Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AEL086W3.159ON96094543680.0
KLTH0C08866g3.159ON97296032360.0
KLLA0F24684g3.159ON97396032020.0
Kwal_56.228043.159ON97395931940.0
NCAS0C035303.159ON97794831550.0
SAKL0C08778g3.159ON100398631440.0
KAFR0C010603.159ON97396031280.0
YDL031W (DBP10)3.159ON99598131060.0
Skud_4.2203.159ON100198730860.0
CAGL0K01551g3.159ON96995930830.0
KNAG0K011103.159ON100196030820.0
Smik_4.2043.159ON99898430800.0
NDAI0G028703.159ON99198230680.0
Kpol_1032.113.159ON97797330570.0
Suva_4.2183.159ON100799330400.0
ZYRO0B04972g3.159ON97994829640.0
TPHA0M003303.159ON98183629380.0
TDEL0D046303.159ON96896928910.0
TBLA0B015903.159ON92967518400.0
Kpol_534.535.208ON7523915987e-65
TPHA0N007005.208ON7553915971e-64
ZYRO0B10318g5.208ON7503915933e-64
CAGL0D03124g5.208ON7253905923e-64
KLLA0C14608g5.337ON4873765764e-64
TDEL0E042105.208ON7403915907e-64
YLL008W (DRS1)5.208ON7523935917e-64
Smik_12.555.208ON7353935907e-64
KNAG0B046605.337ON4943765749e-64
NDAI0C042505.337ON5043765731e-63
Ecym_32175.337ON4863765721e-63
KLLA0F15752g5.208ON7483935872e-63
NCAS0A015505.208ON7483905872e-63
KAFR0C064205.208ON7393905829e-63
NCAS0F027905.337ON5023765661e-62
Skud_12.595.208ON7583905802e-62
TBLA0C061605.208ON7573905802e-62
KNAG0H025205.208ON7543915784e-62
NDAI0C024905.208ON7713915784e-62
AAL164C5.208ON7343925765e-62
TDEL0E028905.337ON5013765609e-62
ZYRO0C14234g5.337ON4943765581e-61
Suva_10.675.208ON7443945732e-61
SAKL0G09328g5.337ON5053775572e-61
TPHA0D019905.337ON4983765554e-61
SAKL0G12760g5.208ON7373915704e-61
Kpol_1005.115.337ON5063765545e-61
Smik_8.1365.337ON5013765546e-61
Kwal_33.143255.337ON5003765537e-61
YHR065C (RRP3)5.337ON5013765537e-61
AAL041C5.337ON4873775511e-60
KLTH0B03278g5.208ON7393905642e-60
Skud_8.1225.337ON5033765502e-60
Kwal_33.151655.208ON7313915632e-60
KLTH0F07106g5.337ON5253765487e-60
CAGL0J10912g5.337ON4933765458e-60
Suva_15.2545.337ON5033765451e-59
TBLA0C035005.337ON5063765423e-59
TDEL0G014206.204ON5123785212e-56
CAGL0H03377g6.204ON5403785181e-55
ZYRO0G08580g6.204ON5393795134e-55
KAFR0B045602.164ON5433885111e-54
Smik_7.2056.204ON5223775091e-54
YGL078C (DBP3)6.204ON5233905081e-54
Kwal_14.16536.148ON6883835171e-54
Suva_7.1926.204ON5183905062e-54
Skud_7.2046.204ON5163905053e-54
CAGL0L03846g2.164ON5443875031e-53
TDEL0B040606.148ON8473945125e-53
KLLA0F01034g8.614ON6274045026e-53
NCAS0G025602.164ON5563884961e-52
ZYRO0B09856g2.164ON5403884951e-52
NCAS0D037406.204ON5193784931e-52
NDAI0I011506.204ON5233854931e-52
NCAS0C017208.614ON6404015002e-52
NDAI0F027402.164ON5613884952e-52
TBLA0C055802.164ON5403874932e-52
KNAG0F020506.204ON5333784923e-52
TPHA0B028508.614ON6284044973e-52
Suva_16.1918.614ON6184044964e-52
NDAI0F020106.148ON8883845064e-52
TDEL0F011902.164ON5493874914e-52
