Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AER206C3.138ON23222111871e-167
Ecym_52693.138ON2412267531e-101
Kwal_56.229033.138ON2602226452e-84
SAKL0C08184g3.138ON2502206233e-81
KLTH0C08360g3.138ON2552216043e-78
TDEL0D048603.138ON2222165745e-74
Kpol_1053.113.138ON2282165737e-74
CAGL0K01265g3.138ON2462195722e-73
ZYRO0B05478g3.138ON2302165623e-72
TBLA0F010103.138ON2252165581e-71
KAFR0C011703.138ON2322165512e-70
NDAI0A068003.138ON2392305503e-70
NCAS0C003603.138ON2272145484e-70
TPHA0M005103.138ON2312205485e-70
KLLA0D03795g3.138ON2342165321e-67
KNAG0K009803.138ON2192135268e-67
Skud_7.3713.138ON2362155009e-63
Suva_7.3573.138ON2422154862e-60
Smik_6.1573.138ON2382144792e-59
YGR075C (PRP38)3.138ON2422154765e-59
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AER206C
         (232 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AER206C Chr5 complement(1020446..1021144) [699 bp, 232 aa] {ON} ...   461   e-167
Ecym_5269 Chr5 (554751..555476) [726 bp, 241 aa] {ON} similar to...   294   e-101
Kwal_56.22903 s56 complement(321790..322572) [783 bp, 260 aa] {O...   253   2e-84
SAKL0C08184g Chr3 (757467..758219) [753 bp, 250 aa] {ON} similar...   244   3e-81
KLTH0C08360g Chr3 (709211..709978) [768 bp, 255 aa] {ON} similar...   237   3e-78
TDEL0D04860 Chr4 complement(883478..884146) [669 bp, 222 aa] {ON...   225   5e-74
Kpol_1053.11 s1053 (14305..14991) [687 bp, 228 aa] {ON} (14305.....   225   7e-74
CAGL0K01265g Chr11 (117543..118283) [741 bp, 246 aa] {ON} simila...   224   2e-73
ZYRO0B05478g Chr2 complement(435448..436140) [693 bp, 230 aa] {O...   221   3e-72
TBLA0F01010 Chr6 complement(246433..247110) [678 bp, 225 aa] {ON...   219   1e-71
KAFR0C01170 Chr3 complement(234805..235503) [699 bp, 232 aa] {ON...   216   2e-70
NDAI0A06800 Chr1 complement(1549698..1550417) [720 bp, 239 aa] {...   216   3e-70
NCAS0C00360 Chr3 (53393..54076) [684 bp, 227 aa] {ON} Anc_3.138 ...   215   4e-70
TPHA0M00510 Chr13 complement(93362..94057) [696 bp, 231 aa] {ON}...   215   5e-70
KLLA0D03795g Chr4 complement(322289..322993) [705 bp, 234 aa] {O...   209   1e-67
KNAG0K00980 Chr11 (193396..194055) [660 bp, 219 aa] {ON} Anc_3.1...   207   8e-67
Skud_7.371 Chr7 complement(623406..624116) [711 bp, 236 aa] {ON}...   197   9e-63
Suva_7.357 Chr7 complement(612532..613260) [729 bp, 242 aa] {ON}...   191   2e-60
Smik_6.157 Chr6 complement(262091..262807) [717 bp, 238 aa] {ON}...   189   2e-59
YGR075C Chr7 complement(636147..636875) [729 bp, 242 aa] {ON}  P...   187   5e-59

>AER206C Chr5 complement(1020446..1021144) [699 bp, 232 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR075C
           (PRP38)
          Length = 232

 Score =  461 bits (1187), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 221/221 (100%), Positives = 221/221 (100%)

Query: 1   MPQEFLVESHISDKQLSNQSTSLVIPKIARLRIHNSMYYKINLYPTGLRGNTLKQLVRVL 60
           MPQEFLVESHISDKQLSNQSTSLVIPKIARLRIHNSMYYKINLYPTGLRGNTLKQLVRVL
Sbjct: 1   MPQEFLVESHISDKQLSNQSTSLVIPKIARLRIHNSMYYKINLYPTGLRGNTLKQLVRVL 60

Query: 61  VRDLGACKHRSGPMLHICGNTEFQCLLMKVIEIRPTWSQIYTLLQLGDERKTGKFNNKYI 120
           VRDLGACKHRSGPMLHICGNTEFQCLLMKVIEIRPTWSQIYTLLQLGDERKTGKFNNKYI
Sbjct: 61  VRDLGACKHRSGPMLHICGNTEFQCLLMKVIEIRPTWSQIYTLLQLGDERKTGKFNNKYI 120

Query: 121 AVLILVYLRIQYYFLADEKAESFPPEADGDVTAAKVKALFAHFLADYRKVKCLDLEVDCW 180
           AVLILVYLRIQYYFLADEKAESFPPEADGDVTAAKVKALFAHFLADYRKVKCLDLEVDCW
Sbjct: 121 AVLILVYLRIQYYFLADEKAESFPPEADGDVTAAKVKALFAHFLADYRKVKCLDLEVDCW 180

Query: 181 SGATQKSVSVQHVDEIVDWLCTKDSIWGIPLGRCRWLADVL 221
           SGATQKSVSVQHVDEIVDWLCTKDSIWGIPLGRCRWLADVL
Sbjct: 181 SGATQKSVSVQHVDEIVDWLCTKDSIWGIPLGRCRWLADVL 221

