLRI 353
              +E  +++      K ++   S G V SLI     MS  +++          ++L+RI
Sbjct: 336 TGDIELSEKIVCSKKFKYWNVTVSFGCVNSLISMPCKMSHASIDPELRKDRKFPEDLIRI 395

Query: 354 SVGCESPEDLIADLAGAFRQL 374
             G E   DL  DL GAF  +
Sbjct: 396 CCGIEDVSDLQWDLLGAFEDV 416

>ACL059C Chr3 complement(259732..261093) [1362 bp, 453 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL184C
           (STR3)
          Length = 453

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 67/249 (26%), Positives = 107/249 (42%), Gaps = 20/249 (8%)

Query: 143 IESPINPYGTLVDVXXXXXXXXXXX--XYVVLDATFAPPPLQDRWEQGADVVVHSCTKYF 200
           +ESP NP   + DV               VV+D T       +    GAD V  S TKY 
Sbjct: 148 LESPTNPLMKVADVPALVAHVKAHAPGCRVVVDNTMMSGLNCNPLRLGADYVYESATKYL 207

Query: 201 GGHSDLLGGVHAVRDAAVARQLRQDRVYLGTNIANLEAYLLIRSMRTMEMRVVRQSTSAT 260
            GH D++ GV      A+A +       +G  +A ++A+LLIR ++T+ +R+ +Q  +A 
Sbjct: 208 NGHHDIMAGVIVAATRALAEEAYFVVNSVGAGLAPMDAWLLIRGLKTLSLRLYKQQHNAM 267

Query: 261 KVVAYLE---SHKAEFGGVLVKVFHSSLQTEPY--VQQYLRGGNAPVFSILLRTVEQCKR 315
            +  +L      +A  G   ++     L++ P   + +    G   V SI        +R
Sbjct: 268 VLAHWLREVCGFRAVGGNHALQTRFVGLRSHPQHKLHRSFNRGPGAVLSIQTGDTALSER 327

Query: 316 L--PSLLKLFHHATSLGGVESLIEWRA-MSDTTVE----------QNLLRISVGCESPED 362
           +     L+ +    S G V SLI     MS  +++          ++L+R+S G E  ED
Sbjct: 328 IVCSKKLQFWGVTVSFGCVNSLISMPCRMSHASIDPELRKARQFPEDLIRLSCGVEDVED 387

Query: 363 LIADLAGAF 371
           L  DL  A 
Sbjct: 388 LQQDLLAAL 396

>KLLA0C17028g Chr3 complement(1487806..1489188) [1383 bp, 460 aa]
           {ON} similar to uniprot|P53101 Saccharomyces cerevisiae
           YGL184C STR3 Cystathionine beta-lyase converts
           cystathionine into homocysteine
          Length = 460

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 69/267 (25%), Positives = 115/267 (43%), Gaps = 42/267 (15%)

Query: 139 DLVHIESPINPYGTLVDV-----XXXXXXXXXXXXYVVLDATFAPPPLQDRWEQGADVVV 193
           D+V +ESP NP   + D+                  +V+D T       +  + GADVV 
Sbjct: 145 DIVLLESPTNPLMKVADLPRLCQFVKQKGGSSSNCKIVVDNTMMSGLNSNPLQFGADVVY 204

Query: 194 HSCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYL-----GTNIANLEAYLLIRSMRTM 248
            S TKY  GH D++ GV       +A++     VY      G  ++ ++++LLIR ++T+
Sbjct: 205 ESGTKYLNGHHDIMAGV------IIAKKDVAPSVYFVINSTGAGLSPMDSWLLIRGLKTL 258

Query: 249 EMRVVRQSTSATKVVAYLES---HKAEFGGVLVKVFHSSLQTEPYVQQYLRGGNAP--VF 303
            +R+ +Q  +A  +  +L+     K       +K     L++ P  + +    N P  V 
Sbjct: 259 SVRLYKQQINAMVLSHWLQDICGFKPTDNNQQLKTRFVGLESHPQFELHKSFNNGPGAVL 318

Query: 304 SI------LLRTVEQCKRLPSLLKLFHHATSLGGVESLIEWRA-MSDTTVE--------- 347
           SI      L   +   KR    L ++    S G V SLI     MS  +++         
Sbjct: 319 SIETGDLALSEAIVTSKR----LNIWAVTVSFGCVNSLISMPCKMSHASIDPELRKQRAF 374

Query: 348 -QNLLRISVGCESPEDLIADLAGAFRQ 373
            ++L+R+  G E  +DL  DL  AF +
Sbjct: 375 PEDLIRLCCGIEDVKDLQYDLLAAFEE 401

>NDAI0D02880 Chr4 (669487..670830) [1344 bp, 447 aa] {ON} Anc_4.53
          Length = 447

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 107/451 (23%), Positives = 175/451 (38%), Gaps = 95/451 (21%)

Query: 2   VELCTSLIHADDNSNRVNDVAPPINVTTTFRYSEDDLIPAVERTADTAGSN--GHFYSRV 59
           ++L     + DDN+NR   V  PI  TT++ +++       E  ++  G    G+ YSR 
Sbjct: 8   IQLHAGQENPDDNANRPRAV--PIYATTSYVFNDS------EHGSNLFGLKVPGYVYSRF 59

Query: 60  SHPNGARCEVLLAEALGG-EAVVYSSGLAAFGAA---LTHFNPKRLFIGRGYHGCHGVAD 115
            +P     E  +A   GG  AV  +SG AA   A   L H     +     Y G +    
Sbjct: 60  QNPTQNVLEERMAALEGGVAAVAVASGQAAQTLAICGLAHSGDNIISTSFLYGGTYNQFK 119

Query: 116 IWVRNHGLQKLSLEEVSERSEPGDL----------VHIESPINPYGTLVDVXXXXXXXXX 165
           +  +  G++            P D           V++ES  NP   + D          
Sbjct: 120 VAFKRLGIEA----RFVTGDNPDDFEKLIDDKTKAVYLESIGNPKYNVPDFEKIVEIAHK 175

Query: 166 XXXYVVLDATF-APPPLQDRWEQGADVVVHSCTKYFGGHSDLLGGV-------------- 210
               VV+D TF A        + GAD+V HS TK+ GGH   + G+              
Sbjct: 176 HGVPVVVDNTFGAGGFFCQPIKYGADIVTHSATKWIGGHGTTIAGMIVDSGKFPWADYPE 235

Query: 211 ------------------HAVRDAAVARQLRQDRVY-LGTNIANLEAYLLIRSMRTMEMR 251
                              A  + A    +R + +  LG  I+   A+LLI+ + T+ +R
Sbjct: 236 KFPQFSKPAEGYHGTIFNEAYGNLAYIVHVRVELLRDLGPAISPFAAFLLIQGIETLSLR 295

Query: 252 VVRQSTSATKVVAYLESHKAEFGGVLVKVFHSSLQTEPY---VQQYLRGGNAPVFSILLR 308
             R   +A K+  +LE         +  V +  L + PY    ++YL  G   V S  ++
Sbjct: 296 GERHGQNALKLAQWLEQSP-----YVSWVSYPGLPSHPYHENAKKYLSNGFGGVLSFGVK 350

Query: 309 -----TVEQCKRLP---------SLLKLFHHATSLGGVESLI------EWRAMSD----- 343
                T E+    P           LKL  +  ++G  ++L+          + D     
Sbjct: 351 DIPGQTKEELAAKPFSASGAQVVDSLKLASNLANVGDSKTLVIAPYFTTHEQLDDDEKLL 410

Query: 344 TTVEQNLLRISVGCESPEDLIADLAGAFRQL 374
           + V ++L+R+SVG E  +D+IAD   +F ++
Sbjct: 411 SGVTKDLIRVSVGTEFIDDIIADFQQSFEKV 441

>YFR055W Chr6 (264204..265226) [1023 bp, 340 aa] {ON}
           IRC7Beta-lyase involved in the production of thiols;
           null mutant displays increased levels of spontaneous
           Rad52p foci; expression induced by nitrogen limitation
           in a GLN3, GAT1-dependent manner and by copper levels in
           a Mac1-dependent manner
          Length = 340

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 81/342 (23%), Positives = 133/342 (38%), Gaps = 43/342 (12%)

Query: 10  HADDNSNRVNDVAPPINVTTTFRYSEDDLIPAVERTADTAGSNGHFYSRVSHPNGARCEV 69
           + D+ S  VN   PP+   +T           +++ +D     G FY     P     E 
Sbjct: 22  NPDEQSGFVN---PPLYKGSTI---------ILKKLSDLEQRKGRFYGTAGSPTIDNLEN 69

Query: 70  LLAEALGGEAVVYS-SGLAAFGAALTHFN--------------PKRLFIGRGYHGCHGV- 113
                 GG   V S SGL +   AL   +              P R+        C G+ 
Sbjct: 70  AWTHLTGGAGTVLSASGLGSISLALLALSKAGDHILMTDSVYVPTRML-------CDGLL 122

Query: 114 ADIWVRNHGLQKLSLEEVSERSEPGD-LVHIESPINPYGTLVDVXXXXXXXXXXXXYVVL 172
           A   V          +++ +  +P   ++ +ESP +    + D+              +L
Sbjct: 123 AKFGVETDYYDPSIGKDIEKLVKPNTTVIFLESPGSGTMEVQDIPALVSVAKKHGIKTIL 182

Query: 173 DATFAPPPLQDRWEQGADVVVHSCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTN 232
           D T+A P   D    G D+ V + TKY GGHSDLL G+ +  +      LR     +   
Sbjct: 183 DNTWATPLFFDAHAHGIDISVEAGTKYLGGHSDLLIGLASANEECWPL-LRSTYDAMAML 241

Query: 233 IANLEAYLLIRSMRTMEMRVVRQSTSATKVVAYLESHKAEFGGVLVKVFHSSLQTEPYVQ 292
               +  L +R MRT+ +R+      A  + A+L  ++ E   VL   F      E +V+
Sbjct: 242 PGAEDCQLALRGMRTLHLRLKEVERKALDLAAWL-GNRDEVEKVLHPAFEDCPGHEYWVR 300

Query: 293 QYLRGGNAPVFSILLR---TVEQCKRLPSLLKLFHHATSLGG 331
            Y   G++ +FSI+L+   T    +++   +K+     S GG
Sbjct: 301 DY--KGSSGLFSIVLKNGFTRAGLEKMVEGMKVLQLGFSWGG 340

>TPHA0F00420 Chr6 complement(103419..104747) [1329 bp, 442 aa] {ON}
           Anc_4.53 YLR303W
          Length = 442

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 107/432 (24%), Positives = 173/432 (40%), Gaps = 83/432 (19%)

Query: 13  DNSNRVNDVAPPINVTTTFRYSEDDLIPAVERTADTAG--SNGHFYSRVSHPNGARCEV- 69
           DN++R    A PI  TT+F + +          A   G    G+ YSRV +P     E  
Sbjct: 19  DNAHR--PAAVPIYQTTSFVFEDS------HHGAQLFGLEKPGYMYSRVGNPTVDVLEKR 70

Query: 70  LLAEALGGEAVVYSSGLAAFGAALT---HFNPKRLFIGRGYHGCHGVADIWVRNHGLQ-K 125
           L A   G  AV  SSG AA   A+T   H     +     Y G +    +  +  G+  +
Sbjct: 71  LAALEGGAAAVCVSSGQAAQTLAITGLAHCGDNIVSTSYLYGGTYNQFKVAFKRLGIDVR 130

Query: 126 LSLEEVSER-----SEPGDLVHIESPINPYGTLVDVXXXXXXXXXXXXYVVLDATF-APP 179
             L +  E       E    V+IES  NP   + D              VV+D TF A  
Sbjct: 131 FVLGDNPEDFEKLFDEKTKAVYIESIGNPKYNVPDFEKIVAVAHKHGIPVVVDNTFGAGG 190

Query: 180 PLQDRWEQGADVVVHSCTKYFGGHSDLLGGV----------------------------- 210
                 + G D+V HS TK+ GGH   + GV                             
Sbjct: 191 FFCQPIKHGVDIVTHSATKWIGGHGTTIAGVIVDSGKFPWKDYPEKFPQFSKPSEGYHGM 250

Query: 211 ---HAVRDAAVARQLRQDRVY-LGTNIANLEAYLLIRSMRTMEMRVVRQSTSATKVVAYL 266
               A+   A    +R + +  LG  +  + A+LL++ + T+ +R  RQ  +A K+  +L
Sbjct: 251 IFNDAMGPLAYIAHVRTELLRDLGPVMEPIAAFLLLQGVETLSLRAERQGQNALKLAQWL 310

Query: 267 ESHKAEFGGVLVKVFHSSLQTEPY---VQQYLRGGNAPVFSILLRTVEQCK--------- 314
           E         +  V +  L + PY    ++YL  G   V SI ++ ++            
Sbjct: 311 EKSPH-----VNWVSYPGLPSHPYHDNAKKYLDNGFGGVLSIGVKPLKDVSDSDPFKKSG 365

Query: 315 -RLPSLLKLFHHATSLGGVESLI------EWRAMSD-----TTVEQNLLRISVGCESPED 362
            ++   LKL  +  ++G  ++L+        + +SD     + V ++L+RIS+G E  +D
Sbjct: 366 AQVVDNLKLALNLANVGDSKTLVIAPYFTTHQQLSDEDKLKSGVTEDLIRISIGTEFIDD 425

Query: 363 LIADLAGAFRQL 374
           +IAD   +F ++
Sbjct: 426 IIADFEQSFEKV 437

>NCAS0A05810 Chr1 (1143717..1145060) [1344 bp, 447 aa] {ON} Anc_4.53
          Length = 447

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 103/455 (22%), Positives = 176/455 (38%), Gaps = 103/455 (22%)

Query: 2   VELCTSLIHADDNSNRVNDVAPPINVTTTFRYSEDDLIPAVERTADTAGSN--GHFYSRV 59
           V+L     + DDN NR   V  PI  TT++ +++       +  A   G    G+ YSR 
Sbjct: 8   VQLHAGQENPDDNKNRPRAV--PIYATTSYVFNDS------KHGAQLFGLEVPGYVYSRF 59

Query: 60  SHPNGARCEVLLAEALGGEAVV-YSSGLAAFGAA---LTHFNPKRLFIGRGYHGCHGVAD 115
            +P     E  +A   GG A V  SSG AA   A   L H     +     Y G +    
Sbjct: 60  QNPTNNVFEERIAALEGGAAAVAVSSGQAAQTLAISGLAHVGDNIVSTSYLYGGTYNQFK 119

Query: 116 IWVRNHGLQKLSLEEVSERSEPGDL----------VHIESPINPYGTLVDVXXXXXXXXX 165
           +  +  G++        +   P D           V++ES  NP   + D          
Sbjct: 120 VAFKRLGVEA----RFVDGDNPADFEKLFDERTKAVYLESIGNPKYNVPDFEGIVAVAHK 175

Query: 166 XXXYVVLDATFAP-----PPLQDRWEQGADVVVHSCTKYFGGHSDLLGGV------HAVR 214
               VV+D TF        PL+     GAD+V HS TK+ GGH   + GV         +
Sbjct: 176 HGIPVVVDNTFGAGGFFCQPLK----FGADIVTHSATKWIGGHGTTVAGVVVDSGKFPWK 231