Skud_15.3708.614ON6094014946e-52
Ecym_54222.164ON5603884916e-52
CAGL0L02915g8.614ON6174014947e-52
Suva_8.2578.614ON6184014937e-52
CAGL0J06908g8.614ON6044054928e-52
TPHA0E024106.204ON5233944888e-52
Ecym_22696.148ON8773905039e-52
YNL112W (DBP2)2.164ON5463854881e-51
AFL027C6.148ON8163834992e-51
NCAS0B017308.614ON6184024902e-51
KLTH0D09328g2.164ON5513914862e-51
YOR204W (DED1)8.614ON6044014892e-51
Smik_14.2152.164ON5473854853e-51
NDAI0E024308.614ON6614044913e-51
Smik_15.3908.614ON6094014883e-51
KLLA0C15499g6.204ON5043764823e-51
ZYRO0A02948g8.469ON5573854844e-51
KAFR0G020308.614ON6064014866e-51
NDAI0E015908.614ON6084004867e-51
Suva_14.2262.164ON5433884827e-51
Kpol_1033.406.204ON5303814809e-51
AFL080W6.204ON5353784809e-51
TDEL0A055908.614ON5973994841e-50
TBLA0B042008.614ON6314014851e-50
ADL273C8.614ON6234004841e-50
Kpol_1072.508.614ON6504014842e-50
Smik_6.3188.614ON6134024822e-50
KLTH0D09746g8.614ON6214014832e-50
SAKL0H08162g8.614ON6244014832e-50
KLTH0H05852g6.148ON8113854884e-50
KAFR0C022206.204ON5113794744e-50
KNAG0H015208.614ON6214064805e-50
KLLA0F23716g2.164ON5543874748e-50
ZYRO0F10934g8.614ON6034014779e-50
ZYRO0G14960g6.148ON8313874841e-49
NCAS0E039205.69ON4373984633e-49
YBR237W (PRP5)6.148ON8493874823e-49
TBLA0D035206.148ON8893864824e-49
KLLA0F10505g6.148ON8123834779e-49
Smik_8.2535.69ON4373994571e-48
SAKL0E10670g2.164ON5743884652e-48
NDAI0B009005.69ON4363984562e-48
Skud_8.2335.69ON4373984562e-48
KAFR0B044805.69ON4353984562e-48
Ecym_82988.614ON6384044682e-48
Kpol_534.316.148ON8723874744e-48
TPHA0N011306.148ON8773834735e-48
KNAG0A032808.614ON6074024635e-48
Suva_15.3695.69ON4373984536e-48
TBLA0D028008.469ON5873994619e-48
Kwal_56.247605.69ON4333944511e-47
Kwal_27.117348.469ON5713934581e-47
YHR169W (DBP8)5.69ON4313984492e-47
Suva_4.4946.148ON8503854682e-47
CAGL0K11198g8.469ON5823944582e-47
KAFR0E028108.469ON5683854562e-47
Smik_2.3806.148ON8503874663e-47
KLLA0C15433g8.469ON5393874533e-47
TBLA0E041008.614ON8664124664e-47
KLTH0H00638g5.69ON4333944464e-47
CAGL0I02354g5.69ON4373934457e-47
KAFR0G034806.148ON8523834637e-47
KLTH0E10890g8.469ON5893994547e-47
TDEL0E038505.241ON7613944608e-47
Ecym_13958.469ON5653864529e-47
NCAS0B025708.469ON5903934539e-47
Skud_2.3696.148ON8483854629e-47
KAFR0E016405.241ON7603854591e-46
KLLA0A05203g5.69ON4353944421e-46
AFL221C2.164ON5573904492e-46
TDEL0G009305.69ON4363984394e-46
YDR243C (PRP28)8.469ON5883964485e-46
KNAG0M006606.148ON8843834575e-46
CAGL0K07029g6.148ON8163844556e-46
SAKL0G11748g5.241ON7633874538e-46
Ecym_47553.249ON3983824331e-45
TPHA0H011605.69ON4333984361e-45
KLLA0A10659g3.249ON3983824331e-45
NCAS0H012806.148ON8873794541e-45
NCAS0A104303.249ON3993834321e-45
Kpol_1062.55.69ON4313984323e-45
TPHA0M009003.249ON4003814293e-45
KLLA0D09504g5.241ON7703944466e-45
ZYRO0A03476g3.249ON3993834277e-45