>Ecym_5269 Chr5 (554751..555476) [726 bp, 241 aa] {ON} similar to
           Ashbya gossypii AER206C
          Length = 241

 Score =  294 bits (753), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 138/226 (61%), Positives = 171/226 (75%), Gaps = 5/226 (2%)

Query: 1   MPQEFLVESHISDKQLSNQSTSLVIPKIARLRIHNSMYYKINLYPTGLRGNTLKQLVRVL 60
           M +EF VES ISDKQL++QSTSLVIPKI RLRIHNSMYYK+NL+P  LRG T+K + +V+
Sbjct: 1   MSREFQVESEISDKQLNHQSTSLVIPKITRLRIHNSMYYKVNLHPASLRGETMKHVSKVM 60

Query: 61  VRDLGACKHRSGPMLHICGNTEFQCLLMKVIEIRPTWSQIYTLLQLGD-ERKTGKFNNKY 119
           +R+LG CK+RS      CG  EFQCLLMK++EIRPTWSQ++ +LQL D   K G FNNKY
Sbjct: 61  IRELGTCKNRSTVSGTACGTVEFQCLLMKMVEIRPTWSQLHLMLQLDDCSEKAGPFNNKY 120

Query: 120 IAVLILVYLRIQYYFLADEKAESFPP----EADGDVTAAKVKALFAHFLADYRKVKCLDL 175
           I VLILVYLRIQYY+L ++  E   P    +  GD+ A K+K LFAHFL D RK+K ++L
Sbjct: 121 IVVLILVYLRIQYYYLVNKGTEEIKPLSNLDTTGDIDAGKIKTLFAHFLRDCRKIKSINL 180

Query: 176 EVDCWSGATQKSVSVQHVDEIVDWLCTKDSIWGIPLGRCRWLADVL 221
             D WS + QK V + H+DEIVDWLCT DSIWG+PLG+C WL ++L
Sbjct: 181 HDDPWSTSIQKRVDIYHIDEIVDWLCTNDSIWGVPLGKCPWLIEIL 226

>Kwal_56.22903 s56 complement(321790..322572) [783 bp, 260 aa] {ON}
           YGR075C (PRP38) - RNA splicing factor [contig 184] FULL
          Length = 260

 Score =  253 bits (645), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 117/222 (52%), Positives = 160/222 (72%), Gaps = 6/222 (2%)

Query: 1   MPQEFLVESHISDKQLSNQSTSLVIPKIARLRIHNSMYYKINLYPTGLRGNTLKQLVRVL 60
           MP EF  +  +S+KQL++QSTSLVIP++ R RIHNSMYYK+NL+P  LRG  + QL++ +
Sbjct: 1   MPLEFHFDESVSEKQLNHQSTSLVIPQLTRARIHNSMYYKVNLHPAALRGINMLQLIKKI 60

Query: 61  VRDLGACKHRSGPMLHICGNTEFQCLLMKVIEIRPTWSQIYTLLQLGDERKTGKFNNKYI 120
           V+  G  +  S  +  +CG  EF+CLLMK++ +RPTWSQ+  +LQ G+E KT KF+NKY+
Sbjct: 61  VKQFGTTRGGSHLVSVVCGGVEFKCLLMKLVHLRPTWSQVLLILQRGNE-KTSKFDNKYL 119

Query: 121 AVLILVYLRIQYYFLADEKAES-----FPPEADGDVTAAKVKALFAHFLADYRKVKCLDL 175
            +L+LVYLR+QYY+L    A          E  GDVT+ K++ LF  ++ DYRKVK +DL
Sbjct: 120 VILVLVYLRVQYYYLPKPAARENKTCILDVEKQGDVTSDKLQNLFRIYINDYRKVKSMDL 179

Query: 176 EVDCWSGATQKSVSVQHVDEIVDWLCTKDSIWGIPLGRCRWL 217
           ++DCWS  T K V V H+DEIVDWLCT+D IWGIPLG+ +W+
Sbjct: 180 DIDCWSNLTGKKVDVLHIDEIVDWLCTQDHIWGIPLGKSQWI 221

>SAKL0C08184g Chr3 (757467..758219) [753 bp, 250 aa] {ON} similar to
           uniprot|Q00723 Saccharomyces cerevisiae YGR075C PRP38
           Unique component of the U4/U6.U5 tri-snRNP particle
           dispensable for spliceosome assembly but required for
           conformational changes which lead to catalytic
           activation of the spliceosome
          Length = 250

 Score =  244 bits (623), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 115/220 (52%), Positives = 151/220 (68%), Gaps = 5/220 (2%)

Query: 1   MPQEFLVESHISDKQLSNQSTSLVIPKIARLRIHNSMYYKINLYPTGLRGNTLKQLVRVL 60
           M +EF VE+++S+KQL++QSTSLVIP++ R+R+HNSMYYK+NL   GLRG  + QL +V+
Sbjct: 1   MSREFQVEANLSNKQLNHQSTSLVIPQLTRVRVHNSMYYKVNLDAVGLRGVNMCQLAKVI 60

Query: 61  VRDLGACKHRSGPMLHICGNTEFQCLLMKVIEIRPTWSQIYTLLQLGDERKTGKFNNKYI 120
           VRDLG+  H       +CG  EF+CLL K++ IRPTW Q+  +L LG  +  G FNNKYI
Sbjct: 61  VRDLGSLAHGGTCTAGVCGGVEFKCLLTKLVHIRPTWRQVVAMLGLGKPQHAG-FNNKYI 119