Query: 215 D----------------AAVARQLRQDRVY-----------LGTNIANLEAYLLIRSMRT 247
           D                  +  +   +  Y           LG  +    A+LL++ + T
Sbjct: 232 DYPEKFPQFSKPAEGYHGTIFNETYGNLAYIVHVRVELLRDLGPGMNPFAAFLLLQGVET 291

Query: 248 MEMRVVRQSTSATKVVAYLESHKAEFGGVLVKVFHSSLQTEPY---VQQYLRGGNAPVFS 304
           + +R  R +++A  +  +LE         +  V +  L++  +    ++YL  G   V S
Sbjct: 292 LSLRCERHASNALALAKWLEKSP-----YVSWVSYPGLESHSHHENAKKYLSNGFGGVLS 346

Query: 305 ILLRTV-----EQCKRLP---------SLLKLFHHATSLGGVESLI------EWRAMSD- 343
             ++ +     E+ K+ P           L+L  +  ++G  ++L+        + + D 
Sbjct: 347 FGVKDLPNQSEEEVKKNPFAASGAQVVDSLQLASNLANVGDSKTLVIAPYFTTHQQLDDD 406

Query: 344 ----TTVEQNLLRISVGCESPEDLIADLAGAFRQL 374
               + V ++L+R+SVG E  +D+I D   +F ++
Sbjct: 407 EKLLSGVTKDLIRVSVGTEFIDDIIGDFQQSFEKV 441

>ZYRO0G22198g Chr7 complement(1827527..1828864) [1338 bp, 445 aa]
           {ON} highly similar to uniprot|P06106 Saccharomyces
           cerevisiae YLR303W MET17 O-acetyl homoserine-O-acetyl
           serine sulfhydrylase required for sulfur amino acid
           synthesis
          Length = 445

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 99/403 (24%), Positives = 158/403 (39%), Gaps = 97/403 (24%)

Query: 53  GHFYSRVSHPNGARCEVLLAEALGG-EAVVYSSGLAAFGAALT---HFNPKRLFIGRGYH 108
           G+ YSR+ +P     E  +A   GG  A+  SSGLAA   A+T   H     +     Y 
Sbjct: 53  GYIYSRIMNPTADVFERRIAALEGGVGALAVSSGLAAQTLAITGLAHAGDNIVSTSYLYG 112

Query: 109 GCHGVADIWVRNHGLQKLSLE---------EVSERSEPGDLVHIESPINPYGTLVDVXXX 159
           G +    I  +  G++   +E         ++ ER++    V++E+  NP   + D    
Sbjct: 113 GTYNQFKIAFKRFGIESRFIEGDDPSGLEAQIDERTK---AVYLETIGNPKYNVPDFEKI 169

Query: 160 XXXXXXXXXYVVLDATFAP-----PPLQDRWEQGADVVVHSCTKY--------------- 199
                     VV+D TF        P++     GADVVVHS TK+               
Sbjct: 170 VAIAHKHGVPVVVDNTFGAGGYYCQPIK----HGADVVVHSATKWIGGHGTTIGGVIVDS 225

Query: 200 -----------FGGHSDLLGGVH------AVRDAAVARQLRQDRVY-LGTNIANLEAYLL 241
                      F   S+   G H      A+ + A    +R + +  LG +++   A+LL
Sbjct: 226 GNFPWKEYPKKFPQFSEPSEGYHGLVFNEALGNQAFIGHVRAELLRDLGPSLSPFAAFLL 285

Query: 242 IRSMRTMEMRVVRQSTSATKVVAYLE----------------SHKAE--------FGGVL 277
           ++ + T+ +R  R +++A K+  +LE                SH A         FGGVL
Sbjct: 286 LQGLETLSLRAERHASNALKLAQWLEKSPYVSWVSYPGLPNHSHHANAKKYLTNGFGGVL 345

Query: 278 VKVFHSSLQTEPYVQQY-LRGGNAPVFSIL-----LRTVEQCKRLPSLLKLFHHATSLGG 331
                  L   P  ++   +   A +   L     L  V  CK L  +   F     L  
Sbjct: 346 -SFGAKDLPDNPEEKENPFKAAGAQISDNLELASNLANVGDCKTL-VIAPYFTTHLQLNH 403

Query: 332 VESLIEWRAMSDTTVEQNLLRISVGCESPEDLIADLAGAFRQL 374
            E L          V ++L+R+SVG E  +D+IAD   +F+++
Sbjct: 404 EEKLA-------AGVSKDLIRVSVGTEFIDDIIADFEQSFKKV 439

>Ecym_8365 Chr8 complement(732418..733752) [1335 bp, 444 aa] {ON}
           similar to Ashbya gossypii ADL031W
          Length = 444

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 97/449 (21%), Positives = 174/449 (38%), Gaps = 100/449 (22%)

Query: 9   IHA--DDNSNRVNDVAPPINVTTTFRYSEDDLIPAVERTADTAGSN--GHFYSRVSHPNG 64
           +HA  D ++N  N  A PI  T+++ +         +  AD  G N  G+ YSR+ +P  
Sbjct: 10  LHAGQDASANSGNPRAVPIYATSSYVFKNS------QHGADLFGLNTPGYLYSRMGNPTV 63

Query: 65  ARCEVLLAEALGGEA-VVYSSGLAAFG---AALTHFNPKRLFIGRGYHGCHGVADIWVRN 120
              E  LA   GG   V  +SG AA      AL       +     Y G +    +  + 
Sbjct: 64  DVLEKRLAALEGGRGCVAVASGQAAQAMALGALAQVGDNIVTSSHLYGGTYNQLKVAFKR 123

Query: 121 HGLQKLSLEEVSERSEPGDL-------VHIESPINPYGTLVDVXXXXXXXXXXXXYVVLD 173
            G++ +   E  E  +   L       +++ES  NP  T+ D              VV+D
Sbjct: 124 LGVE-VRFSEGGEAEDYEQLFDDKTKALYVESIGNPKYTVPDFEKITEVAHKHGIPVVVD 182

Query: 174 ATFAPPPLQDR-WEQGADVVVHSCTKYFGGHSDLLGGVHAVRD----------------- 215
            TF       +  E GAD++ HS TK+  GH   + G  A+ D                 
Sbjct: 183 NTFGAAGFFCKPIEFGADIITHSATKWINGHGTAIAG--AIVDSGNFPWTQYPDKFPQFS 240

Query: 216 ---------------------AAVARQLRQDRVYLGTNIANLEAYLLIRSMRTMEMRVVR 254
                                A V  +L +D   LG+ ++   A+L ++ + T+ +R  R
Sbjct: 241 QPAESYHGMVYNDNFGPLAFIAYVRLELLRD---LGSTMSPFTAFLSLQGLETLSLRCER 297

Query: 255 QSTSATKVVAYLESHKAEFGGVLVKVFHSSLQTEPY---VQQYLRGGNAPVFSILLRTVE 311
            + ++  +  +LE         +  V +  L + P     ++YL  G   + S  ++  +
Sbjct: 298 HARNSIDLARHLEDSP-----YVAWVSYPGLDSHPSRNNAKKYLTNGAGGMLSFGIKPFD 352

Query: 312 QCK---------------RLPSLLKLFHHATSLGGVESLI------EWRAMSD-----TT 345
           +                 +    LKL  +  ++G  ++L+        + ++D       
Sbjct: 353 KTNGEEEASEVDTSVIAAKFVDSLKLASNLANVGDSKTLVIAPYFTTHQQLTDEEKLKAG 412

Query: 346 VEQNLLRISVGCESPEDLIADLAGAFRQL 374
            +++++R+SVG E  +D+IAD   AF+ +
Sbjct: 413 ADKDVIRVSVGTEYIDDIIADFEQAFKTV 441

>KNAG0I02920 Chr9 (573008..574345) [1338 bp, 445 aa] {ON} Anc_4.53
           YLR303W
          Length = 445

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 101/438 (23%), Positives = 168/438 (38%), Gaps = 92/438 (21%)

Query: 12  DDNSNRVNDVAPPINVTTTFRYSEDDLIPAVERTADTAGSN--GHFYSRVSHPNGARCE- 68
           D N N     A PI  TT++ + +       +  AD  G    G+ Y R  +P  A  E 
Sbjct: 16  DPNDNNHRPRAVPIYATTSYVFEDS------KHGADLFGLKVPGYVYGRFQNPTQAVLED 69

Query: 69  VLLAEALGGEAVVYSSGLAAFGAA---LTHFNPKRLFIGRGYHGCHGVADIWVRNHGLQK 125
            L A   G  A+  +SG AA   A   L H     +     Y G +    +  +  G++ 
Sbjct: 70  RLAALEGGAAALATASGQAAQTLAIQGLAHCGDNIVSTSFLYGGTYNQFKVAFKRFGIEA 129

Query: 126 LSLEEVSERS------EPGDLVHIESPINPYGTLVDVXXXXXXXXXXXXYVVLDATFAP- 178
             +E  S         E    V++ES  NP   + D              V++D TF   
Sbjct: 130 RFVEGDSPEDFEKVFDERTKCVYLESIGNPKYNVPDFEKIVAVAHKHGIPVMVDNTFGAG 189

Query: 179 ----PPLQDRWEQGADVVVHSCTKYFGGHSDLLGGV------------------------ 210
                PL+     GAD+V HS TK+ GGH   LGG+                        
Sbjct: 190 GFFCQPLK----YGADIVTHSATKWIGGHGTTLGGIIVDSGKFPWKDYPEKFPQFSKPAE 245

Query: 211 --------HAVRDAAVARQLRQDRVY-LGTNIANLEAYLLIRSMRTMEMRVVRQSTSATK 261
                    A  + A    +R + +  LG+ I+   A+LLI+ + T+ +R  R   +A K
Sbjct: 246 GYHGTIYNEAYGNLAYIVHVRTELLRDLGSMISPFAAFLLIQGVETLSLRGERHGQNALK 305

Query: 262 VVAYLESHK----AEFGGVLVKVFHSSLQTEPYVQQYLRGGNAPVFSILLRTVEQC---- 313
           +  +LE+        + G+     H +       ++YL  G   + S  ++ +       
Sbjct: 306 LAKWLEASPYVSWVSYPGLPSHSHHEN------AKKYLSNGFGGMLSFGVKDLPNAATET 359

Query: 314 -------KRLPSLLKLFHHATSLGGVESLI------EWRAMSD-----TTVEQNLLRISV 355
                   ++   LKL  +  ++G  ++L+          ++D     + V ++L+R+SV
Sbjct: 360 DPFKLSGAQVVDNLKLASNLANVGDSKTLVIAPFFTTHEQLADEEKLASGVTKDLIRVSV 419

Query: 356 GCESPEDLIADLAGAFRQ 373
           G E  +D+I D   AF +
Sbjct: 420 GTEYIDDIIEDFKQAFEK 437

>Kpol_1041.44 s1041 (117344..118678) [1335 bp, 444 aa] {ON}
           (117344..118678) [1335 nt, 445 aa]
          Length = 444

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 95/436 (21%), Positives = 167/436 (38%), Gaps = 86/436 (19%)

Query: 12  DDNSNRVNDVAPPINVTTTFRYSEDDLIPAVERTADTAG--SNGHFYSRVSHPNGARCEV 69
           D ++N  N  A PI  TT++ +++       +  A   G  + G+ YSR+ +P     E 
Sbjct: 16  DASTNANNPNAVPIYATTSYVFNDS------KHGAQLFGLETPGYIYSRIMNPTVDVFEK 69

Query: 70  LLAEALGG-EAVVYSSGLAAFGAALT---HFNPKRLFIGRGYHGCHGVADIWVRNHGLQK 125
            +A   GG  A+  SSG AA   A+T   H     +     Y G +    +  +  G+  
Sbjct: 70  RIAALEGGIAALAVSSGQAAQTLAITGLAHAGDNIVSTSYLYGGTYNQFKVAFKRLGINV 129

Query: 126 LSLEEVSERS------EPGDLVHIESPINPYGTLVDVXXXXXXXXXXXXYVVLDATF-AP 178
             +E    +       E    V++E+  NP   + D              VV+D TF A 
Sbjct: 130 KFVEGDDPKDFEKLFDEKTKAVYLETIGNPKYNVPDFEKITEVAHKHGIPVVVDNTFGAG 189

Query: 179 PPLQDRWEQGADVVVHSCTKYFGGHSDLLGGV---------------------------- 210
                  + G D+V HS TK+ GGH   + G                             
Sbjct: 190 GYFCQPIKYGCDIVTHSATKWIGGHGTTVAGAIIDSGKFPWKDYPERFPQFSKPSEGYHG 249

Query: 211 ----HAVRDAAVARQLRQDRVY-LGTNIANLEAYLLIRSMRTMEMRVVRQSTSATKVVAY 265
                A   AA    +R + +  LG  +    A+LL++ + T+ +R  R   +  K+  +
Sbjct: 250 LVFNDAFGPAAFIGHVRTELLRDLGPCLDAFSAFLLLQGVETLSLRGERHGENTLKLAKW 309

Query: 266 LESHK----AEFGGVLVKVFHSSLQTEPYVQQYLRGGNAPVFSILLRTVEQCK------- 314
           LE         + G+     H +       ++YL  G   V S  ++ +           
Sbjct: 310 LEKSPYVSWVSYPGLPSHSHHEN------AKKYLSNGFGGVLSFGVKDLPNASDEKDPFK 363

Query: 315 ----RLPSLLKLFHHATSLGGVESLI------------EWRAMSDTTVEQNLLRISVGCE 358
               ++   LKL  +  ++G  ++L+            E   ++ + V ++L+R+SVG E
Sbjct: 364 ASGAQVVDNLKLALNLANVGDSKTLVIAPYFTTHQQLNEEEKLA-SGVTKDLIRVSVGTE 422

Query: 359 SPEDLIADLAGAFRQL 374
             +D+IAD   +F ++
Sbjct: 423 YIDDIIADFQQSFEKV 438

>Smik_10.423 Chr10 complement(654265..656184) [1920 bp, 639 aa] {ON}
           YJR130C (REAL)
          Length = 639

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 61/246 (24%), Positives = 102/246 (41%), Gaps = 30/246 (12%)

Query: 141 VHIESPINPYGTLVDVXXXXXXXXXXXXYVVLDATFAPPPLQDRWEQGADVVVHSCTKYF 200
           V IE+P NP   + D+            Y+V+D T       D     AD+V  S TK F
Sbjct: 387 VFIEAPSNPLLKMGDLQELKRLSDLYSFYIVVDETVGGFVNIDVLPY-ADIVCSSLTKIF 445

Query: 201 GGHSDLLGGVHAVRDAA----VARQLRQDRVYLGTNIANLEAYLLIRSMRTMEMRVVRQS 256
            G S+++ G   +         AR+  +        +   +A  L R+ R    R ++ +
Sbjct: 446 SGDSNVIAGSLVLNPKGKIYEFARKFMKTEDGYEDCLWCEDALCLERNSRDFVERTIKVN 505

Query: 257 TSA----TKVVAYLESHKAEFGGVLVKVFHSSLQTEPYVQQY------LRGGNAPVFSIL 306
           T+     TKV+        + G +  K+++ SL +E   + Y        GG   +FS+ 
Sbjct: 506 TNTNILLTKVLL------PQVGKLFKKIYYPSLTSEETKRNYDSVISTKDGGYGGLFSLT 559

