Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AEL167C1.318ON101884635e-61
Ecym_62891.318ON103893116e-38
KLLA0F01683g1.318ON98803063e-37
SAKL0D06952g1.318ON107772952e-35
TDEL0D018701.318ON100892839e-34
KLTH0H10714g1.318ON106852849e-34
Kwal_14.25861.318ON106742692e-31
ZYRO0G20702g1.318ON140792642e-30
Kpol_1035.251.318ON106802525e-29
TPHA0O014701.318ON100872517e-29
CAGL0I09372g1.318ON103912422e-27
Suva_4.5291.318ON1051002249e-25
NCAS0B074401.318ON110772171e-23
NDAI0B047701.318ON113932172e-23
YBR268W (MRPL37)1.318ON105832152e-23
KNAG0C017701.318ON101882111e-22
Skud_2.4001.318ON105892092e-22
KAFR0C042101.318ON101782065e-22
Smik_2.4111.318ON105892066e-22
TBLA0F013201.318ON111811972e-20
NDAI0I02670singletonON153018614.5
AAR137W5.658ON88849606.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AEL167C
         (101 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AEL167C Chr5 complement(322363..322668) [306 bp, 101 aa] {ON} Sy...   182   5e-61
Ecym_6289 Chr6 (542978..543289) [312 bp, 103 aa] {ON} similar to...   124   6e-38
KLLA0F01683g Chr6 complement(158967..159263) [297 bp, 98 aa] {ON...   122   3e-37
SAKL0D06952g Chr4 complement(576023..576346) [324 bp, 107 aa] {O...   118   2e-35
TDEL0D01870 Chr4 (366206..366508) [303 bp, 100 aa] {ON} Anc_1.31...   113   9e-34
KLTH0H10714g Chr8 complement(924077..924397) [321 bp, 106 aa] {O...   114   9e-34
Kwal_14.2586 s14 complement(823777..824097) [321 bp, 106 aa] {ON...   108   2e-31
ZYRO0G20702g Chr7 complement(1705327..1705749) [423 bp, 140 aa] ...   106   2e-30
Kpol_1035.25 s1035 complement(60631..60951) [321 bp, 106 aa] {ON...   101   5e-29
TPHA0O01470 Chr15 complement(295860..296162) [303 bp, 100 aa] {O...   101   7e-29
CAGL0I09372g Chr9 (901576..901887) [312 bp, 103 aa] {ON} similar...    98   2e-27
Suva_4.529 Chr4 (912965..913282) [318 bp, 105 aa] {ON} YBR268W (...    91   9e-25
NCAS0B07440 Chr2 complement(1405363..1405695) [333 bp, 110 aa] {...    88   1e-23
NDAI0B04770 Chr2 complement(1176179..1176520) [342 bp, 113 aa] {...    88   2e-23
YBR268W Chr2 (741299..741616) [318 bp, 105 aa] {ON}  MRPL37Mitoc...    87   2e-23
KNAG0C01770 Chr3 (349006..349311) [306 bp, 101 aa] {ON} Anc_1.31...    86   1e-22
Skud_2.400 Chr2 (710286..710603) [318 bp, 105 aa] {ON} YBR268W (...    85   2e-22
KAFR0C04210 Chr3 (839148..839453) [306 bp, 101 aa] {ON} Anc_1.31...    84   5e-22
Smik_2.411 Chr2 (727356..727673) [318 bp, 105 aa] {ON} YBR268W (...    84   6e-22
TBLA0F01320 Chr6 complement(332337..332672) [336 bp, 111 aa] {ON...    80   2e-20
NDAI0I02670 Chr9 (625423..630015) [4593 bp, 1530 aa] {ON}              28   4.5  
AAR137W Chr1 (586622..589288) [2667 bp, 888 aa] {ON} Syntenic ho...    28   6.4  

>AEL167C Chr5 complement(322363..322668) [306 bp, 101 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR268W
           (MRPL37)
          Length = 101

 Score =  182 bits (463), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 88/88 (100%), Positives = 88/88 (100%)