Query: 121 AVLILVYLRIQYYFLADEKAESFPPEAD----GDVTAAKVKALFAHFLADYRKVKCLDLE 176
            VL+LVYLR QYY+L  E                V++  ++ LF HF+ DYRKVK   L 
Sbjct: 120 VVLVLVYLRAQYYYLPAEGGTMAGGVEQLAKLNRVSSRALRQLFGHFINDYRKVKSFSLA 179

Query: 177 VDCWSGATQKSVSVQHVDEIVDWLCTKDSIWGIPLGRCRW 216
            DCWS + +K V + HVDE+VDWLCTK+ IWGIPLG C+W
Sbjct: 180 ADCWSSSVEKRVELLHVDEVVDWLCTKNEIWGIPLGICQW 219

>KLTH0C08360g Chr3 (709211..709978) [768 bp, 255 aa] {ON} similar to
           uniprot|Q00723 Saccharomyces cerevisiae YGR075C PRP38
           Unique component of the U4/U6.U5 tri-snRNP particle
           dispensable for spliceosome assembly but required for
           conformational changes which lead to catalytic
           activation of the spliceosome
          Length = 255

 Score =  237 bits (604), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 118/221 (53%), Positives = 157/221 (71%), Gaps = 6/221 (2%)

Query: 1   MPQEFLVESHISDKQLSNQSTSLVIPKIARLRIHNSMYYKINLYPTGLRGNTLKQLVRVL 60
           M +EF V+ ++S KQL++QSTSLVIP++AR RIHNSMYYKINL P  LRG+T+ QL + +
Sbjct: 1   MSREFHVDENVSTKQLNHQSTSLVIPQLARTRIHNSMYYKINLDPASLRGDTMVQLSKTM 60

Query: 61  VRDLGACKHRSGPMLHICGNTEFQCLLMKVIEIRPTWSQIYTLLQLGDERKTGKFNNKYI 120
           +RD G C+  +  M  +CG  EF+CLLMK++ +RP W QI T+LQ G+ER + KF+NKY+
Sbjct: 61  MRDFGTCRDNARRMALVCGGVEFKCLLMKLVHLRPQWGQIVTILQKGNER-SSKFDNKYL 119

Query: 121 AVLILVYLRIQYYFLADEKAES-----FPPEADGDVTAAKVKALFAHFLADYRKVKCLDL 175
            VL+LVYLRIQYYFL D   E            G V++  ++ LF  +L+DYRKVK ++L
Sbjct: 120 VVLVLVYLRIQYYFLPDTSDEEKVTGVLNLNKRGSVSSGTLRGLFRIYLSDYRKVKSINL 179

Query: 176 EVDCWSGATQKSVSVQHVDEIVDWLCTKDSIWGIPLGRCRW 216
           E D W  +  K     H+DE+VDWLCT+D IWGIPLGRC+W
Sbjct: 180 ETDYWYNSASKVPKTLHIDEVVDWLCTQDQIWGIPLGRCQW 220

>TDEL0D04860 Chr4 complement(883478..884146) [669 bp, 222 aa] {ON}
           Anc_3.138 YGR075C
          Length = 222

 Score =  225 bits (574), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 104/216 (48%), Positives = 148/216 (68%), Gaps = 15/216 (6%)

Query: 1   MPQEFLVESHISDKQLSNQSTSLVIPKIARLRIHNSMYYKINLYPTGLRGNTLKQLVRVL 60
           M +EF VES++S K+L+NQS SLVIP++ R RIHN +YYK NL+   LRG+T+KQL +V+
Sbjct: 1   MSREFYVESYLSTKELNNQSVSLVIPRLTRDRIHNVIYYKANLHTVALRGDTMKQLCKVI 60

Query: 61  VRDLGACKHRSGPMLHICGNTEFQCLLMKVIEIRPTWSQIYTLLQLGDERKTGKFNNKYI 120
           +RDLG  +  S    ++ G  EF+C+LMK++EIRPTW Q+  LL+         +NNKY+
Sbjct: 61  IRDLGTLQSTSINRKNVLGGVEFKCILMKLVEIRPTWDQLALLLR----NPHPSYNNKYV 116

Query: 121 AVLILVYLRIQYYFLADEKAESFPPEADGDVTAAKVKALFAHFLADYRKVKCLDLEVDCW 180
             L+L YLR+QY++L ++           D+ A  +K  F  ++ DYRK+K + LE+DCW
Sbjct: 117 IALVLTYLRVQYFYLKND-----------DILAQNIKGAFKEYICDYRKMKSVSLEMDCW 165

Query: 181 SGATQKSVSVQHVDEIVDWLCTKDSIWGIPLGRCRW 216
           S +   +V + H+DE+VDWL TKD IWGIPLGRC+W
Sbjct: 166 SASQNVTVEIIHMDELVDWLTTKDEIWGIPLGRCQW 201

>Kpol_1053.11 s1053 (14305..14991) [687 bp, 228 aa] {ON}
           (14305..14991) [687 nt, 229 aa]
          Length = 228

 Score =  225 bits (573), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 106/216 (49%), Positives = 147/216 (68%), Gaps = 13/216 (6%)

Query: 1   MPQEFLVESHISDKQLSNQSTSLVIPKIARLRIHNSMYYKINLYPTGLRGNTLKQLVRVL 60
           M  EFLVESH+S+KQL+NQS SLVIP+I R +IHNS+YYK NL  + LRG  + QL+ V+
Sbjct: 1   MSNEFLVESHLSNKQLNNQSVSLVIPRITRDKIHNSIYYKANLDNSSLRGLNMLQLIEVI 60