Query: 307 LRTVEQCKRL---------PSLLKLFHHATSLGGVESLIEWRAMSDTTVEQNLLRISVGC 357
             ++E+ K+          PSL   F  A     +    E   ++   VE+NL+R+SVG 
Sbjct: 560 FFSIEEAKKFFNNLELCKGPSLGTNFTLACPYAIIAHYQELDEIAQYGVEKNLVRVSVGL 619

Query: 358 ESPEDL 363
           E+ + L
Sbjct: 620 ENSDVL 625

>SAKL0G18172g Chr7 complement(1572652..1574673) [2022 bp, 673 aa]
           {ON} similar to uniprot|P47164 Saccharomyces cerevisiae
           YJR130C STR2 Cystathionine gamma-synthase converts
           cysteine into cystathionine
          Length = 673

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 65/255 (25%), Positives = 105/255 (41%), Gaps = 21/255 (8%)

Query: 127 SLEEVSERSEPGDLVHIESPINPYGTLVDVXXXXXXXXXXXXYVVLDATFAPPPLQDRWE 186
           +L+E+    E    V +E+P NP   + D+            YVV+D T       D   
Sbjct: 405 TLKEILHSGEQILAVFMETPSNPLLKMGDLLELKRLADIYGFYVVVDETAGGFVNIDVLP 464

Query: 187 QGADVVVHSCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTNIANL---EAYLLIR 243
             AD+V  S TK F G S+++ G   +   +   +  Q+    G     L   +A  L R
Sbjct: 465 H-ADLVCSSLTKIFSGDSNVMAGSLVLNPNSRLHEFAQEFFRNGEYEDCLWCEDAIYLER 523

Query: 244 SMRTMEMRVVRQSTSATKVVAYLESHKAEFGGVLVKVFHSSLQTEPYVQQY------LRG 297
           + R    R ++ +++A  ++   +    E G +  K+++  L +E   Q Y        G
Sbjct: 524 NSRDFVTRTLKVNSNAEMLLN--DVLIPEEGHLFSKIYYPRLTSEETKQNYDTVRCKPNG 581

Query: 298 GNAPVFSILLRTVEQCKRL---------PSLLKLFHHATSLGGVESLIEWRAMSDTTVEQ 348
           G   +FS+    +EQ K+          PSL   F  A     +    E   ++   VE 
Sbjct: 582 GYGGLFSLTFYEIEQAKKFFNALELCKGPSLGTNFTLACPYAVLAHYAELEKVAQYGVEA 641

Query: 349 NLLRISVGCESPEDL 363
           NL+R+SVG E  E L
Sbjct: 642 NLVRVSVGLEDAEHL 656

>Suva_12.221 Chr12 complement(344667..346586) [1920 bp, 639 aa] {ON}
           YJR130C (REAL)
          Length = 639

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 61/246 (24%), Positives = 101/246 (41%), Gaps = 30/246 (12%)

Query: 141 VHIESPINPYGTLVDVXXXXXXXXXXXXYVVLDATFAPPPLQDRWEQGADVVVHSCTKYF 200
           V IE+P NP   + D+            Y+V+D T       D     AD+V  S TK F
Sbjct: 387 VFIEAPSNPLLKMGDLQELKRLSDLYSFYIVVDETVGGFVNIDVLPY-ADIVCSSLTKIF 445

Query: 201 GGHSDLLGGVHAV----RDAAVARQLRQDRVYLGTNIANLEAYLLIRSMRTMEMRVVRQS 256
            G S+++ G   +    +    AR+           +   +A  L R+ R    R ++ +
Sbjct: 446 SGDSNVIAGSLVLNPRGKIYEFARKFMSTEDGYEDCLWCEDALCLERNSRDFVERTIKVN 505

Query: 257 TSA----TKVVAYLESHKAEFGGVLVKVFHSSLQTEPYVQQY------LRGGNAPVFSIL 306
           T+     TKV+        + G +  K+++ SL +E   + Y        GG   +FS+ 
Sbjct: 506 TNTDVLLTKVLL------PQVGKLFKKIYYPSLTSEETKKNYDNVMSTKDGGYGGLFSLT 559

Query: 307 LRTVEQCKRL---------PSLLKLFHHATSLGGVESLIEWRAMSDTTVEQNLLRISVGC 357
              +E+ K+          PSL   F  A     +    E   ++   VE+NL+R+SVG 
Sbjct: 560 FFNIERAKKFFNSLELCKGPSLGTNFTLACPYAIIAHYQELDEIAQYGVEKNLVRVSVGL 619

Query: 358 ESPEDL 363
           E+ + L
Sbjct: 620 ENSDVL 625

>KLTH0D03652g Chr4 complement(358612..359946) [1335 bp, 444 aa] {ON}
           highly similar to uniprot|P06106 Saccharomyces
           cerevisiae YLR303W MET17 O-acetyl homoserine-O-acetyl
           serine sulfhydrylase required for sulfur amino acid
           synthesis
          Length = 444

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 99/434 (22%), Positives = 171/434 (39%), Gaps = 82/434 (18%)

Query: 12  DDNSNRVNDVAPPINVTTTFRYSEDDLIPAVERTADTAG--SNGHFYSRVSHPNGARCEV 69
           D   N  N  A PI  T+++ +++       +  A   G    G+ YSR+ +P     E 
Sbjct: 16  DATENAHNPRAVPIYATSSYVFNDS------QHGAQLFGLEKPGYMYSRIVNPTVDVFER 69

Query: 70  LLAEALGG-EAVVYSSGLAAFGAA---LTHFNPKRLFIGRGYHGCHGVADIWVRNHGLQK 125
            +A   GG  A+  +SG AA   A   L H     +     Y G +    +  R  G++ 
Sbjct: 70  RIAALEGGVAALAVASGQAAQALAISGLAHAGDNIVSTSFLYGGTYNQFKVAFRRLGIET 129

Query: 126 LSLE----EVSERS--EPGDLVHIESPINPYGTLVDVXXXXXXXXXXXXYVVLDATF-AP 178
             +E    E  E++  +    V++E+  NP   + D              VV+D TF A 
Sbjct: 130 RFIEGDKPEDFEKAFDDKTKAVYLETIGNPKYNVPDFEKIVAVAHKHGIPVVVDNTFGAG 189

Query: 179 PPLQDRWEQGADVVVHSCTKY--------------------------FGGHSDLLGGVHA 212
                  + GAD+V HS TK+                          F   S    G H 
Sbjct: 190 GYFAQPIKYGADIVTHSATKWIGGHGTTIGGVIVDSGKFPWKEYPEKFPQFSKPSEGYHG 249

Query: 213 --VRDAA--------VARQLRQDRVYLGTNIANLEAYLLIRSMRTMEMRVVRQSTSATKV 262
             + DA         V  +L +D   LG  +    A+ L++ + T+ +R  R +T+A K+
Sbjct: 250 LVINDALGPLAYIGHVRIELLRD---LGPALNPFAAFQLLQGVETLSLRCERHATNALKL 306

Query: 263 VAYLESHKAEFGGVLVKVFHSSLQTEPYVQQYLRGGNAPVFSILLRTVEQCKRLP----- 317
             YLE  K+ +   +     SS       ++YL+ G   V S  ++ +     +      
Sbjct: 307 AQYLE--KSPYVSWVSYPGLSSHSHHENAKKYLQNGFGGVLSFGVKDLPNAHEIEDPFKA 364

Query: 318 ------SLLKLFHHATSLGGVESLI------EWRAMSD-----TTVEQNLLRISVGCESP 360
                   LK+  +  ++G  ++L+        + ++D     + V ++L+R+SVG E  
Sbjct: 365 SGAQVVDSLKIASNLANVGDSKTLVIAPYFTTHQQLTDEEKLASGVTKDLIRVSVGTEFI 424

Query: 361 EDLIADLAGAFRQL 374
           +D+I D   AF ++
Sbjct: 425 DDIIGDFEQAFEKV 438

>Skud_10.353 Chr10 complement(623771..625693) [1923 bp, 640 aa] {ON}
           YJR130C (REAL)
          Length = 640

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 59/246 (23%), Positives = 102/246 (41%), Gaps = 30/246 (12%)

Query: 141 VHIESPINPYGTLVDVXXXXXXXXXXXXYVVLDATFAPPPLQDRWEQGADVVVHSCTKYF 200
           V IE+P NP   + D+            Y+V+D T       D     AD++  S TK F
Sbjct: 388 VFIEAPSNPLLKMGDLQELKRLSDLYSFYIVVDETVGGFVNIDVLPY-ADIICSSLTKIF 446

Query: 201 GGHSDLLGGVHAV----RDAAVARQLRQDRVYLGTNIANLEAYLLIRSMRTMEMRVVRQS 256
            G S+++ G   +    +    A++  +        +   +A  L R+ R    R ++ +
Sbjct: 447 SGDSNVIAGSLVLNPRGKIYEFAKKFMKSENGYEDCLWCEDALCLERNSRDFVERTIKVN 506

Query: 257 TSA----TKVVAYLESHKAEFGGVLVKVFHSSLQTEPYVQQY------LRGGNAPVFSIL 306
           T+     TKV+        + G +  K+++ SL +E   + Y        GG   +FS+ 
Sbjct: 507 TNTDILLTKVLL------PQVGKLFKKIYYPSLTSEETKRNYDSVMATRDGGYGGLFSLT 560

Query: 307 LRTVEQCKRL---------PSLLKLFHHATSLGGVESLIEWRAMSDTTVEQNLLRISVGC 357
              +E+ K+          PSL   F  A     +    E   ++   VE+NL+R+SVG 
Sbjct: 561 FFDIEKAKKFFNNLELCKGPSLGTNFTLACPYAIIAHYQELDEIAQYGVEKNLVRVSVGL 620

Query: 358 ESPEDL 363
           E+ + L
Sbjct: 621 ENSDVL 626

>TBLA0C04400 Chr3 (1062021..1063358) [1338 bp, 445 aa] {ON} Anc_4.53
           YLR303W
          Length = 445

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 64/294 (21%), Positives = 119/294 (40%), Gaps = 66/294 (22%)

Query: 141 VHIESPINPYGTLVDVXXXXXXXXXXXXYVVLDATF-APPPLQDRWEQGADVVVHSCTKY 199
           V++E+  NP   + D              VV+D TF A        + GAD+V HS TK+
Sbjct: 151 VYLETIGNPKYNVPDFDKIVAVAHKHGIPVVVDNTFGAGGFFCQPIKYGADIVTHSATKW 210

Query: 200 FGGHSDLLGGV--------------------------------HAVRDAAVARQLRQDRV 227
            GGH   + G                                  A+ + A    +R + +
Sbjct: 211 IGGHGTTIAGAIIDSGKFPWKEYPEKFPQFSKPSEGYHGMIFNEAMGNLAFIGHVRTELL 270

Query: 228 Y-LGTNIANLEAYLLIRSMRTMEMRVVRQSTSATKVVAYLESHK----AEFGGVLVKVFH 282
             LG  ++   ++LL++ + T+ +R  RQ  +   +  +LE         + G++    H
Sbjct: 271 RDLGPCMSPFASFLLLQGVETLSLRAERQGENTLALAKWLEKSAYVSWVSYPGLVSHSHH 330

Query: 283 SSLQTEPYVQQYLRGGNAPVFSILLRTV----EQCKRLPSL-------LKLFHHATSLGG 331
            +       ++YLR G   V S  ++ +    E+     +        LKL  +  ++G 
Sbjct: 331 EN------AKKYLRNGFGGVLSFGVKDLPGAAEEKDPFKAAGAQAVDNLKLASNLANVGD 384

Query: 332 VESLI------EWRAMSD-----TTVEQNLLRISVGCESPEDLIADLAGAFRQL 374
            ++L+        + +SD     + V ++L+R+SVG E  +D+IAD   +F ++
Sbjct: 385 SKTLVIAPYFTTHQQLSDEEKLASGVTKDLIRVSVGTEFIDDIIADFQQSFEKI 438

>ADL031W Chr4 (645776..647179) [1404 bp, 467 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR303W (MET17)
          Length = 467

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 68/290 (23%), Positives = 115/290 (39%), Gaps = 64/290 (22%)

Query: 141 VHIESPINPYGTLVDVXXXXXXXXXXXXYVVLDATF-APPPLQDRWEQGADVVVHSCTKY 199
           V +ES  NP   + D              VV+D TF A        + GAD+V HS TK+
Sbjct: 151 VFLESIGNPKYNVPDFERIVAVAHRHGIPVVVDNTFGAGGYFCQPIKFGADIVTHSATKW 210

Query: 200 FGGHSDLLGGV--------------------------------HAVRDAAVARQLRQDRV 227
            GGH   +GG+                                 A+   A     R + +
Sbjct: 211 IGGHGTAIGGLVVDSGKFPWKDYPAKFPQFSEPSEGYHGLVLNEALGPLAFVGHARIELL 270

Query: 228 Y-LGTNIANLEAYLLIRSMRTMEMRVVRQSTSATKVVAYLESHKAEFGGVLVKVFHSSLQ 286
             LG  ++   A+L ++ + T+ +R  R   +A  +  YLE+        +  V +  L+
Sbjct: 271 RDLGPALSPFAAFLFLQGLETLSLRAERHGQNALALAKYLET-----SAYVSWVSYPGLE 325

Query: 287 TEPYVQ---QYLRGGNAPVFSI----LLRTVEQCKRLPSL-------LKLFHHATSLGGV 332
           +  Y+    +YL+ G   V S     L  T E+     +        LK   +  ++G  
Sbjct: 326 SHDYLSNATRYLQNGYGGVLSFGVKPLPDTDEEADPFKAAGAQFVDNLKFASNLANVGDS 385

Query: 333 ESLI------EWRAMSDTT-----VEQNLLRISVGCESPEDLIADLAGAF 371
           ++L+        + +S++      V ++L+R+SVG E  +D+IAD   AF
Sbjct: 386 KTLVIAPYFTTHQQLSESEKLASGVTRDLIRVSVGTEYLQDIIADFEQAF 435

>KLLA0D04037g Chr4 (336499..337833) [1335 bp, 444 aa] {ON} highly
           similar to uniprot|P06106 Saccharomyces cerevisiae
           YLR303W MET17 O-acetyl homoserine-O-acetyl serine
           sulfhydrylase required for sulfur amino acid synthesis
          Length = 444

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 98/425 (23%), Positives = 168/425 (39%), Gaps = 84/425 (19%)

Query: 19  NDVAPPINVTTTFRYSEDDLIPAVERTADTAG--SNGHFYSRVSHPNGARCEVLLAEALG 76
           N  A PI  TT++ +++       +  A   G  + G+ YSR+ +P     E  LA   G
Sbjct: 22  NPRAVPIYATTSYVFNDS------KHGAQLFGLETPGYIYSRIMNPTLDVLEKRLAALEG 75

Query: 77  G-EAVVYSSGLAAFGAALT---HFNPKRLFIGRGYHGCHGVADIWVRNHGLQKLSLE--- 129
           G  A+  SSG AA   A+T   H     +     Y G +    +  +  G++   ++   
Sbjct: 76  GIAALATSSGQAAQTLAVTGLAHTGDNIVSTSFLYGGTYNQFKVAFKRLGIEARFVDGDK 135