Query: 14  VSCRVYDQQAQKAVSSCPAGTPLNLLIKKGGKEPLALEDSDYPEWLWKVLDPEAQAAKLA 73
           VSCRVYDQQAQKAVSSCPAGTPLNLLIKKGGKEPLALEDSDYPEWLWKVLDPEAQAAKLA
Sbjct: 14  VSCRVYDQQAQKAVSSCPAGTPLNLLIKKGGKEPLALEDSDYPEWLWKVLDPEAQAAKLA 73

Query: 74  EDPIKARKKALRRMNREHIKQQNFLAKM 101
           EDPIKARKKALRRMNREHIKQQNFLAKM
Sbjct: 74  EDPIKARKKALRRMNREHIKQQNFLAKM 101

>Ecym_6289 Chr6 (542978..543289) [312 bp, 103 aa] {ON} similar to
           Ashbya gossypii AEL167C
          Length = 103

 Score =  124 bits (311), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 72/89 (80%), Gaps = 1/89 (1%)

Query: 14  VSCRVYDQQAQKAV-SSCPAGTPLNLLIKKGGKEPLALEDSDYPEWLWKVLDPEAQAAKL 72
            + R+ +Q+  KA+ SSCPAGTPLNL IKK GKEP+AL +S+YPEWLW VLDP+ +AAKL
Sbjct: 15  TTLRLAEQKGSKAIISSCPAGTPLNLQIKKTGKEPVALHESEYPEWLWGVLDPQVEAAKL 74

Query: 73  AEDPIKARKKALRRMNREHIKQQNFLAKM 101
            EDP  ARKK LR+MNRE IKQ NFL+++
Sbjct: 75  NEDPFAARKKQLRKMNREKIKQNNFLSRI 103

>KLLA0F01683g Chr6 complement(158967..159263) [297 bp, 98 aa] {ON}
           similar to uniprot|P36532 Saccharomyces cerevisiae
           YBR268W MRPL37 Mitochondrial ribosomal protein of the
           large subunit
          Length = 98

 Score =  122 bits (306), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 64/80 (80%)

Query: 22  QAQKAVSSCPAGTPLNLLIKKGGKEPLALEDSDYPEWLWKVLDPEAQAAKLAEDPIKARK 81
           QA K VSSCPAGTPLNL IKK GKEP+ALEDS+YPEWLW VLD   QA KLA DPIK RK
Sbjct: 19  QAAKIVSSCPAGTPLNLQIKKSGKEPVALEDSEYPEWLWTVLDANVQAEKLAADPIKLRK 78

Query: 82  KALRRMNREHIKQQNFLAKM 101
           K LR  NR +IKQ NFLAK+
Sbjct: 79  KQLRIANRANIKQNNFLAKI 98

>SAKL0D06952g Chr4 complement(576023..576346) [324 bp, 107 aa] {ON}
           similar to uniprot|P36532 Saccharomyces cerevisiae
           YBR268W MRPL37 Mitochondrial ribosomal protein of the
           large subunit
          Length = 107

 Score =  118 bits (295), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 63/77 (81%)

Query: 25  KAVSSCPAGTPLNLLIKKGGKEPLALEDSDYPEWLWKVLDPEAQAAKLAEDPIKARKKAL 84
           K  SSCPAGTPLNL IKK GKE +ALED +YPEWLW VLD +AQ+AKLA+DP K +KK L
Sbjct: 31  KVKSSCPAGTPLNLQIKKSGKETVALEDHEYPEWLWTVLDEKAQSAKLAQDPAKLKKKQL 90

Query: 85  RRMNREHIKQQNFLAKM 101
           R+MNRE IKQ NFL K+
Sbjct: 91  RKMNREKIKQNNFLTKI 107

>TDEL0D01870 Chr4 (366206..366508) [303 bp, 100 aa] {ON} Anc_1.318
           YBR268W
          Length = 100

 Score =  113 bits (283), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 53/89 (59%), Positives = 70/89 (78%), Gaps = 2/89 (2%)