Query: 61  VRDLGACKHRSGPMLHICGNTEFQCLLMKVIEIRPTWSQIYTLLQLGDERKTGKFNNKYI 120
           VRDLG  K +S   +   G  EF+C+LMK+IEI PTW Q+ T++Q+ D      F+NKY+
Sbjct: 61  VRDLGTLKDKSVNQVCFLGGVEFKCILMKLIEICPTWEQLMTIIQMQD-NVIDNFDNKYL 119

Query: 121 AVLILVYLRIQYYFLADEKAESFPPEADGDVTAAKVKALFAHFLADYRKVKCLDLEVDCW 180
             L+L Y+RIQYY+  DE            V + K + LF+  ++DYRK+K + ++ DCW
Sbjct: 120 VALVLTYIRIQYYYDNDE------------VNSKKYRELFSKCISDYRKLKSVAMDTDCW 167

Query: 181 SGATQKSVSVQHVDEIVDWLCTKDSIWGIPLGRCRW 216
           S +    + + H+DE+VDWLC++D IWGIPLG C+W
Sbjct: 168 SMSQSIEIKIIHLDELVDWLCSEDEIWGIPLGHCQW 203

>CAGL0K01265g Chr11 (117543..118283) [741 bp, 246 aa] {ON} similar
           to uniprot|Q00723 Saccharomyces cerevisiae YGR075c
           Pre-mRNA splicing factor
          Length = 246

 Score =  224 bits (572), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 114/219 (52%), Positives = 150/219 (68%), Gaps = 13/219 (5%)

Query: 1   MPQEFLVESHISDKQLSNQSTSLVIPKIARLRIHNSMYYKINLYPTGLRGNTLKQLVRVL 60
           M  EF  ES IS+KQL+NQS SLVIP+I R +IHN++YY+ NL+P  +RG+T+  L  ++
Sbjct: 1   MSAEFQYESFISEKQLNNQSVSLVIPRITRDKIHNNIYYRCNLHPVSMRGDTMLNLAPII 60

Query: 61  VRDLGACKHRSGPMLH---ICGNTEFQCLLMKVIEIRPTWSQIYTLLQLGDERKTGKFNN 117
           +RDLG  ++     L+   + G +EF+CLLMK+IEIRPTW QI TL+   +E     F N
Sbjct: 61  IRDLGKLRNPYQKPLNATLLLGGSEFKCLLMKLIEIRPTWEQIMTLI--NEEMVEESFEN 118

Query: 118 KYIAVLILVYLRIQYYFLADEKAESFPPEADGDVTAAKVKALFAHFLADYRKVKCLDLEV 177
           KYI  L+LVY RIQYYFL      +F  +   D  A K + LF  +L DYRK+K LDL V
Sbjct: 119 KYIVALVLVYGRIQYYFL------TFSDDYYDD--AIKWRRLFKKYLNDYRKLKALDLNV 170

Query: 178 DCWSGATQKSVSVQHVDEIVDWLCTKDSIWGIPLGRCRW 216
           DCWS +  ++V + H+DEIVDWL TKD IWGIPLG+C+W
Sbjct: 171 DCWSTSQMQNVELIHLDEIVDWLATKDDIWGIPLGKCQW 209

>ZYRO0B05478g Chr2 complement(435448..436140) [693 bp, 230 aa] {ON}
           similar to uniprot|Q00723 Saccharomyces cerevisiae
           YGR075C PRP38 Unique component of the U4/U6.U5 tri-snRNP
           particle dispensable for spliceosome assembly but
           required for conformational changes which lead to
           catalytic activation of the spliceosome
          Length = 230

 Score =  221 bits (562), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 112/216 (51%), Positives = 146/216 (67%), Gaps = 16/216 (7%)

Query: 1   MPQEFLVESHISDKQLSNQSTSLVIPKIARLRIHNSMYYKINLYPTGLRGNTLKQLVRVL 60
           MPQEF VES +S KQL++QS S VIP+I R RIHN+MYY++NL    LRG+T+  L R+L
Sbjct: 1   MPQEFHVESFLSPKQLNHQSVSFVIPRILRDRIHNAMYYRVNLNTASLRGDTMNCLSRIL 60

Query: 61  VRDLGACKHRSGPMLHICGNTEFQCLLMKVIEIRPTWSQIYTLLQLGDERKTGKFNNKYI 120
           VRDLGA K  S   +++ G  EFQCLLMK++EI+PT+ Q+ T+LQ  DE     FNNKYI
Sbjct: 61  VRDLGALKDGSVNQVNVLGGVEFQCLLMKLVEIKPTFDQLTTMLQ-DDE----NFNNKYI 115

Query: 121 AVLILVYLRIQYYFLADEKAESFPPEADGDVTAAKVKALFAHFLADYRKVKCLDLEVDCW 180
             LIL YLRIQYY+L  +           D  A + ++ F  +  DYRK+K + L+ DCW
Sbjct: 116 VGLILTYLRIQYYYLPVD-----------DPWARRCQSFFRQYYNDYRKLKSVQLDQDCW 164

Query: 181 SGATQKSVSVQHVDEIVDWLCTKDSIWGIPLGRCRW 216
           S +   +V + H DE+VDWL  KD IWGIPLG+C+W
Sbjct: 165 SKSQTINVDILHTDELVDWLLVKDDIWGIPLGKCQW 200