Query: 130 -EVSER--SEPGDLVHIESPINPYGTLVDVXXXXXXXXXXXXYVVLDATF-APPPLQDRW 185
            E  E+   E    +++ES  NP   + D              VV+D TF A        
Sbjct: 136 PEDFEKLFDEKTKALYLESIGNPKYNVPDFEKIVAVAHKHGIPVVVDNTFGAGGFFCQPI 195

Query: 186 EQGADVVVHSCTKY--------------------------FGGHSDLLGGVH------AV 213
           + GAD+V HS TK+                          F   S    G H      A 
Sbjct: 196 KYGADIVTHSATKWIGGHGVTVGGVIIDSGKFPWKDYPEKFPQFSQPSEGYHGLIFNDAF 255

Query: 214 RDAAVARQLRQDRVY-LGTNIANLEAYLLIRSMRTMEMRVVRQSTSATKVVAYLESHK-- 270
             AA    +R + +  LG  ++    +LL++ + T+ +R  R  ++A K+  YLES    
Sbjct: 256 GPAAFIGHVRTELLRDLGPVLSPFAGFLLLQGLETLSLRGERHGSNALKLAQYLESSPYV 315

Query: 271 --AEFGGVLVKVFHSSLQTEPYVQQYLRGGNAPVFSILLRTVEQCK-----------RLP 317
               + G+     H +       ++YL  G   V S  ++ +               ++ 
Sbjct: 316 SWVSYPGLPSHSHHEN------AKKYLENGFGGVLSFGVKDLPNASEESDPFKASGAQVV 369

Query: 318 SLLKLFHHATSLGGVESLI------EWRAMSD-----TTVEQNLLRISVGCESPEDLIAD 366
             LKL  +  ++G  ++L+        + ++D     + V ++L+R+SVG E  +D+IAD
Sbjct: 370 DNLKLASNLANVGDSKTLVIAPYFTTHQQLTDEEKLASGVTKDLIRVSVGTEFIDDIIAD 429

Query: 367 LAGAF 371
              +F
Sbjct: 430 FEASF 434

>AER164C Chr5 complement(944867..946804) [1938 bp, 645 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR130C
           (STR2) and YML082W
          Length = 645

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 67/251 (26%), Positives = 108/251 (43%), Gaps = 25/251 (9%)

Query: 128 LEEVSERSEPGDLVHIESPINPYGTLVDVXXXXXXXXXXXXYVVLDATFAPPPLQDRWEQ 187
           LE++    EP   V IE+P NP   + D+            Y+V+D T       D    
Sbjct: 378 LEDILHSGEPILAVFIETPSNPLLKMGDLQALRRLADIYGFYLVVDDTLGGFVNIDVLPH 437

Query: 188 GADVVVHSCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTNIANL---EAYLLIRS 244
            AD+V  S TK F G S+++ G   V  A+      Q   + G+    L   +A  L R+
Sbjct: 438 -ADLVCSSLTKIFSGDSNVMAGSLVVNPASRLYDFAQGFFHNGSYEDLLWCEDAIYLERN 496

Query: 245 MRTMEMRVVRQSTSATKVV-AYLESHKAEFGGVLVKVFHSSLQTEPYVQQY--LR----G 297
            R    R +R + +   ++   L  H+   G +  K+F+ +L +E   + Y  +R    G
Sbjct: 497 SRDCASRSLRVNKNTELLLEKVLLPHQ---GSLFKKIFYPTLTSEETKRNYDAVRCKPDG 553

Query: 298 GNAPVFS----------ILLRTVEQCKRLPSLLKLFHHATSLGGVESLIEWRAMSDTTVE 347
           G   +FS          +   T+E CK  PSL   F  A     +    E   +++  +E
Sbjct: 554 GYGGLFSLTFHEENRAKVFFDTLELCKG-PSLGTNFTLACPYTVLAHYAEMDVVAEYGLE 612

Query: 348 QNLLRISVGCE 358
           ++L+R+SVG E
Sbjct: 613 RSLVRVSVGLE 623

>YJR130C Chr10 complement(665218..667137) [1920 bp, 639 aa] {ON}
           STR2Cystathionine gamma-synthase, converts cysteine into
           cystathionine
          Length = 639

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 58/242 (23%), Positives = 100/242 (41%), Gaps = 22/242 (9%)

Query: 141 VHIESPINPYGTLVDVXXXXXXXXXXXXYVVLDATFAPPPLQDRWEQGADVVVHSCTKYF 200
           V IE+P NP   + D+            Y+V+D T       D     AD+V  S TK F
Sbjct: 387 VFIEAPSNPLLKMGDLQELKRLSDLYSFYIVVDETVGGFVNIDVLPY-ADIVCSSLTKIF 445

Query: 201 GGHSDLLGGVHAV----RDAAVARQLRQDRVYLGTNIANLEAYLLIRSMRTMEMRVVRQS 256
            G S+++ G   +    +    AR+  +        +   +A  L R+ R    R ++ +
Sbjct: 446 SGDSNVIAGSLVLNPRGKIYEFARKFMKTEDGYEDCLWCEDALCLERNSRDFVERTIKVN 505

Query: 257 TSATKVVAYLESHKAEFGGVLVKVFHSSLQTEPYVQQY------LRGGNAPVFSILLRTV 310
           T+   ++  +     + G +  K+++ SL +E   + Y        GG   +FS+    +
Sbjct: 506 TNTDILLKRV--LLPQVGKLFKKIYYPSLTSEDTKRNYDSVMSTKDGGYGGLFSLTFFNI 563

Query: 311 EQCKRL---------PSLLKLFHHATSLGGVESLIEWRAMSDTTVEQNLLRISVGCESPE 361
           E+ K+          PSL   F  A     +    E   ++   VE NL+R+SVG E+ +
Sbjct: 564 EEAKKFFNNLELCKGPSLGTNFTLACPYAIIAHYQELDEVAQYGVETNLVRVSVGLENSD 623

Query: 362 DL 363
            L
Sbjct: 624 VL 625

>Smik_13.55 Chr13 (99421..101520) [2100 bp, 699 aa] {ON} YJR130C
           (REAL)
          Length = 699

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 66/251 (26%), Positives = 99/251 (39%), Gaps = 38/251 (15%)

Query: 141 VHIESPINPYGTLVDVXXXXXXXXXXXXYVVLDATFAPPPLQDRWEQGADVVVHSCTKYF 200
           V IE+P NP   + ++            ++++D T       D     AD+V  S TK F
Sbjct: 445 VFIETPSNPLLKMGNLLELKRLSELFGFFIIIDETVGGIVNIDGL-PFADIVCGSLTKTF 503

Query: 201 GGHSDLLGGVHAVRDAAVARQLRQDRVY-LGTNIANLE-----------AYLLIRSMRTM 248
            G S+++GG   +          Q RVY   T    LE           A  L R+ R  
Sbjct: 504 SGDSNVIGGSMVLNP--------QSRVYEFATRFMQLEDEYEDLLWCEDAIYLERNSRDF 555

Query: 249 EMRVVRQSTSATKVV-AYLESHKAEFGGVLVKVFHSSLQTEPYVQQY------LRGGNAP 301
             R +R + S   ++   L++H  E  G+  K+++ SL ++  +  Y        GG   
Sbjct: 556 IARTIRINYSTEYLLDKILKAHVGE-NGLFKKIYYPSLTSKETLINYDMVRCKKEGGYGG 614

Query: 302 VFSILLRTVE---------QCKRLPSLLKLFHHATSLGGVESLIEWRAMSDTTVEQNLLR 352
           +FS+     +         Q  + PSL   F  A     +    E        VE+NLLR
Sbjct: 615 LFSLTFHDEDHAAAFYNNLQLNKGPSLGTNFTLAFPYTLMTYYHELTMAEKFGVERNLLR 674

Query: 353 ISVGCESPEDL 363
           ISVG ES   L
Sbjct: 675 ISVGLESQSTL 685

>SAKL0H23892g Chr8 (2059083..2060411) [1329 bp, 442 aa] {ON} highly
           similar to uniprot|P06106 Saccharomyces cerevisiae
           YLR303W MET17 O-acetyl homoserine-O-acetyl serine
           sulfhydrylase required for sulfur amino acid synthesis
          Length = 442

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 64/300 (21%), Positives = 115/300 (38%), Gaps = 78/300 (26%)

Query: 141 VHIESPINPYGTLVDVXXXXXXXXXXXXYVVLDATFAP-----PPLQDRWEQGADVVVHS 195
           +++ES  NP   + D              VV+D TF        P+  +W  GAD+V HS
Sbjct: 150 LYLESIGNPKYNVPDFEKIVAIAHKHGIPVVVDNTFGAGGFFCQPI--KW--GADIVTHS 205

Query: 196 CTKYFGGHSDLLGGV--------------------------------HAVRDAAVARQLR 223
            TK+ GGH   + G                                  A    A     R
Sbjct: 206 ATKWIGGHGTTIAGAIIDSGKFPWKDYPEKFPQFSKPSEGYHGLVFNDAFGPLAFIGHAR 265

Query: 224 QDRVY-LGTNIANLEAYLLIRSMRTMEMRVVRQSTSATKVVAYLESHK----AEFGGVLV 278
            + +  LG  ++   ++LL++ + T+ +R  R + +A K+  +LE         + G+  
Sbjct: 266 TELLRDLGPALSPFSSFLLLQGLETLSLRGERHAYNALKLAQWLEKSPYVSWVSYPGLES 325

Query: 279 KVFHSSLQTEPYVQQYLRGGNAPVFSILLRTVEQCK-----------RLPSLLKLFHHAT 327
              H +       ++YL+ G   V S  ++ +               ++   LKL  +  
Sbjct: 326 HTHHEN------AKKYLQNGFGGVLSFGVKPLPNASEESDPFKASGAQVVDNLKLASNLA 379

Query: 328 SLGGVESLI-------------EWRAMSDTTVEQNLLRISVGCESPEDLIADLAGAFRQL 374
           ++G  ++L+             E +  S  T   +L+R+SVG E  +D+IAD   +F ++
Sbjct: 380 NVGDSKTLVIAPYFTTHQQLSHEEKLASGVT--DDLIRVSVGTEFIDDIIADFEQSFEKI 437

>Kwal_26.7437 s26 complement(365889..367223) [1335 bp, 444 aa] {ON}
           YLR303W (MET17) - O-Acetylhomoserine-O-Acetylserine
           Sulfhydralase [contig 50] FULL
          Length = 444

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 69/299 (23%), Positives = 121/299 (40%), Gaps = 76/299 (25%)

Query: 141 VHIESPINPYGTLVDVXXXXXXXXXXXXYVVLDATF-APPPLQDRWEQGADVVVHSCTKY 199
           V++ES  NP   + D              VV+D TF A       ++ GAD++ HS TK+
Sbjct: 151 VYLESIGNPKYNVPDFEKIVAVAHKHGIPVVVDNTFGAGGFFAQPFKFGADIITHSATKW 210

Query: 200 F----------------------------------GGH----SDLLGGVHAVRDAAVARQ 221
                                              G H    +D LG +  +  A V  +
Sbjct: 211 IGGHGTTIGGVIVDSGKFPWKDYPEKFPQFSQPSEGYHGLIFNDALGPLAYI--AHVRVE 268

Query: 222 LRQDRVYLGTNIANLEAYLLIRSMRTMEMRVVRQSTSATKVVAYLESHK----AEFGGVL 277
           L +D   LG  +    A+ L++ + T+ +R  R +++A K+  YLES        + G+ 
Sbjct: 269 LLRD---LGPALNPFAAFQLLQGIETLSLRCERHASNALKLAQYLESSPYVSWVSYPGLP 325

Query: 278 VKVFHSSLQTEPYVQQYLRGGNAPVFSILLRTVEQCK-----------RLPSLLKLFHHA 326
               H +       ++YL+ G   V SI ++ +               ++   LKL  + 
Sbjct: 326 SHSHHEN------AKKYLQNGFGGVLSIGVKDLPNASEETDPFAASGAQVVDSLKLASNL 379

Query: 327 TSLGGVESLI------EWRAMSD-----TTVEQNLLRISVGCESPEDLIADLAGAFRQL 374
            ++G  ++L+        + +SD     + V ++L+RISVG E  +D+I D   AF ++
Sbjct: 380 ANVGDSKTLVIAPYFTTHQQLSDEEKLASGVTKDLIRISVGTEFIDDIIGDFEQAFEKV 438

>TDEL0E05710 Chr5 complement(1062353..1064023) [1671 bp, 556 aa]
           {ON} 
          Length = 556

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 61/256 (23%), Positives = 107/256 (41%), Gaps = 35/256 (13%)

Query: 143 IESPINPYGTLVDVXXXXXXXXXXXXYVVLDATFAPPPLQDRWEQGADVVVHSCTKYFGG 202
           +E+P NP   + D+            ++V+D T     L       AD+V  S TK F G
Sbjct: 304 VETPSNPLLNMPDLTGLRKLANEYGFFIVIDDTIGG--LNVDILPYADIVCTSLTKLFNG 361

Query: 203 HSDLLGG---------VHAVRDAAVARQLRQDRVYLGTNIANLEAYLLIRSMRTMEMRVV 253
            S+++GG         +++   A V     +D ++        +A +L  + R  E R V
Sbjct: 362 SSNVMGGSLILNPKSSLYSSARAFVESDGFEDLLWCE------DAKVLEINSRDFEDRTV 415

Query: 254 RQSTSATKVVAYLESHKAEFGGVLVKVFHSSLQTEPYVQQY--LR---GGNAPVFSILLR 308
           R + +  ++++  E      G V  K+++ ++ +E   + Y  +R   GG   +FS+   
Sbjct: 416 RANKNTERLLS--ELILVNEGKVFKKIYYPTVSSEETFKNYEAVRNKLGGYGCMFSMAFY 473

Query: 309 TVEQCKRLPSLLKLFHHATSLGGVESL----------IEWRAMSDTTVEQNLLRISVGCE 358
           + E  K     LK+F    S G   +L           E   +S    + NL+R+SVG E
Sbjct: 474 SEEDSKAFYDSLKVF-KGPSNGTNFTLACPYVQLAHRFELEEVSKFGADPNLIRVSVGLE 532

Query: 359 SPEDLIADLAGAFRQL 374
             + L+   + A   L
Sbjct: 533 DSQWLLDVFSDAINML 548

>KAFR0F03070 Chr6 (610571..611908) [1338 bp, 445 aa] {ON} Anc_4.53
           YLR303W
          Length = 445

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 64/309 (20%), Positives = 123/309 (39%), Gaps = 77/309 (24%)

Query: 129 EEVSERSEPGDLVHIESPINPYGTLVDVXXXXXXXXXXXXYVVLDATFAP-----PPLQD 183
           ++  ER++    V++ES  NP   + D              V++D TF        P++ 
Sbjct: 142 KQFDERTK---CVYLESIGNPKYNVPDFEKIVAVAHKHGIPVMVDNTFGAGGFFCQPIK- 197

Query: 184 RWEQGADVVVHSCTKYFGGHSDLLGGV--------------------------------H 211
               G D+V HS TK+ GGH   LGGV                                 
Sbjct: 198 ---YGVDIVTHSATKWIGGHGTTLGGVIIDSGKFPWKDYPEKFPQFSKPAEGYHGTIYNE 254