Query: 15  SCRVYDQQAQKAV--SSCPAGTPLNLLIKKGGKEPLALEDSDYPEWLWKVLDPEAQAAKL 72
           +CRV+ Q+    +  SSCPAGT L++ +KK GK+P+ALEDS+YP WLW+VLDPEA+A KL
Sbjct: 12  NCRVFLQETPSTIVKSSCPAGTVLSVNVKKSGKDPVALEDSEYPAWLWEVLDPEARARKL 71

Query: 73  AEDPIKARKKALRRMNREHIKQQNFLAKM 101
           AEDP+K RKK +R+ NR  IKQ NFL ++
Sbjct: 72  AEDPMKLRKKQIRKANRMQIKQNNFLQQL 100

>KLTH0H10714g Chr8 complement(924077..924397) [321 bp, 106 aa] {ON}
           similar to uniprot|P36532 Saccharomyces cerevisiae
           YBR268W MRPL37 Mitochondrial ribosomal protein of the
           large subunit
          Length = 106

 Score =  114 bits (284), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 63/85 (74%), Gaps = 5/85 (5%)

Query: 22  QAQKA-----VSSCPAGTPLNLLIKKGGKEPLALEDSDYPEWLWKVLDPEAQAAKLAEDP 76
           Q QKA     VSSCPAGTPLNL IKK GKEP+ALED +YPEWLW VLD  AQ  KL EDP
Sbjct: 22  QGQKASPSGVVSSCPAGTPLNLQIKKSGKEPVALEDHEYPEWLWTVLDSRAQLKKLQEDP 81

Query: 77  IKARKKALRRMNREHIKQQNFLAKM 101
           +K RKK LR  NR  IKQ NFL+++
Sbjct: 82  LKLRKKQLRSANRNKIKQNNFLSEI 106

>Kwal_14.2586 s14 complement(823777..824097) [321 bp, 106 aa] {ON}
           YBR268W (MRPL37) - Probable mitochondrial protein L37
           [contig 224] FULL
          Length = 106

 Score =  108 bits (269), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 51/74 (68%), Positives = 59/74 (79%)

Query: 28  SSCPAGTPLNLLIKKGGKEPLALEDSDYPEWLWKVLDPEAQAAKLAEDPIKARKKALRRM 87
           SSC AGTPLNL IKK GKEP+ALED +YPEWLW VLD +AQ  KL EDP+K RKK LR  
Sbjct: 33  SSCIAGTPLNLQIKKSGKEPVALEDHEYPEWLWSVLDDKAQLKKLQEDPLKLRKKQLRSA 92

Query: 88  NREHIKQQNFLAKM 101
           NR+ IKQ NFL+++
Sbjct: 93  NRQKIKQNNFLSEI 106

>ZYRO0G20702g Chr7 complement(1705327..1705749) [423 bp, 140 aa]
           {ON} similar to uniprot|P36532 Saccharomyces cerevisiae
           YBR268W MRPL37 Mitochondrial ribosomal protein of the
           large subunit
          Length = 140

 Score =  106 bits (264), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 61/79 (77%)

Query: 23  AQKAVSSCPAGTPLNLLIKKGGKEPLALEDSDYPEWLWKVLDPEAQAAKLAEDPIKARKK 82
            Q   SSCPAGT +N+  KK GK+P+ALED++YP+WLW+VLDPEAQ  KL  DP+K RKK
Sbjct: 62  GQAVKSSCPAGTIINVNTKKSGKDPVALEDNEYPDWLWEVLDPEAQMKKLQADPMKLRKK 121

Query: 83  ALRRMNREHIKQQNFLAKM 101
            LR+ NRE IKQ NFL ++
Sbjct: 122 QLRKDNREKIKQNNFLKQI 140

>Kpol_1035.25 s1035 complement(60631..60951) [321 bp, 106 aa] {ON}
           complement(60631..60951) [321 nt, 107 aa]
          Length = 106

 Score =  101 bits (252), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 62/80 (77%)

Query: 22  QAQKAVSSCPAGTPLNLLIKKGGKEPLALEDSDYPEWLWKVLDPEAQAAKLAEDPIKARK 81
           Q+ K  SSCPAG+ L L IKK GK+P+ALED++YP WLW VLD EAQA  L++DP+  RK
Sbjct: 27  QSLKIQSSCPAGSVLTLNIKKAGKDPVALEDAEYPTWLWTVLDKEAQAEALSKDPLALRK 86