AER301C5.69ON4353984298e-45
TBLA0D034005.241ON7753904441e-44
NDAI0C063008.87ON6145774372e-44
SAKL0D03960g3.249ON3983824242e-44
AGR333C5.40ON5043924312e-44
ZYRO0C11660g5.69ON4353934253e-44
SAKL0H11968g8.469ON5663944324e-44
Kpol_1036.33.249ON3993834214e-44
YJL033W (HCA4)5.241ON7703884379e-44
TBLA0I018603.249ON3873834171e-43
TDEL0D037603.249ON3983834171e-43
CAGL0M06567g3.249ON3993874172e-43
Skud_4.5058.469ON6043974282e-43
Skud_10.1895.241ON7703874342e-43
KLTH0A02244g8.87ON5984014273e-43
ZYRO0A10802g5.241ON7713954333e-43
KAFR0B015205.40ON4963914213e-43
Ecym_73248.87ON5973904263e-43
NDAI0A058603.249ON3993834144e-43
YDR021W (FAL1)3.249ON3993834144e-43
Skud_4.2733.249ON3993834134e-43
CAGL0L08976g8.87ON6174004264e-43
Kpol_1058.438.87ON6074094255e-43
Suva_2.1713.249ON3993834125e-43
TPHA0C018608.469ON6073954246e-43
Suva_2.4098.469ON5893964228e-43
KLTH0G07766g5.241ON7644754289e-43
KAFR0E011603.249ON4053934119e-43
KNAG0H013703.249ON3983884101e-42
Smik_4.4908.469ON5873964211e-42
TDEL0B016708.469ON5793984202e-42
Ecym_47755.40ON5003934152e-42
Smik_4.2553.249ON3993834082e-42
KAFR0D011208.87ON6105324202e-42
Kpol_165.12.164ON4413494112e-42
KLTH0C07964g3.249ON3983824064e-42
Smik_6.818.87ON6063894184e-42
Kwal_26.84702.164ON4253544059e-42
SAKL0A06204g6.148ON8432274211e-41
ZYRO0F04312g8.87ON6023994131e-41
TPHA0B029302.164ON4273494041e-41
KAFR0D046305.337ON4872204072e-41
YOR046C (DBP5)5.643ON4823954035e-41
Smik_15.2245.643ON4773954017e-41
KNAG0A041308.469ON6093954087e-41
Skud_6.728.87ON6063894061e-40
Suva_8.985.643ON4823953992e-40
AER408W3.249ON3983863932e-40
Suva_6.598.87ON6063924042e-40
KNAG0L004108.87ON6134034033e-40
Skud_15.2105.643ON4823953973e-40
Kpol_1007.108.469ON6053974033e-40
ZYRO0B05852g3.122ON7514234074e-40
Kwal_23.51258.87ON5984064014e-40
ZYRO0E02530g8.124ON5564003971e-39
Kwal_23.42885.40ON4923913931e-39
YFL002C (SPB4)8.87ON6063913981e-39
Skud_14.2192.164ON4353493891e-39
TBLA0H032408.402ON7674164003e-39
TBLA0C006908.87ON6044073953e-39
TDEL0C011608.87ON6035503901e-38
ACR253C1.211ON3963703782e-38
SAKL0B02794g8.87ON5983983864e-38
Kpol_473.75.643ON4783823797e-38
TPHA0J012305.643ON4913833797e-38
Kpol_340.28.402ON6703973869e-38
NCAS0G006105.643ON4713953779e-38
ZYRO0B15576g5.643ON4914013789e-38
TPHA0D009408.124ON5703983829e-38
KLLA0C11253g3.122ON7964273881e-37
KLLA0F15950g5.643ON4693833742e-37
KLLA0A05731g1.211ON3963673684e-37
AGL112C8.402ON6583963804e-37
CAGL0F05577g8.402ON6664113804e-37
KAFR0C060905.643ON4743973725e-37
TPHA0B030401.211ON3963673676e-37
SAKL0C10296g3.122ON8124253801e-36
Ecym_51961.211ON3963703651e-36
TBLA0J008905.643ON4983863691e-36
TPHA0N009405.241ON7711963772e-36
TDEL0F052608.402ON6554133742e-36
Kwal_23.32358.402ON6763963752e-36
KLTH0F08382g8.402ON6573993733e-36
Ecym_54885.643ON4823833663e-36