Query: 212 AVRDAAVARQLRQDRVY-LGTNIANLEAYLLIRSMRTMEMRVVRQSTSATKVVAYLESHK 270
           A  + A    +R + +  LG+ ++   A+LL++ + T+ +R  R   +A K+  +LE   
Sbjct: 255 AYGNLAYIVHVRTELLRDLGSLMSPFAAFLLLQGVETLSLRGERHGENALKLAKWLEQSP 314

Query: 271 ----AEFGGVLVKVFHSSLQTEPYVQQYLRGGNAPVFSILLRTVEQCK-----------R 315
                 + G+     H +       ++YL  G   + S  ++ +               +
Sbjct: 315 YVSWVSYPGLPSHSHHEN------AKKYLSNGFGGMLSFGVKDLPNADTETDPFKLSGAQ 368

Query: 316 LPSLLKLFHHATSLGGVESLI------EWRAMSD-----TTVEQNLLRISVGCESPEDLI 364
           +   LK+  +  ++G  ++L+        + ++D     + V ++L+R+SVG E  +D+I
Sbjct: 369 VVDNLKIASNLANVGDSKTLVIAPYFTTHQQLNDEEKLASGVTKDLIRVSVGTEFIDDII 428

Query: 365 ADLAGAFRQ 373
            D   +F +
Sbjct: 429 NDFQQSFER 437

>Kwal_14.791 s14 complement(49074..50789) [1716 bp, 571 aa] {ON}
           YLL058W - Hypothetical ORF [contig 245] FULL
          Length = 571

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 58/242 (23%), Positives = 101/242 (41%), Gaps = 25/242 (10%)

Query: 141 VHIESPINPYGTLVDVXXXXXXXXXXXXYVVLDATFAPPPLQDRWEQGADVVVHSCTKYF 200
           V +E+P NP   + D+            ++V+D T     L       AD+V  S TK F
Sbjct: 317 VFVETPSNPLLNVPDLDKLRKLADEYGFFIVIDDTIGG--LNVDILPYADIVCTSLTKLF 374

Query: 201 GGHSDLLGGVHAVRDAAVARQLRQDRVYLGTNIANL----EAYLLIRSMRTMEMRVVRQS 256
            G S+++GG   +   +      Q+  +      +L    +A +L  + R  E R +R +
Sbjct: 375 SGTSNVMGGSVLLNPDSSLYPYAQE-YFQSCEFEDLLWSEDAVVLEANSRDFEARTLRTN 433

Query: 257 TSATKVVAYLESHKAEFGGVLVKVFHSSLQTEPYVQQYLR-----GGNAPVFSILLRTVE 311
            +   ++  +     E G ++ KV++ ++ +E   + Y R     GG   +FSI     E
Sbjct: 434 ENTVNLLTKV--LLPEEGKLIKKVYYPTVSSEETFKNYERVRNRQGGYGCLFSIAFHNEE 491

Query: 312 QCKRLPSLLKLFHHATSLGGVESL----------IEWRAMSDTTVEQNLLRISVGCESPE 361
             K     LK+F    S G   +L           E   +++   + NL+R+SVG E  +
Sbjct: 492 DAKCFYDSLKVF-KGPSNGTNFTLACPYVHLAHHFELVEVAELGADPNLVRVSVGLEEFQ 550

Query: 362 DL 363
            L
Sbjct: 551 GL 552

>KLTH0D17930g Chr4 (1486259..1488217) [1959 bp, 652 aa] {ON} similar
           to uniprot|P47164 Saccharomyces cerevisiae YJR130C STR2
           Cystathionine gamma-synthase converts cysteine into
           cystathionine
          Length = 652

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 68/284 (23%), Positives = 119/284 (41%), Gaps = 32/284 (11%)

Query: 101 LFIGRGYHGCHGVADIWVRNHGLQKLSLEEVSERSEPGD---LVHIESPINPYGTLVDVX 157
           L I R ++  H + D      G QK S++++ +    G+    V +E+P NP   + D+ 
Sbjct: 361 LSILRKFNHTHFLGD------GDQK-SMDQLKDILHSGEQILAVFMEAPSNPLLKMGDLV 413

Query: 158 XXXXXXXXXXXYVVLDATFAPPPLQDRWEQGADVVVHSCTKYFGGHSDLLGGVHAVRDAA 217
                      Y+V+D T       D     AD+V  S TK F G S+++ G   +   +
Sbjct: 414 ELRELANAYGFYIVVDETAGGFVNIDVLPH-ADIVCSSLTKIFSGDSNVMAGSVVLNPRS 472

Query: 218 VARQLRQDRVYLGTNIANL----EAYLLIRSMRTMEMRVVRQSTSATKVVAYLESHKAEF 273
                 Q + +   +  +L    +A  L R+ R    R +  + +  +++   +    + 
Sbjct: 473 PLYPFAQ-QFFSSDSFEDLLWCEDAIYLERNSRDFATRTLTVNKNTQRLLE--DVLLPQE 529

Query: 274 GGVLVKVFHSSLQTEPYVQQY-----LRGGNAPVFSILLRTVEQCK---------RLPSL 319
           G +  K+F  SL +E   + Y      +GG   +FS+     EQ +         + PSL
Sbjct: 530 GKLFKKIFFPSLTSEETKRNYDVVLCPQGGYGGLFSLTFYREEQARVFFDVLELCKGPSL 589

Query: 320 LKLFHHATSLGGVESLIEWRAMSDTTVEQNLLRISVGCESPEDL 363
              F  A     +    E   ++   VE++L+R+SVG ES E L
Sbjct: 590 GTNFTLACPYAILAHYAELEEVAKYGVERSLVRVSVGLESAESL 633

>TPHA0L00330 Chr12 (43495..45648) [2154 bp, 717 aa] {ON} Anc_4.354
           YJR130C
          Length = 717

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 56/252 (22%), Positives = 96/252 (38%), Gaps = 33/252 (13%)

Query: 141 VHIESPINPYGTLVDVXXXXXXXXXXXXYVVLDATFAPPPLQDRWEQGADVVVHSCTKYF 200
           V IE P NP   + D+            Y+V+D T       D     AD+V  S ++ F
Sbjct: 456 VFIEIPSNPLLKVADLKYLRNLANIYGFYIVIDETLGGFVNIDVL-PFADIVCSSLSQSF 514

Query: 201 GGHSDLLGGVHAVRDAAVARQLRQDRVYLGTNIANLEAY-------LLIRSMRTMEMRVV 253
           GG S+++ G   +       Q  Q  ++L   +   E Y       +L R+ R    R +
Sbjct: 515 GGDSNVMAGSMVLNPQEKLYQFAQ--LFLN-QLGEYENYVWCEDAIILERNSRDFIPRSI 571

Query: 254 RQSTSATKVVAYLESHKAEFGGVLVKVFHSSLQTEPYVQQYLR-------------GGNA 300
             + ++  ++  +         +  K+++ SL ++   + Y +             GG  
Sbjct: 572 TINHNSEYLINEVLLPNEGPDKIFKKIYYPSLTSDETKENYDKLRCKKIPNFEKEEGGYG 631

Query: 301 PVFSILLRTVEQCKRL---------PSLLKLFHHATSLGGVESLIEWRAMSDTTVEQNLL 351
            + S+    ++  KR          PSL      A     +        +    VE+NL+
Sbjct: 632 GIISLTFHNLDTSKRFFDEINITKGPSLSTNHTLACPYTILSYFDNLAQVEKFGVEENLI 691

Query: 352 RISVGCESPEDL 363
           RI +GCES EDL
Sbjct: 692 RIKIGCESKEDL 703

>YML082W Chr13 (101862..103811) [1950 bp, 649 aa] {ON} Putative
           protein predicted to have carbon-sulfur lyase activity;
           transcriptionally regulated by Upc2p via an upstream
           sterol response element; green fluorescent protein
           (GFP)-fusion protein localizes to the nucleus and the
           cytoplasm; YML082W is not an essential gene
          Length = 649

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 59/240 (24%), Positives = 97/240 (40%), Gaps = 24/240 (10%)

Query: 141 VHIESPINPYGTLVDVXXXXXXXXXXXXYVVLDATFAPPPLQDRWEQGADVVVHSCTKYF 200
           V IE+P NP   + ++            ++++D T       D     AD+V  S TK F
Sbjct: 395 VFIETPSNPLLKMGNLLELKRLSELFGFFIIIDETVGGIVNIDGL-PFADIVCSSLTKTF 453

Query: 201 GGHSDLLGGVHAVRDAAVARQLRQDRVYLGTNIANL----EAYLLIRSMRTMEMRVVRQS 256
            G S+++GG   +   +   +     + L     +L    +A  L R+ R    R +R +
Sbjct: 454 SGDSNVIGGSMVLNPQSRVYEFASRFMQLEDEYEDLLWCEDAIYLERNSRDFIARTIRIN 513

Query: 257 TSATKVV-AYLESHKAEFGGVLVKVFHSSLQTEPYVQQY------LRGGNAPVFSILLRT 309
            S   ++   L+ H  E   +  K+++ +L ++  +  Y        GG   +FS+    
Sbjct: 514 YSTEYLLDKILKPHVGE-NKLFKKIYYPNLTSKETLTNYDMVRCKKEGGYGGLFSLTFHD 572

Query: 310 VEQCKRLPSLLKLFHHATSLGGVESLI----------EWRAMSDTTVEQNLLRISVGCES 359
            +        LKL +   SLG   +L           E        VE+NLLRISVG ES
Sbjct: 573 EDHAAAFYDNLKL-NKGPSLGTNFTLAFPYTLMTYYHELDMAEKFGVERNLLRISVGLES 631

>YLL058W Chr12 (23569..25296) [1728 bp, 575 aa] {ON} Putative
           protein of unknown function with similarity to Str2p,
           which is a cystathionine gamma-synthase important in
           sulfur metabolism; YLL058W is not an essential gene
          Length = 575

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 57/249 (22%), Positives = 103/249 (41%), Gaps = 25/249 (10%)

Query: 141 VHIESPINPYGTLVDVXXXXXXXXXXXXYVVLDATFAPPPLQDRWEQGADVVVHSCTKYF 200
           V +E+P NP   + D+            ++V+D T     L       AD+V  S TK F
Sbjct: 321 VFVETPSNPLLNMPDLKKLRSLADQYGFFIVIDDTIGG--LNVDILPYADIVSTSLTKLF 378

Query: 201 GGHSDLLGGVHAVRDAAVARQLRQDRVYLGTNIANL----EAYLLIRSMRTMEMRVVRQS 256
            G S+++GG   V +   +        +   N  +L    +A +L R+ R  E R +R +
Sbjct: 379 NGASNVMGG-SVVLNPKSSLYPYAREYFRSANFEDLLWCEDAIVLERNSRDFEDRTLRAN 437

Query: 257 TSATKVVAYLESHKAEFGGVLVKVFHSSLQTEPYVQQY-----LRGGNAPVFSILLRTVE 311
            +   ++  L     E G +  K+++ ++ ++   + Y      RGG   +FS+      
Sbjct: 438 ANTGILLNDL--LLPEEGKICKKIYYPTVTSKETFENYESVRNERGGYGCLFSVAFFNEG 495

Query: 312 QCKRLPSLLKLFHHATSLGGVESLI----------EWRAMSDTTVEQNLLRISVGCESPE 361
             K     LK+F   ++ G   +L           E   +S    + N++R+SVG E  +
Sbjct: 496 DAKAFYDSLKVFKGPSN-GTNFTLACPYVHLAHHSELEEVSKFGADPNIIRVSVGLEDIQ 554

Query: 362 DLIADLAGA 370
            L+   + A
Sbjct: 555 WLLKVFSSA 563

>Kwal_47.16644 s47 complement(41349..43307) [1959 bp, 652 aa] {ON}
           YJR130C (STR2) - Cystathionine gamma-synthase [contig
           376] FULL
          Length = 652

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 74/289 (25%), Positives = 115/289 (39%), Gaps = 28/289 (9%)

Query: 101 LFIGRGYHGCHGVADIWVRNHGLQKLSLEEVSERSEPGD---LVHIESPINPYGTLVDVX 157
           L I R ++  H + D      G +K S+E++ E    G+    V +E+P NP   + ++ 
Sbjct: 365 LSILRKFNHTHFLGD------GDEK-SMEQLKEILHSGEQILAVFMEAPSNPLLKMGNLI 417

Query: 158 XXXXXXXXXXXYVVLDATFAPPPLQDRWEQGADVVVHSCTKYFGGHSDLLGGVHAVRDAA 217
                      YVV+D T       D     AD+V  S TK F G S+++ G   +   +
Sbjct: 418 ELRELADAYGFYVVIDETAGGFVNIDVLPH-ADMVCSSLTKIFSGDSNVMAGSLVLNRKS 476

Query: 218 VARQLRQDRVYLGTNIANLEAYLLIRSMRTMEMRVVRQSTSATKVVAYLES-HKAEFGGV 276
                 Q   + G     L    +I   R     V R  T        LE     +   +
Sbjct: 477 PLYSFAQQFFHDGEFEDLLWCEDVIYLERNSRDFVTRTLTVNKNTAQLLEEVLIPQEKKL 536

Query: 277 LVKVFHSSLQTEPYVQQY-----LRGGNAPVFS----------ILLRTVEQCKRLPSLLK 321
             K+F+ SL +    + Y      +GG   +FS          +   T+E CK  PSL  
Sbjct: 537 FKKIFYPSLTSPETKRNYDAILCPKGGYGGLFSLTFYNEKQARVFFDTLELCKG-PSLGT 595

Query: 322 LFHHATSLGGVESLIEWRAMSDTTVEQNLLRISVGCESPEDLIADLAGA 370
            F  A     +    E   ++   VE++L+R+SVG ESP+ L A  + A
Sbjct: 596 NFTLACPYAILAHYTELEEVAKFGVERSLVRVSVGLESPQVLNAVFSRA 644

>KLTH0G00418g Chr7 complement(23130..24836) [1707 bp, 568 aa] {ON}
           similar to uniprot|Q12198 Saccharomyces cerevisiae
           YLL058W Hypothetical ORF
          Length = 568

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 58/242 (23%), Positives = 102/242 (42%), Gaps = 23/242 (9%)

Query: 141 VHIESPINPYGTLVDVXXXXXXXXXXXXYVVLDATFAPPPLQDRWEQGADVVVHSCTKYF 200
           V +E+P NP   + D+            ++V+D T     L       AD+V  S TK F
Sbjct: 320 VFLETPSNPMLNMPDLKQLRNMANEYGFFIVVDDTIGG--LNVDVLPYADIVCTSLTKLF 377

Query: 201 GGHSDLLGG--VHAVRDAAVARQLRQDRVYLGTNIANLE-AYLLIRSMRTMEMRVVRQST 257
            G S+++GG  +   + A  +  L+  R      +  LE A +L  + R  E R  R + 
Sbjct: 378 SGSSNVMGGSIILNPKSALYSCALQYFRGGEFEELLWLEDAIILEANSRDFEERTTRTNE 437

Query: 258 SATKVVAYLESHKAEFGGVLVKVFHSSLQTEPYVQQYLR-----GGNAPVFSILLRTVEQ 312
           +  K++   E    E G +  KV++ ++ ++   + +       GG   +FS+     E 
Sbjct: 438 NTMKLIQ--EVLLPEEGKIFKKVYYPTVSSKETFKNFESVRTNGGGYGSLFSLSFFNEED 495