Query: 82  KALRRMNREHIKQQNFLAKM 101
           K LR+ NR++IKQ NFL ++
Sbjct: 87  KKLRQANRKNIKQNNFLKQI 106

>TPHA0O01470 Chr15 complement(295860..296162) [303 bp, 100 aa] {ON}
           Anc_1.318 YBR268W
          Length = 100

 Score =  101 bits (251), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 62/87 (71%)

Query: 15  SCRVYDQQAQKAVSSCPAGTPLNLLIKKGGKEPLALEDSDYPEWLWKVLDPEAQAAKLAE 74
           S  + + QA    SSC AGTPL + + K GK+P+ALEDS+YP WLW VLD  AQAA+L  
Sbjct: 14  SILLQESQANVLKSSCKAGTPLQINVLKTGKDPIALEDSEYPPWLWTVLDKGAQAARLEN 73

Query: 75  DPIKARKKALRRMNREHIKQQNFLAKM 101
           DP+K R+K LRR NR +IKQ NFL ++
Sbjct: 74  DPLKLRRKELRRKNRANIKQNNFLKQI 100

>CAGL0I09372g Chr9 (901576..901887) [312 bp, 103 aa] {ON} similar to
           uniprot|P36532 Saccharomyces cerevisiae YBR268w MRPL37
          Length = 103

 Score = 97.8 bits (242), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 49/91 (53%), Positives = 66/91 (72%), Gaps = 4/91 (4%)

Query: 15  SCRVYDQQAQKAVSSCPAGTPLNLLIKKGGKEPLALEDSDYPEWLWKVLDPEAQAAK--- 71
           S  V   +A++  SSC AGTPL+L +KK GK+P+ALEDS+YPEWLW VLD    AA    
Sbjct: 13  SSVVLRNEAKQIKSSCLAGTPLSLNVKKTGKDPVALEDSEYPEWLWTVLDQTNTAAAAKA 72

Query: 72  -LAEDPIKARKKALRRMNREHIKQQNFLAKM 101
            ++E+ +KARKK +R+ NRE IKQ+NFL ++
Sbjct: 73  PVSEESLKARKKQIRQSNREKIKQRNFLNQL 103

>Suva_4.529 Chr4 (912965..913282) [318 bp, 105 aa] {ON} YBR268W
           (REAL)
          Length = 105

 Score = 90.9 bits (224), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 63/100 (63%), Gaps = 12/100 (12%)

Query: 14  VSCR-------VYDQQAQKAV-SSCPAGTPLNLLIKKGGKEPLALEDSDYPEWLWKVLDP 65
           VSCR        Y++QA K V SSCPAGT LNL I K GK+  ALED +YP WLW VLD 
Sbjct: 6   VSCRWLSTSRVFYNKQAVKVVASSCPAGTSLNLNIWKSGKDAQALEDREYPSWLWSVLDA 65

Query: 66  EAQAAKLAEDP----IKARKKALRRMNREHIKQQNFLAKM 101
           +      A+DP    +  RKK +R+ NR+ IKQ NFL+++
Sbjct: 66  KQAVDHAAKDPEGEALSQRKKNIRKANRQQIKQNNFLSQL 105

>NCAS0B07440 Chr2 complement(1405363..1405695) [333 bp, 110 aa] {ON}
           Anc_1.318 YBR268W
          Length = 110

 Score = 88.2 bits (217), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 60/77 (77%), Gaps = 3/77 (3%)

Query: 28  SSCPAGTPLNLLIKKGGKEPLALEDSDYPEWLWKVLDPEA--QAAKLAEDPIKA-RKKAL 84
           SSC AGT LNL IKK GK+P+ALED++YP WLWKVL+ +A  +A+ L+E  + A RKK L
Sbjct: 33  SSCLAGTSLNLNIKKNGKDPIALEDNEYPAWLWKVLESKAPKEASDLSEQEVLAMRKKQL 92