SAKL0G01496g5.643ON4803833654e-36
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AEL086W
         (960 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AEL086W Chr5 (464521..467403) [2883 bp, 960 aa] {ON} Syntenic ho...  1687   0.0  
KLTH0C08866g Chr3 (742559..745477) [2919 bp, 972 aa] {ON} highly...  1251   0.0  
KLLA0F24684g Chr6 complement(2294708..2297629) [2922 bp, 973 aa]...  1238   0.0  
Kwal_56.22804 s56 complement(286570..289491) [2922 bp, 973 aa] {...  1234   0.0  
NCAS0C03530 Chr3 (703955..706888) [2934 bp, 977 aa] {ON} Anc_3.159   1219   0.0  
SAKL0C08778g Chr3 (804617..807628) [3012 bp, 1003 aa] {ON} simil...  1215   0.0  
KAFR0C01060 Chr3 complement(215822..218743) [2922 bp, 973 aa] {O...  1209   0.0  
YDL031W Chr4 (394217..397204) [2988 bp, 995 aa] {ON}  DBP10Putat...  1201   0.0  
Skud_4.220 Chr4 (389016..392021) [3006 bp, 1001 aa] {ON} YDL031W...  1193   0.0  
CAGL0K01551g Chr11 (136421..139330) [2910 bp, 969 aa] {ON} highl...  1192   0.0  
KNAG0K01110 Chr11 (215540..218545) [3006 bp, 1001 aa] {ON} Anc_3...  1191   0.0  
Smik_4.204 Chr4 (374339..377335) [2997 bp, 998 aa] {ON} YDL031W ...  1191   0.0  
NDAI0G02870 Chr7 (664526..667501) [2976 bp, 991 aa] {ON}             1186   0.0  
Kpol_1032.11 s1032 complement(27093..30026) [2934 bp, 977 aa] {O...  1182   0.0  
Suva_4.218 Chr4 (384623..387646) [3024 bp, 1007 aa] {ON} YDL031W...  1175   0.0  
ZYRO0B04972g Chr2 complement(401735..404674) [2940 bp, 979 aa] {...  1146   0.0  
TPHA0M00330 Chr13 complement(61976..64921) [2946 bp, 981 aa] {ON}    1136   0.0  
TDEL0D04630 Chr4 complement(849268..852174) [2907 bp, 968 aa] {O...  1118   0.0  
TBLA0B01590 Chr2 (349441..352230) [2790 bp, 929 aa] {ON} Anc_3.1...   713   0.0  
Kpol_534.53 s534 (137204..139462) [2259 bp, 752 aa] {ON} (137204...   234   7e-65
TPHA0N00700 Chr14 (157186..159453) [2268 bp, 755 aa] {ON} Anc_5....   234   1e-64
ZYRO0B10318g Chr2 complement(808717..810969) [2253 bp, 750 aa] {...   233   3e-64
CAGL0D03124g Chr4 complement(321029..323206) [2178 bp, 725 aa] {...   232   3e-64
KLLA0C14608g Chr3 (1276354..1277817) [1464 bp, 487 aa] {ON} high...   226   4e-64
TDEL0E04210 Chr5 complement(786151..788373) [2223 bp, 740 aa] {O...   231   7e-64
YLL008W Chr12 (131729..133987) [2259 bp, 752 aa] {ON}  DRS1Nucle...   232   7e-64
Smik_12.55 Chr12 (118743..120950) [2208 bp, 735 aa] {ON} YLL008W...   231   7e-64
KNAG0B04660 Chr2 complement(900857..902341) [1485 bp, 494 aa] {O...   225   9e-64
NDAI0C04250 Chr3 (968216..969730) [1515 bp, 504 aa] {ON} Anc_5.337    225   1e-63
Ecym_3217 Chr3 complement(411925..413385) [1461 bp, 486 aa] {ON}...   224   1e-63
KLLA0F15752g Chr6 (1454735..1456981) [2247 bp, 748 aa] {ON} simi...   230   2e-63