Query: 313 CKRLPSLLKLFHHATSLGGVESL----------IEWRAMSDTTVEQNLLRISVGCESPED 362
            K+  + L +F    S G   +L           E   +S      +L+R+SVG E+ + 
Sbjct: 496 AKKFYNSLTVF-KGPSNGTNFTLACPYVHLAHHFELEEVSTFGAHSSLVRVSVGLENTQW 554

Query: 363 LI 364
           L+
Sbjct: 555 LL 556

>NCAS0A06270 Chr1 complement(1239445..1241424) [1980 bp, 659 aa]
           {ON} Anc_4.354
          Length = 659

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 55/243 (22%), Positives = 98/243 (40%), Gaps = 24/243 (9%)

Query: 141 VHIESPINPYGTLVDVXXXXXXXXXXXXYVVLDATFAPPPLQDRWEQGADVVVHSCTKYF 200
           V IE+P NP   + D+            ++V+D T       D     AD+V  S TK F
Sbjct: 407 VFIEAPSNPLLQMCDLIELQKLSEIYGFFIVVDETIGGFVNLDGLFH-ADIVCSSLTKVF 465

Query: 201 GGHSDLLGGVHAVRDAA----VARQLRQDRVYLGTNIANLEAYLLIRSMRTMEMRVVRQS 256
            G S+++ G   +   +     A+Q       +  +I   +   L ++ R    + +R +
Sbjct: 466 NGDSNVIAGSMVLNPKSKIYEFAQQFLNGPDGVTDSIWCEDLIYLEKNSRDFVAKTLRIN 525

Query: 257 TSATKVVAYLESHKAEFGGVLVKVFHSSLQTEPYVQQY------LRGGNAPVFSILLRTV 310
            +   ++  +   K   G +  ++++ S  +E   Q Y        GG   VFS+    +
Sbjct: 526 YTTEYLLDNV--FKPHVGKLFKRIYYPSQNSEEIKQNYEAIKCKKDGGYGGVFSVTFFQL 583

Query: 311 EQCKRLPSLLKLFHHATSLGGVESLI----------EWRAMSDTTVEQNLLRISVGCESP 360
           +Q K   + LKL    T LG   + +          E   + +  +E NL+R+ VG E+ 
Sbjct: 584 DQAKVFFNNLKLTKQIT-LGNNSTTVCPYTMLKHKDELERVKEYGLEDNLIRVCVGLENK 642

Query: 361 EDL 363
             L
Sbjct: 643 NTL 645

>Skud_12.10 Chr12 (10565..12280) [1716 bp, 571 aa] {ON} YLL058W
           (REAL)
          Length = 571

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 58/250 (23%), Positives = 104/250 (41%), Gaps = 25/250 (10%)

Query: 141 VHIESPINPYGTLVDVXXXXXXXXXXXXYVVLDATFAPPPLQDRWEQGADVVVHSCTKYF 200
           V +E+P NP   + ++            ++V+D T     L       AD+V  S TK F
Sbjct: 317 VFVETPSNPLLNMPNLKELRRLADAYGFFIVIDDTIGG--LNVDILPYADIVCTSLTKLF 374

Query: 201 GGHSDLLGGVHAVRDAAVARQLRQDRVYLGTNIANL----EAYLLIRSMRTMEMRVVRQS 256
            G S+++GG   V +   A   R    +      +L    +A +L R+ R  E R +R +
Sbjct: 375 NGASNVMGG-SVVLNPKSALYQRAREYFKSGEFEDLLWGEDAVVLERNSRDFEDRTLRAN 433

Query: 257 TSATKVVAYLESHKAEFGGVLVKVFHSSLQTEPYVQQY-----LRGGNAPVFSILLRTVE 311
           T+  K++   E    E G    K+++ ++ ++  +  Y      RGG   +FS+   +  
Sbjct: 434 TNTEKLLK--ELLLPEQGKTCKKIYYPTVNSKETINNYESVRNERGGYGCLFSVAFHSEG 491

Query: 312 QCKRLPSLLKLFHHATSLGGVESLI----------EWRAMSDTTVEQNLLRISVGCESPE 361
             +     LK+F    S G   +L           E   +S    + +++R+SVG E  +
Sbjct: 492 DAEAFYDSLKVF-KGPSNGTNFTLACPYVHLAHHSELEEVSKFGADSSIIRVSVGLEETQ 550

Query: 362 DLIADLAGAF 371
            L+   + A 
Sbjct: 551 LLLDVFSSAL 560

>Ecym_5169 Chr5 complement(353237..355282) [2046 bp, 681 aa] {ON}
           similar to Ashbya gossypii AER164C
          Length = 681

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 59/244 (24%), Positives = 103/244 (42%), Gaps = 27/244 (11%)

Query: 136 EPGDLVHIESPINPYGTLVDVXXXXXXXXXXXXYVVLDATFAPPPLQDRWEQGADVVVHS 195
           EP   V IE+P NP   + D+            YV++D T       D   Q AD+V  S
Sbjct: 422 EPILAVFIETPSNPLLKMGDLLELRKLADAYDFYVIIDDTIGGFINVDVL-QYADIVCSS 480

Query: 196 CTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTNIANL----EAYLLIRSMRTMEMR 251
            TK F G S+++ G   +  ++   +L + R +   +  +L    ++  L R+ R    R
Sbjct: 481 LTKIFSGDSNVMAGSLVLNPSSRLYKLAR-RFFASDDYEDLLWCEDSIYLERNSRDCVSR 539

Query: 252 VVRQSTSATKVVAYLESHKAEFGGVLV-KVFHSSLQTEPYVQQY------LRGGNAPVFS 304
            ++ + +A ++   L+       G L  K+++ SL +      Y        GG   +FS
Sbjct: 540 SMKINENAERL---LKGTLLPLEGTLFKKIYYPSLTSSETKANYDAVKCQPNGGYGGLFS 596

Query: 305 I----------LLRTVEQCKRLPSLLKLFHHATSLGGVESLIEWRAMSDTTVEQNLLRIS 354
           +             +++ CK  PSL   F  A     +    E   ++   +E+NL+R+S
Sbjct: 597 LTFFDDECAKAFFNSLDLCKG-PSLGTNFTLACPYTILAHYGEMDVVAKYGLEKNLVRVS 655

Query: 355 VGCE 358
           +G E
Sbjct: 656 IGLE 659

>CAGL0D06402g Chr4 (602973..604301) [1329 bp, 442 aa] {ON} highly
           similar to uniprot|P06106 Saccharomyces cerevisiae
           YLR303w MET25 O-acetylhomoserine sulfhydrylase
          Length = 442

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 99/439 (22%), Positives = 171/439 (38%), Gaps = 94/439 (21%)

Query: 12  DDNSNRVNDVAPPINVTTTFRYSEDDLIPAVERTADTAGSN--GHFYSRVSHP-NGARCE 68
           DDN++R   V  PI  TT+F +++       +  A   G    G+ YSR  +P N    E
Sbjct: 18  DDNNHRPRAV--PIYSTTSFVFNDS------QHGAQLFGLEVPGYIYSRFQNPTNNVLEE 69

Query: 69  VLLAEALGGEAVVYSSGLAAFG---AALTHFNPKRLFIGRGYHGCHGVADIWVRNHGLQK 125
            + A   G  A+  SSG AA     A L H     +     Y G +    +  +  G++ 
Sbjct: 70  RIAALEGGAAALAVSSGQAAQTLAVAGLAHNGDNIVSTSFLYGGTYNQFKVAFKRLGIEA 129

Query: 126 LSLE----EVSER--SEPGDLVHIESPINPYGTLVDVXXXXXXXXXXXXYVVLDATFAP- 178
             +E    E  E+   E    V++ES  NP   + D              VV+D TF   
Sbjct: 130 RFVEGDKPEDFEKLFDERTKAVYLESIGNPKYNVPDFENIVAVAHKHGIPVVVDNTFGAG 189

Query: 179 ----PPLQDRWEQGADVVVHSCTKY--------------------------FGGHSDLLG 208
                P++     GAD+V HS TK+                          F   S    
Sbjct: 190 GFFCQPIK----YGADIVTHSATKWIGGHGTTIGGIIVDSGKFPWKDYPEKFPQFSKPAE 245

Query: 209 GVHAV------RDAAVARQLRQDRVY-LGTNIANLEAYLLIRSMRTMEMRVVRQSTSATK 261
           G H         + A    +R + +  LG  ++   A+LL++ + T+ +R  R   +A  
Sbjct: 246 GYHGTVYNETYGNLAYIVHVRTELLRDLGPGMSPFAAFLLLQGVETLSLRGERHGQNALA 305

Query: 262 VVAYLESHK----AEFGGVLVKVFHSSLQTEPYVQQYLRGGNAPVFSILLRTVEQCKR-- 315
           +  +LE +       + G+     H +       ++YL  G   V S  ++ +    +  
Sbjct: 306 LAKWLEKNPHVAWVSYPGLPSHSHHEN------AKKYLSNGFGGVLSFGVKDLPNADKET 359

Query: 316 ---------LPSLLKLFHHATSLGGVESLI------EWRAMSD-----TTVEQNLLRISV 355
                    +   LK+  +  ++G  ++L+        + +SD     + V ++L+R+SV
Sbjct: 360 DPFKLAGAQVVDNLKIASNLANVGDSKTLVIAPYFTTHQQLSDPEKLASGVTKDLIRVSV 419

Query: 356 GCESPEDLIADLAGAFRQL 374
           G E  +D+IAD   +F ++
Sbjct: 420 GTEFIDDIIADFEQSFAKV 438

>Skud_13.59 Chr13 (101194..103143) [1950 bp, 649 aa] {ON} YML082W
           (REAL)
          Length = 649

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 65/252 (25%), Positives = 96/252 (38%), Gaps = 40/252 (15%)

Query: 141 VHIESPINPYGTLVDVXXXXXXXXXXXXYVVLDATFAPPPLQDRWEQGADVVVHSCTKYF 200
           V IE+P NP   + ++            ++++D T       D     AD+V  S TK F
Sbjct: 395 VFIETPSNPLLKMGNLLELKRLSELFGFFIIIDETVGGIVNIDGL-PFADIVCSSLTKTF 453

Query: 201 GGHSDLLGGVHAVRDAAVARQLRQDRVY-LGTNIANLE-----------AYLLIRSMRTM 248
            G S+++GG   +          Q RVY   T    LE           A  L R+ R  
Sbjct: 454 SGDSNVIGGSMVLNP--------QSRVYEFATRFMRLEDEYEDLLWCEDAIYLERNSRDF 505

Query: 249 EMRVVRQSTSATKVVAYLESHKAEFGG--VLVKVFHSSLQTEPYVQQY------LRGGNA 300
             R VR + S   ++  +   K   GG  +  K+++ +L ++  +  Y        GG  
Sbjct: 506 IARTVRINYSTEYLLDKI--LKPHVGGNELFKKIYYPNLTSKETLTNYDMVRCKKEGGYG 563

Query: 301 PVFSILLRTVE---------QCKRLPSLLKLFHHATSLGGVESLIEWRAMSDTTVEQNLL 351
            +FS+               Q  + PSL   F  A     +    E        VE+NLL
Sbjct: 564 GLFSLTFHDEHHAAAFYDNLQLNKGPSLGTNFTLAFPYTLMTYYQELAMAEKFGVERNLL 623

Query: 352 RISVGCESPEDL 363
           RISVG ES   L
Sbjct: 624 RISVGLESQSTL 635

>Suva_13.68 Chr13 (103103..105169) [2067 bp, 688 aa] {ON} YML082W
           (REAL)
          Length = 688

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 60/248 (24%), Positives = 99/248 (39%), Gaps = 40/248 (16%)

Query: 141 VHIESPINPYGTLVDVXXXXXXXXXXXXYVVLDATFAPPPLQDRWEQGADVVVHSCTKYF 200
           V IE+P NP   + ++            ++++D T       D     AD+V  S TK F
Sbjct: 434 VFIETPSNPLLKMGNLVELKRLSELFGFFIIIDETVGGIVNIDGL-PFADLVCSSLTKTF 492

Query: 201 GGHSDLLGGVHAVRDAAVARQLRQDRVY-LGTNIANLE-----------AYLLIRSMRTM 248
            G S+++GG   +          Q RVY   T    LE           A  L R+ R  
Sbjct: 493 SGDSNVIGGSMVLNP--------QSRVYEFATRFMQLEDEYEDLLWCEDAIYLERNSRDF 544

Query: 249 EMRVVRQSTSATKVV-AYLESHKAEFGGVLVKVFHSSLQTEPYVQQY------LRGGNAP 301
             R +R + +   ++   ++ H  E   +  K+++ +L ++  +  Y        GG   
Sbjct: 545 IARTIRINYNTEYLLDKIIKPHVGE-NALFKKIYYPNLTSKETLTNYDMVRCKKEGGYGG 603

Query: 302 VFSILLRTVEQCKRLPSLLKLFHHATSLGGVESLI----------EWRAMSDTTVEQNLL 351
           +FS+     +  +     L+L +   SLG   +L+          E        VE+NLL
Sbjct: 604 LFSLTFHDEDHAEAFYDNLQL-NKGPSLGTNFTLVFPYTLMTYYHEMAMAEKFGVERNLL 662

Query: 352 RISVGCES 359
           RISVG E+
Sbjct: 663 RISVGLEN 670

>Smik_12.3 Chr12 (6081..7781) [1701 bp, 566 aa] {ON} YLL058W (REAL)
          Length = 566

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 49/201 (24%), Positives = 87/201 (43%), Gaps = 23/201 (11%)

Query: 189 ADVVVHSCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTNIANL----EAYLLIRS 244
           AD+V  S TK F G S+++GG   +   +      ++  +   +  +L    +A +L R+
Sbjct: 358 ADIVCTSLTKLFNGASNVMGGSIVLNPKSSIYPYARE-YFKSADFEDLLWCEDAVVLERN 416

Query: 245 MRTMEMRVVRQSTSATKVVAYLESHKAEFGGVLVKVFHSSLQTEPYVQQY-----LRGGN 299
            R  E R +  + +  K++   E    E G +  KV++ ++ +E   + Y      RGG 
Sbjct: 417 SRDFENRTLHANANTEKLLN--EVLIPEQGKLCKKVYYPTVTSEETFRNYESVRNERGGY 474

Query: 300 APVFSILLRTVEQCKRLPSLLKLFHHATSLGGVESLI----------EWRAMSDTTVEQN 349
             +FS+        K     LK+F    S G   +L           E  A+S    + N
Sbjct: 475 GCLFSVAFYNEGDAKAFYDSLKVF-KGPSNGTNFTLACPYVHLAHHSELEAVSKFGADPN 533

Query: 350 LLRISVGCESPEDLIADLAGA 370
           ++R+SVG E  + L+   + A
Sbjct: 534 IIRVSVGLEDTQWLLEVFSNA 554

>KLLA0B04378g Chr2 (390701..392767) [2067 bp, 688 aa] {ON} similar
           to uniprot|P47164 Saccharomyces cerevisiae YJR130C STR2
           Cystathionine gamma-synthase converts cysteine into
           cystathionine
          Length = 688