>TBLA0F01010 Chr6 complement(246433..247110) [678 bp, 225 aa] {ON}
           Anc_3.138 YGR075C
          Length = 225

 Score =  219 bits (558), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 105/216 (48%), Positives = 149/216 (68%), Gaps = 13/216 (6%)

Query: 1   MPQEFLVESHISDKQLSNQSTSLVIPKIARLRIHNSMYYKINLYPTGLRGNTLKQLVRVL 60
           M +EF VES +S KQL++QS SLVIP++ R +IH+++YYK+NL    +RGNTL  L  V+
Sbjct: 3   MSKEFFVESQVSSKQLNHQSVSLVIPRLTRDKIHSALYYKVNLQDPSMRGNTLLGLNNVI 62

Query: 61  VRDLGACKHRSGPMLHICGNTEFQCLLMKVIEIRPTWSQIYTLLQLGDERKTGKFNNKYI 120
           +RDLG   + S    ++ G  EF+C+LMK++E+RPT  Q+  +L++ D   TG+FNNKYI
Sbjct: 63  IRDLGTLNNESINKKNVLGGVEFKCILMKLVELRPTIEQLDIILEISD--ATGEFNNKYI 120

Query: 121 AVLILVYLRIQYYFLADEKAESFPPEADGDVTAAKVKALFAHFLADYRKVKCLDLEVDCW 180
             LILVYLRIQYY+ A+E ++           A + KALF  ++ DYRK+K + L +DCW
Sbjct: 121 IALILVYLRIQYYY-ANETSDE----------AKRFKALFQQYINDYRKMKAISLNIDCW 169

Query: 181 SGATQKSVSVQHVDEIVDWLCTKDSIWGIPLGRCRW 216
           S +   +V + H+DE+V WL  KD+IWGIPLG+C W
Sbjct: 170 SQSQIITVELIHMDELVHWLSAKDNIWGIPLGKCSW 205

>KAFR0C01170 Chr3 complement(234805..235503) [699 bp, 232 aa] {ON}
           Anc_3.138 YGR075C
          Length = 232

 Score =  216 bits (551), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 103/216 (47%), Positives = 147/216 (68%), Gaps = 14/216 (6%)

Query: 1   MPQEFLVESHISDKQLSNQSTSLVIPKIARLRIHNSMYYKINLYPTGLRGNTLKQLVRVL 60
           M  EF VES +S KQL++QS SL+IP++ R RIHN++YYK+NL PT LRG+TL +L +V+
Sbjct: 1   MSSEFHVESFLSAKQLNHQSVSLIIPRLTRDRIHNNIYYKVNLQPTSLRGDTLLELSKVI 60

Query: 61  VRDLGACKHRSGPMLHICGNTEFQCLLMKVIEIRPTWSQIYTLLQLGDERKTGKFNNKYI 120
           +RDLG  K  S   +H+ G  EF+CLLMK+IEIRPT +Q++ +L   +      F +KYI
Sbjct: 61  IRDLGTLKDLSVNKVHVLGGMEFKCLLMKLIEIRPTINQLFAMLNPAN--ANTNFEDKYI 118

Query: 121 AVLILVYLRIQYYFLADEKAESFPPEADGDVTAAKVKALFAHFLADYRKVKCLDLEVDCW 180
             LI+ YLRIQY++L D +               ++K LF   + DYRK+K L L+ DCW
Sbjct: 119 TALIITYLRIQYFYLTDAQE------------CLRMKNLFKKCIKDYRKLKSLSLQSDCW 166

Query: 181 SGATQKSVSVQHVDEIVDWLCTKDSIWGIPLGRCRW 216
           S + + +V+V H+DE+ +WL +K+ IWGIPLG+C+W
Sbjct: 167 SPSEELTVAVVHMDELTEWLVSKEQIWGIPLGKCQW 202

>NDAI0A06800 Chr1 complement(1549698..1550417) [720 bp, 239 aa] {ON}
           Anc_3.138 YGR075C
          Length = 239

 Score =  216 bits (550), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 111/230 (48%), Positives = 154/230 (66%), Gaps = 25/230 (10%)

Query: 2   PQEFLVESHISDKQLSNQSTSLVIPKIARLRIHNSMYYKINLYPTGLRGNTLKQLVRVLV 61
             EF VES IS+KQL+N S SLVIP+I R +IHNS+YYK+NL    LRGNT+ QL++V+V
Sbjct: 4   SNEFFVESFISNKQLNNSSVSLVIPRITRDKIHNSIYYKVNLTSQSLRGNTMVQLIQVIV 63

Query: 62  RDLGACK-----HRSGPML---HICGNTEFQCLLMKVIEIRPTWSQIYTLLQLGDERKTG 113
           RD G  K     H S  M+   H+ G TEF+CLLMK+IE++PT  QI+ LL+  D+    
Sbjct: 64  RDFGKLKSQSHSHSSDTMVVRNHLVGGTEFKCLLMKIIELKPTIEQIWILLEDHDD---T 120

Query: 114 KFNNKYIAVLILVYLRIQYYFLADEKAESFPPEADGDVTAAKVKALFAHFLADYRKVKCL 173
           +F+NKYI VLI+ Y+RIQY+F+              D  A K + +F   L +Y K+KC 
Sbjct: 121 EFDNKYITVLIITYIRIQYFFI-----------GKNDSLARKFQDIFQKCLNNYTKLKCF 169