NCAS0A01550 Chr1 complement(302857..305103) [2247 bp, 748 aa] {O...   230   2e-63
KAFR0C06420 Chr3 complement(1286002..1288221) [2220 bp, 739 aa] ...   228   9e-63
NCAS0F02790 Chr6 (561303..562811) [1509 bp, 502 aa] {ON} Anc_5.337    222   1e-62
Skud_12.59 Chr12 (122973..125249) [2277 bp, 758 aa] {ON} YLL008W...   228   2e-62
TBLA0C06160 Chr3 (1494579..1496852) [2274 bp, 757 aa] {ON} Anc_5...   228   2e-62
KNAG0H02520 Chr8 complement(463527..465791) [2265 bp, 754 aa] {O...   227   4e-62
NDAI0C02490 Chr3 complement(570276..572591) [2316 bp, 771 aa] {O...   227   4e-62
AAL164C Chr1 complement(55223..57427) [2205 bp, 734 aa] {ON} Syn...   226   5e-62
TDEL0E02890 Chr5 (550708..552213) [1506 bp, 501 aa] {ON} Anc_5.3...   220   9e-62
ZYRO0C14234g Chr3 complement(1116350..1117834) [1485 bp, 494 aa]...   219   1e-61
Suva_10.67 Chr10 (136688..138922) [2235 bp, 744 aa] {ON} YLL008W...   225   2e-61
SAKL0G09328g Chr7 (797795..799312) [1518 bp, 505 aa] {ON} highly...   219   2e-61
TPHA0D01990 Chr4 complement(411607..413103) [1497 bp, 498 aa] {O...   218   4e-61
SAKL0G12760g Chr7 complement(1088344..1090557) [2214 bp, 737 aa]...   224   4e-61
Kpol_1005.11 s1005 complement(18157..19677) [1521 bp, 506 aa] {O...   218   5e-61
Smik_8.136 Chr8 complement(202825..204330) [1506 bp, 501 aa] {ON...   218   6e-61
Kwal_33.14325 s33 (619599..621101) [1503 bp, 500 aa] {ON} YHR065...   217   7e-61
YHR065C Chr8 complement(227532..229037) [1506 bp, 501 aa] {ON}  ...   217   7e-61
AAL041C Chr1 complement(270739..272202) [1464 bp, 487 aa] {ON} S...   216   1e-60
KLTH0B03278g Chr2 complement(257395..259614) [2220 bp, 739 aa] {...   221   2e-60
Skud_8.122 Chr8 complement(200848..202359) [1512 bp, 503 aa] {ON...   216   2e-60
Kwal_33.15165 s33 (987878..990073) [2196 bp, 731 aa] {ON} YLL008...   221   2e-60
KLTH0F07106g Chr6 (618637..620214) [1578 bp, 525 aa] {ON} highly...   215   7e-60
CAGL0J10912g Chr10 (1063600..1065081) [1482 bp, 493 aa] {ON} hig...   214   8e-60
Suva_15.254 Chr15 complement(429201..430712) [1512 bp, 503 aa] {...   214   1e-59
TBLA0C03500 Chr3 complement(835236..836756) [1521 bp, 506 aa] {O...   213   3e-59
TDEL0G01420 Chr7 (287165..288703) [1539 bp, 512 aa] {ON} Anc_6.2...   205   2e-56
CAGL0H03377g Chr8 complement(313755..315377) [1623 bp, 540 aa] {...   204   1e-55
ZYRO0G08580g Chr7 complement(695127..696746) [1620 bp, 539 aa] {...   202   4e-55
KAFR0B04560 Chr2 complement(947248..947615,948264..949527) [1632...   201   1e-54
Smik_7.205 Chr7 complement(354693..356261) [1569 bp, 522 aa] {ON...   200   1e-54
YGL078C Chr7 complement(360288..361859) [1572 bp, 523 aa] {ON}  ...   200   1e-54
Kwal_14.1653 s14 complement(406891..408957) [2067 bp, 688 aa] {O...   203   1e-54
Suva_7.192 Chr7 complement(353138..354694) [1557 bp, 518 aa] {ON...   199   2e-54