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 57/244 (23%), Positives = 93/244 (38%), Gaps = 22/244 (9%)

Query: 141 VHIESPINPYGTLVDVXXXXXXXXXXXXYVVLDATFAPPPLQDRWEQGADVVVHSCTKYF 200
           V IESP NP   + D+            Y+V+D T       D     ADVV  S TK F
Sbjct: 431 VFIESPSNPLLKMGDLVELKRLSDLYGFYIVIDETVGGFLNIDVLPY-ADVVCSSLTKIF 489

Query: 201 GGHSDLLGGVHAVRDAAVARQLRQDRVYLGTN-----IANLEAYLLIRSMRTMEMRVVRQ 255
            G S+++ G   +   +   +     ++L        +   +A  L R+ R    R +  
Sbjct: 490 SGDSNVMAGSIVLNPRSRLYEFATTMLHLTEKWYEDLLWCEDAICLERNSRDFISRSILV 549

Query: 256 STSATKVVAYLESHKAEFGGVLVKVFHSSLQTEPYVQQYLR-------GGNAPVFSILLR 308
           + +   ++  +   +   G +  KVF+         + Y +        G   +FS+   
Sbjct: 550 NENTESLLEKVILPQQGEGKLFKKVFYPKYTNAETKKNYDQVKAKTAGSGYGGLFSVTFY 609

Query: 309 TVEQCKRL---------PSLLKLFHHATSLGGVESLIEWRAMSDTTVEQNLLRISVGCES 359
            +EQ K           PSL   F  A     +    E   ++   +E NL+R+SVG ES
Sbjct: 610 NIEQAKMFFNSLNLCKGPSLGTNFTLACPYTVLAHYQEMEEVAKFGLEDNLVRVSVGLES 669

Query: 360 PEDL 363
            + L
Sbjct: 670 KQHL 673

>Kwal_26.7197 s26 (258929..259192) [264 bp, 87 aa] {OFF} YAL012W
           (CYS3) - cystathionine gamma-lyase [contig 47] FULL
          Length = 87

 Score = 38.1 bits (87), Expect = 0.003,   Method: Composition-based stats.
 Identities = 24/65 (36%), Positives = 35/65 (53%), Gaps = 11/65 (16%)

Query: 318 SLLKLFHHATSLGGVESLIEWRAM-----------SDTTVEQNLLRISVGCESPEDLIAD 366
           S  +LF  A SLGG+ESL+E  A+             + V  +L+R+SVG E  +DL+ D
Sbjct: 18  STTRLFTLAESLGGIESLLEVPAVMTHGGIPKDQREASGVYDDLIRLSVGIEDTDDLLDD 77

Query: 367 LAGAF 371
           +  A 
Sbjct: 78  IKNAL 82

>Suva_10.8 Chr10 (9213..10931) [1719 bp, 572 aa] {ON} YLL058W (REAL)
          Length = 572

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 55/249 (22%), Positives = 98/249 (39%), Gaps = 25/249 (10%)

Query: 141 VHIESPINPYGTLVDVXXXXXXXXXXXXYVVLDATFAPPPLQDRWEQGADVVVHSCTKYF 200
           V +E+P NP   + D+            ++V+D T     L       AD+V  S TK F
Sbjct: 318 VFVETPSNPLLNMPDLKELRRLADAYGFFIVVDDTIGG--LNVDVLPYADIVCTSLTKLF 375

Query: 201 GGHSDLLGGVHAVRDAAVARQLRQDRVYLGTNIANL----EAYLLIRSMRTMEMRVVRQS 256
            G S+ +GG   + +   +        +      +L    +A +L  + R  + R +R +
Sbjct: 376 NGSSNAMGG-SIILNPKSSLYSSACEYFKSAEFEDLLWCEDAVVLEANSRDFQDRTLRAN 434

Query: 257 TSATKVVAYLESHKAEFGGVLVKVFHSSLQTEPYVQQY-----LRGGNAPVFSILLRTVE 311
            +  K++   E    E G +  K+++ ++ ++     Y       GG   +FS+      
Sbjct: 435 INTEKLLN--EVLLPEEGKICKKIYYPTVSSKETFNNYESVRNKHGGYGCLFSMAFYNEG 492

Query: 312 QCKRLPSLLKLFHHATSLGGVESLI----------EWRAMSDTTVEQNLLRISVGCESPE 361
             K     LK+F    S G   +L           E   +S    + NL+R+SVG E  +
Sbjct: 493 DAKTFYDTLKVF-KGPSNGTNFTLACPYVHLAHHSELEEVSKFGADPNLIRVSVGLEDTQ 551

Query: 362 DLIADLAGA 370
            L+   + A
Sbjct: 552 TLLDVFSSA 560

>TDEL0E05620 Chr5 complement(1043585..1044925) [1341 bp, 446 aa]
           {ON} Anc_4.53 YLR303W
          Length = 446

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 105/452 (23%), Positives = 173/452 (38%), Gaps = 98/452 (21%)

Query: 2   VELCTSLIHADDNSNRVNDVAPPINVTTTFRYSEDDLIPAVERTADTAG--SNGHFYSRV 59
           V+L     + DDN+NR   V  PI  TT++ +++       +  +   G  + G+ YSR+
Sbjct: 8   VQLHAGQENPDDNANRPRAV--PIYATTSYVFNDS------KHGSQLFGLETPGYIYSRI 59

Query: 60  SHPNGARCEV-LLAEALGGEAVVYSSGLAAFGAA---LTHFNPKRLFIGRGYHGCHGVAD 115
            +P     E  + A   G  A+  +SG A+   A   L H     +     Y G +    
Sbjct: 60  MNPTVDVLEKRIAALEGGAAALAVASGQASQALAISGLAHTGDNIVATSFLYGGTYNQFK 119

Query: 116 IWVRNHGLQKLSLE----EVSER--SEPGDLVHIESPINPYGTLVDVXXXXXXXXXXXXY 169
           +  +  G++   +E    E  E+   E    V++E+  NP   + D              
Sbjct: 120 VAFKRLGIETRFVEGDNPEDFEKVFDERTKAVYLETIGNPKYNVPDFDRIVEVAHKHGIP 179

Query: 170 VVLDATF-APPPLQDRWEQGADVVVHSCTKY--------------------------FGG 202
           VV+D TF A        + GAD+V HS TK+                          F  
Sbjct: 180 VVVDNTFGAGGFFAQPIKYGADIVTHSATKWIGGHGTTIGGIIVDSGKFPWKDYPEKFPQ 239

Query: 203 HSDLLGGVHAV--RDAA--------VARQLRQDRVYLGTNIANLEAYLLIRSMRTMEMRV 252
            S    G H +   DA         V  +L +D   LG  +    A+ L++ + T+ +R 
Sbjct: 240 FSIPSEGYHGMIFNDAFGPLAFIGHVRTELLRD---LGPALNPFAAFQLLQGVETLSLRA 296

Query: 253 VRQSTSATKVVAYLESHK----AEFGGVLVKVFHSSLQTEPYVQQYLRGGNAPVFSI--- 305
            R   +A K+ A+LE         + G+     H +       ++YL  G   V S    
Sbjct: 297 ERHGENALKLAAWLEQSPYVSWVSYPGLPSHSHHEN------AKKYLTNGFGGVLSFGAK 350

Query: 306 -LLRTVEQCKRLP---------SLLKLFHHATSLGGVESLI-------------EWRAMS 342
            L    E   + P           LKL  +  ++G  ++L+             E +A S
Sbjct: 351 DLPNNAEAEAKNPFAAAGAKVVDNLKLASNLANVGDCKTLVIAPYFTTHLQLTHEEKASS 410

Query: 343 DTTVEQNLLRISVGCESPEDLIADLAGAFRQL 374
             T  ++L+R+SVG E  +D+I D   +F Q+
Sbjct: 411 GVT--KDLIRVSVGTEFIDDIINDFQQSFEQV 440

>Suva_10.397 Chr10 (693647..694981) [1335 bp, 444 aa] {ON} YLR303W
           (REAL)
          Length = 444

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 63/294 (21%), Positives = 113/294 (38%), Gaps = 66/294 (22%)

Query: 141 VHIESPINPYGTLVDVXXXXXXXXXXXXYVVLDATF-APPPLQDRWEQGADVVVHSCTKY 199
           V++E+  NP   + D              VV+D TF A        + GAD+V HS TK+
Sbjct: 151 VYLETIGNPKYNVPDFEKIVAIAHKHGIPVVVDNTFGAGGYFCQPIKYGADIVTHSATKW 210

Query: 200 --------------------------FGGHSDLLGGVH------AVRDAAVARQLRQDRV 227
                                     F   S    G H      A  + A    +R + +
Sbjct: 211 IGGHGTTIGGIIVDSGKFPWKDYPEKFPQFSQPAEGYHGTIYNEAYGNLAYIVHVRTELL 270

Query: 228 Y-LGTNIANLEAYLLIRSMRTMEMRVVRQSTSATKVVAYLESHK----AEFGGVLVKVFH 282
             LG  +    ++LL++ + T+ +R  R   +A K+  +LE         + G+     H
Sbjct: 271 RDLGPLMNPFASFLLLQGVETLSLRAERHGENALKLAKWLEQSPYVSWVSYPGLASHSHH 330

Query: 283 SSLQTEPYVQQYLRGGNAPVFSILLRTVEQCKR-----------LPSLLKLFHHATSLGG 331
            +       ++YL  G   V S  ++ +    +           +   LKL  +  ++G 
Sbjct: 331 EN------AKKYLSNGFGGVLSFGVKDLPNADKETDPFKLSGAQVVDSLKLASNLANVGD 384

Query: 332 VESLI------EWRAMSDTT-----VEQNLLRISVGCESPEDLIADLAGAFRQL 374
            ++L+        + ++DT      V ++L+R+SVG E  +D+IAD   +F  +
Sbjct: 385 AKTLVIAPYFTTHKQLNDTEKLASGVTKDLIRVSVGIEFIDDIIADFQQSFETV 438

>ZYRO0B08338g Chr2 complement(649933..651855) [1923 bp, 640 aa] {ON}
           similar to uniprot|P47164 Saccharomyces cerevisiae
           YJR130C STR2 Cystathionine gamma-synthase converts
           cysteine into cystathionine
          Length = 640

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 62/254 (24%), Positives = 106/254 (41%), Gaps = 49/254 (19%)

Query: 141 VHIESPINPYGTLVDVXXXXXXXXXXXXYVVLDATFAPPPLQDRWEQGADVVVHSCTKYF 200
           + +E+P NP   + D+            Y+V+D T A   +       AD+V  S TK F
Sbjct: 390 LFMEAPSNPLLKMGDLIELRELANSFGFYIVVDDT-AGGFVNIDVLPFADIVCSSLTKIF 448

Query: 201 GGHSDLLGG---------VHAVRDAAVARQLR-----QDRVYLGTNIANLEAYLLIRSMR 246
            G S+++ G         +++  +  + +Q       +D +YL  N  +  A       R
Sbjct: 449 SGDSNVIAGSIVLNPQSKLYSFAETFMEQQYEDCLWCEDALYLERNSRDFVA-------R 501

Query: 247 TMEMRVVRQSTSA--TKVVAYLESHKAEFGGVLVKVFHSSLQTEPYVQQY-----LRGGN 299
           T++   V Q+T     KV+   E      G +  K+++ SL ++   + Y      +GG 
Sbjct: 502 TLK---VNQNTERLLNKVLLPQE------GKLFKKIYYPSLTSKETKKNYDAVRGHQGGY 552

Query: 300 APVFSI----------LLRTVEQCKRLPSLLKLFHHATSLGGVESLIEWRAMSDTTVEQN 349
             +FS+             T++ CK  PSL   F  A     +    E   ++   VE N
Sbjct: 553 GGLFSLTFYNLDSAKTFFNTLQLCKG-PSLGTNFTLACPYAIIAHYQELDRVAKYGVESN 611

Query: 350 LLRISVGCESPEDL 363
           L+R+SVG E  ++L
Sbjct: 612 LVRVSVGLEREDEL 625

>CAGL0M00550g Chr13 (66078..67787) [1710 bp, 569 aa] {ON} similar to
           uniprot|P47164 Saccharomyces cerevisiae YJR130c STR2
          Length = 569

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 61/250 (24%), Positives = 101/250 (40%), Gaps = 23/250 (9%)

Query: 141 VHIESPINPYGTLVDVXXXXXXXXXXXXYVVLDATFAPPPLQDRWEQGADVVVHSCTKYF 200
           V +E+P NP   + D+            ++V+D T +     D      D+V  S TK F
Sbjct: 318 VFLEAPSNPLLKMCDMSKLKQLSQQYGFFIVVDETVSGFVNIDILSY-CDIVCSSLTKIF 376

Query: 201 GGHSDLLGGVHAVRDAAVARQLRQDRVYLGTNIANL----EAYLLIRSMRTMEMRVVRQS 256
            G S+++ G   V  A+       D +       +L    ++  L R+ R    R  + +
Sbjct: 377 SGDSNVIAGSLVVNPASKLHDFAIDFLNDPKRNEDLLWCEDSVYLERNSRDFIDRAQKIN 436

Query: 257 TSATKVVAYLESHKAEFGGVLVKVFHSSLQTEPYVQQY-----LRGGNAPVFSILLRTVE 311
             A  +V+ +   +     +L K+++ SL +      Y       GG   + SI+ +  +
Sbjct: 437 KIAEDLVSTVLLEEEG--QLLEKIYYPSLTSPESKLNYDSVKCNNGGYGGLISIVFKRED 494

Query: 312 QCKRLPSLLKLFHHATSLGGVESLI----------EWRAMSDTTVEQNLLRISVGCESPE 361
           Q K     L L +   SLG   +L+          E   ++   V +NL+RISVG ES E
Sbjct: 495 QAKVFYDNLSL-NKGPSLGTNFTLVCPYAILAHYAELDEVAKYGVVKNLVRISVGLESLE 553

Query: 362 DLIADLAGAF 371
            L      AF
Sbjct: 554 TLQTIFRKAF 563

>Skud_12.384 Chr12 (673748..675082) [1335 bp, 444 aa] {ON} YLR303W
           (REAL)
          Length = 444

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 99/449 (22%), Positives = 171/449 (38%), Gaps = 94/449 (20%)

Query: 2   VELCTSLIHADDNSNRVNDVAPPINVTTTFRYSEDDLIPAVERTADTAGSN--GHFYSRV 59
           V+L     +A DN++R   V  PI  TT++ +         +  +   G    G+ YSR 
Sbjct: 8   VQLHAGQENAGDNAHRSRAV--PIYATTSYVFENS------KHGSQLFGLEVPGYVYSRF 59

Query: 60  SHPNGARCEV-LLAEALGGEAVVYSSGLAAFGAA---LTHFNPKRLFIGRGYHGCHGVAD 115
            +P     E  + A   G  A+  SSG AA   A   L H     +     Y G +    
Sbjct: 60  QNPTSNVLEERIAALEGGAAALAVSSGQAAQTLAIQGLAHTGDNIVSTSYLYGGTYNQFK 119

Query: 116 IWVRNHGLQKLSLE----EVSER--SEPGDLVHIESPINPYGTLVDVXXXXXXXXXXXXY 169
           I  +  G++   +E    E  E+   E    V++E+  NP   + D              
Sbjct: 120 ISFKRFGIEARFVEGDNPEDFEKVFDERTKAVYLETIGNPKYNVPDFEKIVAIAHKHGIP 179