Query: 174 DLEVDCW---SGATQKSVSVQHVDEIVDWLCTKDSIWGIPLGRCRWLADV 220
            L+ DCW      +++SV + ++DE+VDWL TKD+IWGIPLG+C+W+A++
Sbjct: 170 QLDADCWSPSLSLSEESVRIIYMDEVVDWLLTKDNIWGIPLGKCQWVAEI 219

>NCAS0C00360 Chr3 (53393..54076) [684 bp, 227 aa] {ON} Anc_3.138
           YGR075C
          Length = 227

 Score =  215 bits (548), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 104/214 (48%), Positives = 144/214 (67%), Gaps = 14/214 (6%)

Query: 3   QEFLVESHISDKQLSNQSTSLVIPKIARLRIHNSMYYKINLYPTGLRGNTLKQLVRVLVR 62
           ++F VESHIS K+L+NQS SLVIP++ R +IHN +YYK+NL  T LRGNT+ QL ++++R
Sbjct: 4   RDFFVESHISSKELNNQSVSLVIPRLTRDKIHNVLYYKVNLTSTSLRGNTMLQLSKIIIR 63

Query: 63  DLGACKHRSGPMLHICGNTEFQCLLMKVIEIRPTWSQIYTLLQLGDERKTGKFNNKYIAV 122
           DLG  K  +    ++ G  EF+CLLMK+IEIRPT+ QI  LL+   +     F NKYI  
Sbjct: 64  DLGQLKDSNSLKNYLVGGVEFKCLLMKLIEIRPTFDQITMLLE-KKKSPDDTFENKYIVA 122

Query: 123 LILVYLRIQYYFLADEKAESFPPEADGDVTAAKVKALFAHFLADYRKVKCLDLEVDCWSG 182
           LIL YLRIQYY+L                 A+ +  LF  ++ DYRK+K +D+++DCWS 
Sbjct: 123 LILTYLRIQYYYLKLHD-------------ASHLINLFREYINDYRKLKGIDMDMDCWSM 169

Query: 183 ATQKSVSVQHVDEIVDWLCTKDSIWGIPLGRCRW 216
           + Q  V + H+DE+VD L T ++IWGIPLG+C+W
Sbjct: 170 SQQLKVEIIHIDELVDRLATNNNIWGIPLGKCQW 203

>TPHA0M00510 Chr13 complement(93362..94057) [696 bp, 231 aa] {ON}
           Anc_3.138 YGR075C
          Length = 231

 Score =  215 bits (548), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 100/220 (45%), Positives = 144/220 (65%), Gaps = 15/220 (6%)

Query: 1   MPQEFLVESHISDKQLSNQSTSLVIPKIARLRIHNSMYYKINLYPTGLRGNTLKQLVRVL 60
           M  EF VE+++S KQL+NQS SLVIP++ R +IHNSMYYK+NL    LRGNT+ QL +V+
Sbjct: 1   MSHEFAVEAYLSSKQLNNQSVSLVIPRLTRDKIHNSMYYKVNLTDNSLRGNTVLQLSKVI 60

Query: 61  VRDLGACKHRSGPMLHICGNTEFQCLLMKVIEIRPTWSQIYTLLQLGDERKT----GKFN 116
           VRDLG   + S   L++ G  EF+C+LMK++E+RPTW Q+ +LL + ++  +    G+F+
Sbjct: 61  VRDLGTLLNGSSQQLNVIGGVEFKCILMKLVEMRPTWEQLLSLLNIDNDFNSVGTVGEFD 120

Query: 117 NKYIAVLILVYLRIQYYFLADEKAESFPPEADGDVTAAKVKALFAHFLADYRKVKCLDLE 176
           NKYI  L+L Y+RIQY+F+  +                K K LF  ++ DYRK+K +   
Sbjct: 121 NKYITALVLTYIRIQYHFINSDHQ-----------LFNKCKKLFKLYMNDYRKLKSIAFG 169

Query: 177 VDCWSGATQKSVSVQHVDEIVDWLCTKDSIWGIPLGRCRW 216
            +CWS +    V + H+DE+V+WL TK+ IWG+PL  C W
Sbjct: 170 TNCWSMSQAIDVGIGHIDELVEWLATKNDIWGLPLAMCSW 209

>KLLA0D03795g Chr4 complement(322289..322993) [705 bp, 234 aa] {ON}
           similar to uniprot|Q00723 Saccharomyces cerevisiae
           YGR075C PRP38 Unique component of the U4/U6.U5 tri-snRNP
           particle dispensable for spliceosome assembly but
           required for conformational changes which lead to
           catalytic activation of the spliceosome
          Length = 234

 Score =  209 bits (532), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 99/216 (45%), Positives = 141/216 (65%), Gaps = 11/216 (5%)

Query: 1   MPQEFLVESHISDKQLSNQSTSLVIPKIARLRIHNSMYYKINLYPTGLRGNTLKQLVRVL 60
           MP EF VE ++S KQL++QS SLV+P+I R ++ + MYYK NL P  LRG+T+ +L+ V+
Sbjct: 1   MPNEFYVEENLSGKQLNHQSASLVVPQIFRNKVSSCMYYKFNLTPASLRGDTIVELIPVI 60

Query: 61  VRDLGACKHRSGPMLHICGNTEFQCLLMKVIEIRPTWSQIYTLLQLGDERKTGKFNNKYI 120
           VRD G    R  P + + G  EF+CLLMK+I +RP W Q+  LL+  +       NNKYI
Sbjct: 61  VRDFGTMDERKTPHVTVLGGIEFKCLLMKLINLRPPWEQLKVLLEPHE-----PLNNKYI 115