Query: 85  RRMNREHIKQQNFLAKM 101
           R+ NR+ IKQ NFL+++
Sbjct: 93  RKENRKKIKQNNFLSQL 109

>NDAI0B04770 Chr2 complement(1176179..1176520) [342 bp, 113 aa] {ON}
           Anc_1.318 YBR268W
          Length = 113

 Score = 88.2 bits (217), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 58/93 (62%), Gaps = 7/93 (7%)

Query: 16  CRVYDQQAQKAVSSCPAGTPLNLLIKKGGKEPLALEDSDYPEWLWKVLDPEAQAAKL--- 72
            +V    A +  SSC AGTPLNL IKK GKEP+ALED +YPEWLW VLD +    +    
Sbjct: 21  VKVASTIASEIKSSCLAGTPLNLNIKKTGKEPIALEDKEYPEWLWTVLDTKTANGRAKSG 80

Query: 73  ----AEDPIKARKKALRRMNREHIKQQNFLAKM 101
                E+ + ARK+ LR   R+ IKQ NFL+++
Sbjct: 81  KGTSVEESLLARKRQLRVETRKKIKQNNFLSQI 113

>YBR268W Chr2 (741299..741616) [318 bp, 105 aa] {ON}
           MRPL37Mitochondrial ribosomal protein of the large
           subunit
          Length = 105

 Score = 87.4 bits (215), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 42/83 (50%), Positives = 55/83 (66%), Gaps = 4/83 (4%)

Query: 23  AQKAVSSCPAGTPLNLLIKKGGKEPLALEDSDYPEWLWKVLDPEAQAAKLAEDP----IK 78
            +  VSSCPAGT LNL I K GK+ +ALED +YP WLW VLD +      AEDP    + 
Sbjct: 23  VKSVVSSCPAGTSLNLNIWKSGKDAVALEDKEYPNWLWSVLDSDHVVEHAAEDPEGQALL 82

Query: 79  ARKKALRRMNREHIKQQNFLAKM 101
            R+K +R+ NR+ IKQ NFL+++
Sbjct: 83  KRRKNIRKANRQRIKQNNFLSQL 105

>KNAG0C01770 Chr3 (349006..349311) [306 bp, 101 aa] {ON} Anc_1.318
           YBR268W
          Length = 101

 Score = 85.9 bits (211), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 58/88 (65%), Gaps = 3/88 (3%)

Query: 17  RVYDQQAQKAV--SSCPAGTPLNLLIKKGGKEPLALEDSDYPEWLWKVLDPEAQA-AKLA 73
           RV  Q AQ     SSC AGTPL L I+K G++P+A+ D +YPEWLW VL+P     A   
Sbjct: 14  RVLGQTAQGPAVKSSCLAGTPLKLDIRKDGRDPVAMRDEEYPEWLWHVLEPATGGDASAR 73

Query: 74  EDPIKARKKALRRMNREHIKQQNFLAKM 101
            DP+ AR+K LRR +R  IKQ N+L+++
Sbjct: 74  ADPLAARRKELRRKHRNEIKQSNYLSQL 101

>Skud_2.400 Chr2 (710286..710603) [318 bp, 105 aa] {ON} YBR268W
           (REAL)
          Length = 105

 Score = 85.1 bits (209), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 59/89 (66%), Gaps = 5/89 (5%)

Query: 18  VYDQQAQKAV-SSCPAGTPLNLLIKKGGKEPLALEDSDYPEWLWKVLDPEAQAAKLAED- 75
           +Y++QA K V SSCPAGT LNL I K GK+ LALE+ +YP WLW VLD +       +D 
Sbjct: 17  LYNKQAVKTVVSSCPAGTSLNLNIWKSGKDALALEEKEYPSWLWSVLDNKQDVEHAGQDQ 76

Query: 76  ---PIKARKKALRRMNREHIKQQNFLAKM 101
               +  R+K +R+ NR+ IKQ NFL+++
Sbjct: 77  EGEALLKRRKNIRKANRQRIKQSNFLSQL 105

>KAFR0C04210 Chr3 (839148..839453) [306 bp, 101 aa] {ON} Anc_1.318
           YBR268W
          Length = 101