Query: 170 VVLDATFAP-----PPLQDRWEQGADVVVHSCTKY------------------------- 199
           VV+D TF        P++     GAD+V HS TK+                         
Sbjct: 180 VVVDNTFGAGGYFCQPIK----YGADIVTHSATKWIGGHGTTIGGIIVDSGKFPWKDYPE 235

Query: 200 -FGGHSDLLGGVH------AVRDAAVARQLRQDRVY-LGTNIANLEAYLLIRSMRTMEMR 251
            F   S    G H      A  + A    +R + +  LG  +    ++LL++ + T+ +R
Sbjct: 236 KFPQFSQPAEGYHGTIYNEAYGNLAYIVHVRTELLRDLGPLMNPFASFLLLQGVETLSLR 295

Query: 252 VVRQSTSATKVVAYLESHK----AEFGGVLVKVFHSSLQTEPYVQQYLRGGNAPVFSILL 307
             R   +A K+  +LE         + G+     H +       ++YL  G   V S  +
Sbjct: 296 AERHGENALKLAKWLEESPYVSWVSYPGLASHSHHEN------AKKYLSNGFGGVLSFGV 349

Query: 308 RTVEQCKR-----------LPSLLKLFHHATSLGGVESLI------EWRAMSD-----TT 345
           + +    +           +   LKL  +  ++G  ++L+        + ++D     + 
Sbjct: 350 KDLPNADKETDPFKLSGAQVVDNLKLASNLANVGDAKTLVIAPYFTTHKQLNDKEKLASG 409

Query: 346 VEQNLLRISVGCESPEDLIADLAGAFRQL 374
           V ++L+R+SVG E  +D+IAD   +F  +
Sbjct: 410 VTKDLIRVSVGIEFIDDIIADFQQSFETV 438

>Kpol_1028.80 s1028 (179685..181754) [2070 bp, 689 aa] {ON}
           (179685..181754) [2070 nt, 690 aa]
          Length = 689

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 53/252 (21%), Positives = 99/252 (39%), Gaps = 33/252 (13%)

Query: 141 VHIESPINPYGTLVDVXXXXXXXXXXXXYVVLDATFAPPPLQDRWEQGADVVVHSCTKYF 200
           V +E+P NP   + D+            Y+++D T       D     AD+V  S TK F
Sbjct: 428 VFVETPSNPLLKMPDLAHLRRLANLYGFYIIIDETMGGFVNIDVLPY-ADIVCSSLTKIF 486

Query: 201 GGHSDLLGGVHAVRDAAVARQLRQDRVYLGTNIANLEAYL-------LIRSMRTMEMRVV 253
            G S+++ G   +          Q  V++ + +   E +L       L R+ R    R +
Sbjct: 487 SGSSNVIAGSMVLNPQEKLYSFAQ--VFM-SQLGEYEDHLWCEDAIYLERNSRDFIARTI 543

Query: 254 RQSTSATKVVAYLESHKAEFGGVLVKVFHSSLQTEPYVQQY-------------LRGGNA 300
           + + +   ++  +   +     +  K+F+ SL +      Y               GG  
Sbjct: 544 KTNQNTEFLLKKVLLAQEGPSKLFKKIFYPSLTSAESKVNYDAVRCKSIDKDSDEEGGYG 603

Query: 301 PVFSILLRTVEQCK---------RLPSLLKLFHHATSLGGVESLIEWRAMSDTTVEQNLL 351
            +FS+    +EQ K         + PSL   F  +     +    +   ++   VE++L+
Sbjct: 604 GLFSLAFNKIEQAKIFFNELNLSKGPSLGTNFTLSCPYTVLMYYDKLDEVAKYEVEESLV 663

Query: 352 RISVGCESPEDL 363
           R+S+G ES ++L
Sbjct: 664 RVSIGIESQDEL 675

>YLR303W Chr12 (732542..733876) [1335 bp, 444 aa] {ON}
           MET17Methionine and cysteine synthase (O-acetyl
           homoserine-O-acetyl serine sulfhydrylase), required for
           sulfur amino acid synthesis
          Length = 444

 Score = 38.9 bits (89), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 87/390 (22%), Positives = 148/390 (37%), Gaps = 76/390 (19%)

Query: 53  GHFYSRVSHPNGARCEV-LLAEALGGEAVVYSSGLAAFGAA---LTHFNPKRLFIGRGYH 108
           G+ YSR  +P     E  + A   G  A+  SSG AA   A   L H     +     Y 
Sbjct: 53  GYVYSRFQNPTSNVLEERIAALEGGAAALAVSSGQAAQTLAIQGLAHTGDNIVSTSYLYG 112

Query: 109 GCHGVADIWVRNHGLQKLSLE----EVSER--SEPGDLVHIESPINPYGTLVDVXXXXXX 162
           G +    I  +  G++   +E    E  E+   E    V++E+  NP   + D       
Sbjct: 113 GTYNQFKISFKRFGIEARFVEGDNPEEFEKVFDERTKAVYLETIGNPKYNVPDFEKIVAI 172

Query: 163 XXXXXXYVVLDATF-APPPLQDRWEQGADVVVHSCTKY---------------------- 199
                  VV+D TF A        + GAD+V HS TK+                      
Sbjct: 173 AHKHGIPVVVDNTFGAGGYFCQPIKYGADIVTHSATKWIGGHGTTIGGIIVDSGKFPWKD 232

Query: 200 ----FGGHSDLLGGVH------AVRDAAVARQLRQDRVY-LGTNIANLEAYLLIRSMRTM 248
               F   S    G H      A  + A    +R + +  LG  +    ++LL++ + T+
Sbjct: 233 YPEKFPQFSQPAEGYHGTIYNEAYGNLAYIVHVRTELLRDLGPLMNPFASFLLLQGVETL 292

Query: 249 EMRVVRQSTSATKVVAYLESHK----AEFGGVLVKVFHSSLQTEPYVQQYLRGGNAPVFS 304
            +R  R   +A K+  +LE         + G+     H +       ++YL  G   V S
Sbjct: 293 SLRAERHGENALKLAKWLEQSPYVSWVSYPGLASHSHHEN------AKKYLSNGFGGVLS 346

Query: 305 ILLRTVEQCKR-----------LPSLLKLFHHATSLGGVESLI------EWRAMSD---- 343
             ++ +    +           +   LKL  +  ++G  ++L+        + ++D    
Sbjct: 347 FGVKDLPNADKETDPFKLSGAQVVDNLKLASNLANVGDAKTLVIAPYFTTHKQLNDKEKL 406

Query: 344 -TTVEQNLLRISVGCESPEDLIADLAGAFR 372
            + V ++L+R+SVG E  +D+IAD   +F 
Sbjct: 407 ASGVTKDLIRVSVGIEFIDDIIADFQQSFE 436

>Smik_12.383 Chr12 (670676..672010) [1335 bp, 444 aa] {ON} YLR303W
           (REAL)
          Length = 444

 Score = 38.9 bits (89), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 62/292 (21%), Positives = 112/292 (38%), Gaps = 66/292 (22%)

Query: 141 VHIESPINPYGTLVDVXXXXXXXXXXXXYVVLDATF-APPPLQDRWEQGADVVVHSCTKY 199
           V++E+  NP   + D              VV+D TF A        + GAD+V HS TK+
Sbjct: 151 VYLETIGNPKYNVPDFEKIVAIAHKHGIPVVVDNTFGAGGYFCQPIKYGADIVTHSATKW 210

Query: 200 --------------------------FGGHSDLLGGVH------AVRDAAVARQLRQDRV 227
                                     F   S    G H      A  + A    +R + +
Sbjct: 211 IGGHGTTIGGIIVDSGKFPWKDYPEKFPQFSQPAEGYHGTIYNEAYGNLAYIVHVRTELL 270

Query: 228 Y-LGTNIANLEAYLLIRSMRTMEMRVVRQSTSATKVVAYLESHK----AEFGGVLVKVFH 282
             LG  +    ++LL++ + T+ +R  R   +A K+  +LE         + G+     H
Sbjct: 271 RDLGPLMNPFASFLLLQGVETLSLRAERHGENALKLAKWLEQSPYVSWVSYPGLASHSHH 330

Query: 283 SSLQTEPYVQQYLRGGNAPVFSILLRTVEQCKR-----------LPSLLKLFHHATSLGG 331
            +       ++YL  G   V S  ++ +    +           +   LKL  +  ++G 
Sbjct: 331 EN------AKKYLSNGFGGVLSFGVKDLPNADKETDPFKLSGAQVVDNLKLASNLANVGD 384

Query: 332 VESLI------EWRAMSD-----TTVEQNLLRISVGCESPEDLIADLAGAFR 372
            ++L+        + ++D     + V ++L+R+SVG E  +D+IAD   +F 
Sbjct: 385 AKTLVIAPYFTTHKQLNDKEKLASGVTKDLIRVSVGIEFIDDIIADFQQSFE 436

>TDEL0D00610 Chr4 (109396..111354) [1959 bp, 652 aa] {ON} Anc_4.354
           YJR130C
          Length = 652

 Score = 38.9 bits (89), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 59/259 (22%), Positives = 102/259 (39%), Gaps = 30/259 (11%)

Query: 128 LEEVSERSEPGDLVHIESPINPYGTLVDVXXXXXXXXXXXXYVVLDATFAPPPLQDRWEQ 187
           L+++ +  E    V +E+P NP   + D+            ++V+D T       D    
Sbjct: 384 LKKILQSGEQILAVFMEAPSNPLLKMGDLLELRQLANLYGFFIVVDETAGGFVNIDVLPH 443

Query: 188 GADVVVHSCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTNIANL----EAYLLIR 243
            ADVV  S TK F G S+L+ G   +          Q  +       +     +A  L R
Sbjct: 444 -ADVVCSSLTKIFSGDSNLIAGSLVLNPQGKLYDFAQQWLLAQKEYEDTLWCEDALALER 502

Query: 244 SMRTMEMRVVRQSTSA----TKVVAYLESHKAEFGGVLVKVFHSSLQTEPYVQQY----- 294
           + R    R ++ + +      KV+  LE      G +  K+++ SL +    + Y     
Sbjct: 503 NSRDFVQRTIQVNHNTEYLLNKVLIPLE------GKLFKKIYYPSLTSPETKRHYDAVKC 556

Query: 295 -LRGGNAPVFSILLRTVEQCK---------RLPSLLKLFHHATSLGGVESLIEWRAMSDT 344
            +  G   +FS+    + Q +         + PSL   F  A     +    E   ++  
Sbjct: 557 SIDAGYGGLFSLTFFNLAQARVFFDSLQLCKGPSLGTNFTLACPYAILAHYQELDEVARY 616

Query: 345 TVEQNLLRISVGCESPEDL 363
            VE++L+R+SVG E+ E L
Sbjct: 617 GVEKSLVRVSVGLENRESL 635

>NDAI0D03260 Chr4 complement(774579..776669) [2091 bp, 696 aa] {ON}
           Anc_4.354
          Length = 696

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 58/293 (19%), Positives = 115/293 (39%), Gaps = 28/293 (9%)

Query: 105 RGYHGCHGVADIWVRNHGLQKLSLEEVSERSEPGDLVHIESPINPYGTLVDVXXXXXXXX 164
           + ++  H ++D    N  + KL  +E+    E    V IE+P NP   + D+        
Sbjct: 404 QKFNHTHFLSDNDEENSAMSKL--KEILHSGEQILAVFIEAPSNPLLKMGDLIELKRLSD 461

Query: 165 XXXXYVVLDATFAPPPLQDRWEQGADVVVHSCTKYFGGHSDLLGGVHAVRDAAVARQLRQ 224
               ++++D T A   +       AD++  S TK F G S+++ G   +   +      +
Sbjct: 462 MYGFFIIVDETIA-GFVNIDAIIHADIICSSLTKVFTGDSNVIAGSMVLNPMSKIYDFAK 520

Query: 225 DRVYLGTNIANL----EAYLLIRSMRTMEMRVVRQSTSATKVVAYLES----HKAEFGGV 276
             +       +     +   L ++ R    +  R + +   +V  + S     K   G +
Sbjct: 521 RFLSFPDGFEDCLWCEDILYLEKNSRDFLSKTTRINNTTEYLVNTVLSPYVGKKEANGKL 580

Query: 277 LVKVFHSSLQTEPYVQQY------LRGGNAPVFSILLRTVEQCKRLPSLLKLFHHATSLG 330
             K+++ +  ++     Y        GG   VFSI    +E+ K   + LKL     SLG
Sbjct: 581 FKKIYYPTTTSKETKMCYDAIKCKTYGGYGGVFSITFHDIEKAKLFFNNLKL-SKTISLG 639

Query: 331 GVESLI----------EWRAMSDTTVEQNLLRISVGCESPEDLIADLAGAFRQ 373
              + +          E   +S+  +++ L+R+ VG E+   L  + + A  +
Sbjct: 640 SNYTTVCPYTVLKHGDELEKVSEYGLDETLIRVCVGLENKTSLKENFSRAIEK 692

>KAFR0E04390 Chr5 complement(879422..883717) [4296 bp, 1431 aa] {ON}
           Anc_4.370 YJR137C
          Length = 1431

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 50/103 (48%), Gaps = 11/103 (10%)

Query: 257 TSATKVVAYLESHKAEFGGVLVKVFHSSLQTEPYVQQYLRGGNAPVFSILLRTVEQCKR- 315
           +S+ + V +LES    +  VL ++F S+LQ           GN+P F   L   EQ  R 
Sbjct: 328 SSSIENVLHLES---AYIKVLQQLFSSNLQVLNEYNSETVNGNSPEFGYGLFLHEQKARE 384

Query: 316 -LPSLLK------LFHHATSLGGVESLIEWRAMSDTTVEQNLL 351
            L  ++K      LFH   +   VE L EW A+SD  ++++ L
Sbjct: 385 ELVGIVKSCLDVSLFHTENANRLVELLSEWLALSDEPLDESEL 427

>KAFR0E04410 Chr5 complement(886158..890468) [4311 bp, 1436 aa] {ON}
           
          Length = 1436

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 50/103 (48%), Gaps = 11/103 (10%)

Query: 257 TSATKVVAYLESHKAEFGGVLVKVFHSSLQTEPYVQQYLRGGNAPVFSILLRTVEQCKR- 315
           +S+ + V +LES    +  VL ++F S+LQ           GN+P F   L   EQ  R 
Sbjct: 332 SSSIENVLHLES---AYIKVLQQLFSSNLQVLNEYNSETVNGNSPEFGYGLFLHEQKARE 388

Query: 316 -LPSLLK------LFHHATSLGGVESLIEWRAMSDTTVEQNLL 351
            L  ++K      LFH   +   VE L EW A++D  ++++ L
Sbjct: 389 ELVGIVKSCLDASLFHTENANRLVELLSEWLALNDKPLDESEL 431

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 35,736,793
Number of extensions: 1353419
Number of successful extensions: 3301
Number of sequences better than 10.0: 116
Number of HSP's gapped: 3167
Number of HSP's successfully gapped: 136
Length of query: 374
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 263
Effective length of database: 40,753,473
Effective search space: 10718163399
Effective search space used: 10718163399
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 66 (30.0 bits)