Query: 121 AVLILVYLRIQYYFLADEKAESFPPEADGDVTAAKVKALFAHFLADYRKVKCLDLEVDCW 180
           A L+L Y+RI YYFL     ES P E   D++   +  L   ++ D+RK+K   L++DCW
Sbjct: 116 AALVLCYMRISYYFL----TESNPSEQ--DISFNLLHDLMKKYILDHRKLKSYSLDMDCW 169

Query: 181 SGATQKSVSVQHVDEIVDWLCTKDSIWGIPLGRCRW 216
           S + +K + + H DE++DWLC ++ IWGIPLG+C W
Sbjct: 170 SSSIKKEIKLIHFDELIDWLCDRNEIWGIPLGKCNW 205

>KNAG0K00980 Chr11 (193396..194055) [660 bp, 219 aa] {ON} Anc_3.138
           YGR075C
          Length = 219

 Score =  207 bits (526), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 101/213 (47%), Positives = 141/213 (66%), Gaps = 15/213 (7%)

Query: 4   EFLVESHISDKQLSNQSTSLVIPKIARLRIHNSMYYKINLYPTGLRGNTLKQLVRVLVRD 63
           EF VESHIS KQL++QS SLVIP++ R ++H+ +YYK+NL    LRG+T+ QL +VL+RD
Sbjct: 5   EFQVESHISTKQLNHQSVSLVIPRLTRDKVHHVLYYKVNLEVGSLRGDTMLQLSKVLIRD 64

Query: 64  LGACKHRSGPMLHICGNTEFQCLLMKVIEIRPTWSQIYTLLQLGDERKTGKFNNKYIAVL 123
           LG  K  +    HI G  EF+CLLMK++EIRPT  Q+  +L    E +   F++KYI  L
Sbjct: 65  LGTIKANTLNQTHILGGVEFKCLLMKLVEIRPTREQLVYIL----ETQNKTFDDKYIVAL 120

Query: 124 ILVYLRIQYYFLADEKAESFPPEADGDVTAAKVKALFAHFLADYRKVKCLDLEVDCWSGA 183
           IL Y+RIQY+++              D  A K + LF  ++ D+RK+K +D E DCWS +
Sbjct: 121 ILTYIRIQYFYVTLH-----------DELARKWRELFKTYMKDFRKLKAVDFEQDCWSQS 169

Query: 184 TQKSVSVQHVDEIVDWLCTKDSIWGIPLGRCRW 216
            + +V V H+DE++DWL T+  IWGIPLG C+W
Sbjct: 170 QKINVKVTHLDELIDWLVTETQIWGIPLGMCQW 202

>Skud_7.371 Chr7 complement(623406..624116) [711 bp, 236 aa] {ON}
           YGR075C (REAL)
          Length = 236

 Score =  197 bits (500), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 96/215 (44%), Positives = 141/215 (65%), Gaps = 8/215 (3%)

Query: 3   QEFLVESHISDKQLSNQSTSLVIPKIARLRIHNSMYYKINLYPTGLRGNTLKQLVRVLVR 62
            EF VESHIS KQL+NQS SL+IP++ R +IHNSMYYK+NL    LRGNT+ +L++V++ 
Sbjct: 4   HEFQVESHISSKQLNNQSVSLIIPRLTRDKIHNSMYYKVNLSNESLRGNTMLELLKVIID 63

Query: 63  DLGACKHRSGPM-LHICGNTEFQCLLMKVIEIRPTWSQIYTLLQLGDERKTGKFNNKYIA 121
            LG  + + G + + + G  EF+C+LMK++EIRP   Q+  LL   D +    FN+KYI 
Sbjct: 64  ALGTLRGQDGHLNMAVLGGVEFKCILMKLVEIRPNLKQLAFLL---DVKNVKDFNSKYII 120

Query: 122 VLILVYLRIQYYFLADEKAESFPPEADGDVTAAKVKALFAHFLADYRKVKCLDLEVDCWS 181
            L+LVY R+QYY+L D+   +     + D+     K     +   + K+K   L+VDC++
Sbjct: 121 ALVLVYARLQYYYLNDQNKNN---SYENDLIQL-FKVQLYKYSQQFFKLKSFPLQVDCFA 176

Query: 182 GATQKSVSVQHVDEIVDWLCTKDSIWGIPLGRCRW 216
            +  + + + HVDE+VDWL T+D IWGIPLG+C+W
Sbjct: 177 HSQNEGLCIVHVDELVDWLVTQDHIWGIPLGKCQW 211

>Suva_7.357 Chr7 complement(612532..613260) [729 bp, 242 aa] {ON}
           YGR075C (REAL)
          Length = 242

 Score =  191 bits (486), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 97/215 (45%), Positives = 141/215 (65%), Gaps = 8/215 (3%)

Query: 3   QEFLVESHISDKQLSNQSTSLVIPKIARLRIHNSMYYKINLYPTGLRGNTLKQLVRVLVR 62
           +EF VESHIS KQL+NQS SL+IP++ R +IHNSMYYK+NL    LRGNT+ +L++V+V 
Sbjct: 4   KEFQVESHISLKQLNNQSVSLIIPRLTRDKIHNSMYYKVNLSSESLRGNTMVELLKVIVG 63