Skud_7.204 Chr7 complement(363553..365103) [1551 bp, 516 aa] {ON...   199   3e-54
CAGL0L03846g Chr12 complement(443677..444047,445148..446411) [16...   198   1e-53
TDEL0B04060 Chr2 complement(724075..726618) [2544 bp, 847 aa] {O...   201   5e-53
KLLA0F01034g Chr6 (93422..95305) [1884 bp, 627 aa] {ON} similar ...   197   6e-53
NCAS0G02560 Chr7 (457574..458852,459621..460012) [1671 bp, 556 a...   195   1e-52
ZYRO0B09856g Chr2 complement(769104..769462,770138..771401) [162...   195   1e-52
NCAS0D03740 Chr4 complement(694809..696368) [1560 bp, 519 aa] {O...   194   1e-52
NDAI0I01150 Chr9 (278832..280403) [1572 bp, 523 aa] {ON} Anc_6.204    194   1e-52
NCAS0C01720 Chr3 complement(317951..319873) [1923 bp, 640 aa] {O...   197   2e-52
NDAI0F02740 Chr6 complement(670654..671051,672039..673326) [1686...   195   2e-52
TBLA0C05580 Chr3 (1351338..1352610,1353450..1353799) [1623 bp, 5...   194   2e-52
KNAG0F02050 Chr6 (392126..393727) [1602 bp, 533 aa] {ON} Anc_6.2...   194   3e-52
TPHA0B02850 Chr2 complement(650888..652774) [1887 bp, 628 aa] {O...   196   3e-52
Suva_16.191 Chr16 complement(333913..335769) [1857 bp, 618 aa] {...   195   4e-52
NDAI0F02010 Chr6 (492540..495206) [2667 bp, 888 aa] {ON} Anc_6.148    199   4e-52
TDEL0F01190 Chr6 (211677..212937,213454..213842) [1650 bp, 549 a...   193   4e-52
Skud_15.370 Chr15 (661915..663744) [1830 bp, 609 aa] {ON} YOR204...   194   6e-52
Ecym_5422 Chr5 complement(868686..869065,869897..871199) [1683 b...   193   6e-52
CAGL0L02915g Chr12 complement(342831..344684) [1854 bp, 617 aa] ...   194   7e-52
Suva_8.257 Chr8 (461776..463632) [1857 bp, 618 aa] {ON} YOR204W ...   194   7e-52
CAGL0J06908g Chr10 complement(662041..663855) [1815 bp, 604 aa] ...   194   8e-52
TPHA0E02410 Chr5 (512919..514490) [1572 bp, 523 aa] {ON} Anc_6.2...   192   8e-52
Ecym_2269 Chr2 complement(527849..530482) [2634 bp, 877 aa] {ON}...   198   9e-52
YNL112W Chr14 (413639..414911,415914..416281) [1641 bp, 546 aa] ...   192   1e-51
AFL027C Chr6 complement(386001..388451) [2451 bp, 816 aa] {ON} S...   196   2e-51
NCAS0B01730 Chr2 complement(286249..288105) [1857 bp, 618 aa] {O...   193   2e-51
KLTH0D09328g Chr4 complement(773449..773837,774557..775823) [165...   191   2e-51
YOR204W Chr15 (722911..724725) [1815 bp, 604 aa] {ON}  DED1ATP-d...   192   2e-51
Smik_14.215 Chr14 (393283..394555,395537..395907) [1644 bp, 547 ...   191   3e-51
NDAI0E02430 Chr5 complement(503901..505886) [1986 bp, 661 aa] {O...   193   3e-51
Smik_15.390 Chr15 (672576..674405) [1830 bp, 609 aa] {ON} YOR204...   192   3e-51
KLLA0C15499g Chr3 complement(1345201..1346715) [1515 bp, 504 aa]...   190   3e-51
ZYRO0A02948g Chr1 (240353..242026) [1674 bp, 557 aa] {ON} simila...   191   4e-51