 Score = 84.0 bits (206), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 56/78 (71%), Gaps = 3/78 (3%)

Query: 27  VSSCPAGTPLNLLIKKGGKEPLALEDSDYPEWLWKVLDPEAQAAKLAEDPIKA---RKKA 83
           VSSCP GTPL L ++KG K PLAL+D +YP WLW VL+ E+   +    PI+    R+K 
Sbjct: 24  VSSCPEGTPLKLGVRKGQKPPLALKDEEYPGWLWSVLNEESANTQKELSPIQELELRRKQ 83

Query: 84  LRRMNREHIKQQNFLAKM 101
           LR++NR+ IKQ+NFL+++
Sbjct: 84  LRKLNRDKIKQKNFLSEL 101

>Smik_2.411 Chr2 (727356..727673) [318 bp, 105 aa] {ON} YBR268W
           (REAL)
          Length = 105

 Score = 84.0 bits (206), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 60/89 (67%), Gaps = 5/89 (5%)

Query: 18  VYDQQAQKAV-SSCPAGTPLNLLIKKGGKEPLALEDSDYPEWLWKVLDPEAQAAKLAEDP 76
           ++++ A K+V SSCPAGT LNL I K GK+ +ALED +YP WLW +L+ E       +DP
Sbjct: 17  LFNKPAVKSVVSSCPAGTSLNLNIWKSGKDAVALEDKEYPNWLWGILNNEQTVEHTTKDP 76

Query: 77  ----IKARKKALRRMNREHIKQQNFLAKM 101
               +  R+K +R+ NR+ IKQ NFL+++
Sbjct: 77  EGEALLKRRKNIRKANRQRIKQNNFLSQL 105

>TBLA0F01320 Chr6 complement(332337..332672) [336 bp, 111 aa] {ON}
           Anc_1.318 YBR268W
          Length = 111

 Score = 80.5 bits (197), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 42/81 (51%), Positives = 51/81 (62%), Gaps = 2/81 (2%)

Query: 21  QQAQKAVSSCPAGTPLNLLIKKGGKEPLALEDSDYPEWLWKVLDPEAQAAKLAEDPIKAR 80
           QQA K  SSCPAGT L L + K GK+P+ALED  YP WLW +L P         + I  R
Sbjct: 32  QQAIK--SSCPAGTELRLNVYKDGKDPVALEDEKYPPWLWSILTPSNNKNPSPMEAIAQR 89

Query: 81  KKALRRMNREHIKQQNFLAKM 101
           KK LR+ NR+ IKQ NFL ++
Sbjct: 90  KKVLRKNNRDRIKQNNFLKQL 110

>NDAI0I02670 Chr9 (625423..630015) [4593 bp, 1530 aa] {ON} 
          Length = 1530

 Score = 28.1 bits (61), Expect = 4.5,   Method: Composition-based stats.
 Identities = 8/18 (44%), Positives = 13/18 (72%)

Query: 45   KEPLALEDSDYPEWLWKV 62
            K+P   ED  +P+W+WK+
Sbjct: 1148 KQPPGFEDLQHPDWVWKL 1165

>AAR137W Chr1 (586622..589288) [2667 bp, 888 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR058C (ASE1)
          Length = 888

 Score = 27.7 bits (60), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 23/49 (46%), Gaps = 6/49 (12%)

Query: 43  GGKEPLALEDSDYPEWLWKVLDPEAQAAKLAEDPIKARKKALRRMNREH 91
            G E   +ED ++ EW         Q AKL +  I++  +   R+N EH
Sbjct: 843 AGDESSMMEDKNFTEW------KRLQLAKLNDSSIRSGNELTTRINWEH 885

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.130    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 9,060,570
Number of extensions: 318145
Number of successful extensions: 965
Number of sequences better than 10.0: 25
Number of HSP's gapped: 956
Number of HSP's successfully gapped: 25
Length of query: 101
Length of database: 53,481,399
Length adjustment: 72
Effective length of query: 29
Effective length of database: 45,225,447
Effective search space: 1311537963
Effective search space used: 1311537963
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 59 (27.3 bits)