Query: 63  DLGACKHRSGPM-LHICGNTEFQCLLMKVIEIRPTWSQIYTLLQLGDERKTGKFNNKYIA 121
            LGA K++ G + + + G  EF+C+LMK++EIRPT  Q+  LL + D      F++KYI 
Sbjct: 64  KLGALKNQDGHLNMTVLGGVEFKCILMKLVEIRPTLQQLTFLLNVTD---PSTFSSKYIT 120

Query: 122 VLILVYLRIQYYFLADEKAESFPPEADGDVTAAKVKALFAHFLADYRKVKCLDLEVDCWS 181
            LILVY R+QYY+L D+       +          K     +   + K+K   L+VDC++
Sbjct: 121 ALILVYARLQYYYLNDKNNNDTNDDN----LIKLFKVQLYKYSQQFSKLKSFPLQVDCFA 176

Query: 182 GATQKSVSVQHVDEIVDWLCTKDSIWGIPLGRCRW 216
            +  + + +  +DE+VDWL T+D IWGIPLG+C+W
Sbjct: 177 HSNNEELCIIRIDELVDWLVTEDHIWGIPLGKCQW 211

>Smik_6.157 Chr6 complement(262091..262807) [717 bp, 238 aa] {ON}
           YGR075C (REAL)
          Length = 238

 Score =  189 bits (479), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 95/214 (44%), Positives = 138/214 (64%), Gaps = 8/214 (3%)

Query: 4   EFLVESHISDKQLSNQSTSLVIPKIARLRIHNSMYYKINLYPTGLRGNTLKQLVRVLVRD 63
           EF VESHIS KQL+NQS SL++P++ R +IHNSMYYK+NL    LRGNT+ +L++V+V  
Sbjct: 5   EFQVESHISSKQLNNQSVSLIVPRLTRDKIHNSMYYKVNLSNESLRGNTMVELLKVIVGT 64

Query: 64  LGACKHRSGPM-LHICGNTEFQCLLMKVIEIRPTWSQIYTLLQLGDERKTGKFNNKYIAV 122
           LG  + + G + + + G  EF+C+LMK+IEIRP + Q+  LL +   +    FN+KYI  
Sbjct: 65  LGTSRGQDGHLHMVVLGGVEFKCILMKLIEIRPNFEQLNFLLNV---KNANNFNSKYIIA 121

Query: 123 LILVYLRIQYYFLADEKAESFPPEADGDVTAAKVKALFAHFLADYRKVKCLDLEVDCWSG 182
           LILVY R+QYY+L D+       +          K     +   Y K+K   L+ DC++ 
Sbjct: 122 LILVYARLQYYYLNDKNNNDNDEDN----LIKLFKVQLYKYSQQYFKLKSFPLQKDCFAH 177

Query: 183 ATQKSVSVQHVDEIVDWLCTKDSIWGIPLGRCRW 216
           +  + + + HVDE+VDWL T+D IWG+PLG+C+W
Sbjct: 178 SYNQELCIIHVDELVDWLVTQDHIWGMPLGKCQW 211

>YGR075C Chr7 complement(636147..636875) [729 bp, 242 aa] {ON}
           PRP38Unique component of the U4/U6.U5 tri-snRNP
           particle, required for conformational changes which
           result in the catalytic activation of the spliceosome;
           dispensible for spliceosome assembly
          Length = 242

 Score =  187 bits (476), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 94/215 (43%), Positives = 139/215 (64%), Gaps = 8/215 (3%)

Query: 3   QEFLVESHISDKQLSNQSTSLVIPKIARLRIHNSMYYKINLYPTGLRGNTLKQLVRVLVR 62
            EF VES+IS KQL+NQS SLVIP++ R +IHNSMYYK+NL    LRGNT+ +L++V++ 
Sbjct: 4   NEFQVESNISPKQLNNQSVSLVIPRLTRDKIHNSMYYKVNLSNESLRGNTMVELLKVMIG 63

Query: 63  DLGACKHRSGPM-LHICGNTEFQCLLMKVIEIRPTWSQIYTLLQLGDERKTGKFNNKYIA 121
             G  K ++G + + + G  EF+C+LMK+IEIRP + Q+  LL + +E     F++KYI 
Sbjct: 64  AFGTIKGQNGHLHMMVLGGIEFKCILMKLIEIRPNFQQLNFLLNVKNE---NGFDSKYII 120

Query: 122 VLILVYLRIQYYFLADEKAESFPPEADGDVTAAKVKALFAHFLADYRKVKCLDLEVDCWS 181
            L+LVY R+QYY+L               +   ++     H    Y K+K   L+VDC++
Sbjct: 121 ALLLVYARLQYYYLNGNNKNDDDENDLIKLFKVQLYKYSQH----YFKLKSFPLQVDCFA 176

Query: 182 GATQKSVSVQHVDEIVDWLCTKDSIWGIPLGRCRW 216
            +  + + + H+DE+VDWL T+D IWGIPLG+C+W
Sbjct: 177 HSYNEELCIIHIDELVDWLATQDHIWGIPLGKCQW 211

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.139    0.432 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 23,110,337
Number of extensions: 913192
Number of successful extensions: 2465
Number of sequences better than 10.0: 21
Number of HSP's gapped: 2472
Number of HSP's successfully gapped: 21
Length of query: 232
Length of database: 53,481,399
Length adjustment: 106
Effective length of query: 126
Effective length of database: 41,326,803
Effective search space: 5207177178
Effective search space used: 5207177178
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 64 (29.3 bits)