KAFR0G02030 Chr7 complement(428516..430336) [1821 bp, 606 aa] {O...   191   6e-51
NDAI0E01590 Chr5 complement(315658..317484) [1827 bp, 608 aa] {O...   191   7e-51
Suva_14.226 Chr14 (410416..411691,412742..413097) [1632 bp, 543 ...   190   7e-51
Kpol_1033.40 s1033 complement(104203..105795) [1593 bp, 530 aa] ...   189   9e-51
AFL080W Chr6 (288205..289812) [1608 bp, 535 aa] {ON} Syntenic ho...   189   9e-51
TDEL0A05590 Chr1 (980392..982185) [1794 bp, 597 aa] {ON} Anc_8.6...   191   1e-50
TBLA0B04200 Chr2 complement(970057..971952) [1896 bp, 631 aa] {O...   191   1e-50
ADL273C Chr4 complement(225068..226939) [1872 bp, 623 aa] {ON} S...   191   1e-50
Kpol_1072.50 s1072 complement(115009..116961) [1953 bp, 650 aa] ...   191   2e-50
Smik_6.318 Chr6 (498013..499854) [1842 bp, 613 aa] {ON} YPL119C ...   190   2e-50
KLTH0D09746g Chr4 (805863..807728) [1866 bp, 621 aa] {ON} simila...   190   2e-50
SAKL0H08162g Chr8 complement(702292..704166) [1875 bp, 624 aa] {...   190   2e-50
KLTH0H05852g Chr8 complement(514352..516787) [2436 bp, 811 aa] {...   192   4e-50
KAFR0C02220 Chr3 complement(439704..441239) [1536 bp, 511 aa] {O...   187   4e-50
KNAG0H01520 Chr8 complement(267709..269574) [1866 bp, 621 aa] {O...   189   5e-50
KLLA0F23716g Chr6 complement(2215454..2215845,2216857..2218129) ...   187   8e-50
ZYRO0F10934g Chr6 (890412..892223) [1812 bp, 603 aa] {ON} simila...   188   9e-50
ZYRO0G14960g Chr7 (1201495..1203990) [2496 bp, 831 aa] {ON} simi...   191   1e-49
NCAS0E03920 Chr5 complement(769305..770618) [1314 bp, 437 aa] {O...   182   3e-49
YBR237W Chr2 (691969..694518) [2550 bp, 849 aa] {ON}  PRP5RNA he...   190   3e-49
TBLA0D03520 Chr4 (873710..876379) [2670 bp, 889 aa] {ON} Anc_6.1...   190   4e-49
KLLA0F10505g Chr6 complement(966736..969174) [2439 bp, 812 aa] {...   188   9e-49
Smik_8.253 Chr8 (419155..420468) [1314 bp, 437 aa] {ON} YHR169W ...   180   1e-48
SAKL0E10670g Chr5 complement(888829..889205,889934..891281) [172...   183   2e-48
NDAI0B00900 Chr2 complement(209012..210322) [1311 bp, 436 aa] {O...   180   2e-48
Skud_8.233 Chr8 (413556..414869) [1314 bp, 437 aa] {ON} YHR169W ...   180   2e-48
KAFR0B04480 Chr2 complement(929008..930315) [1308 bp, 435 aa] {O...   180   2e-48
Ecym_8298 Chr8 (605258..607174) [1917 bp, 638 aa] {ON} similar t...   184   2e-48
Kpol_534.31 s534 complement(73551..76169) [2619 bp, 872 aa] {ON}...   187   4e-48
TPHA0N01130 Chr14 complement(237020..239653) [2634 bp, 877 aa] {...   186   5e-48
KNAG0A03280 Chr1 complement(416099..417922) [1824 bp, 607 aa] {O...   182   5e-48
Suva_15.369 Chr15 (648232..649545) [1314 bp, 437 aa] {ON} YHR169...   179   6e-48
TBLA0D02800 Chr4 (686898..688661) [1764 bp, 587 aa] {ON} Anc_8.4...   182   9e-48
Kwal_56.24760 s56 (1136947..1138248) [1302 bp, 433 aa] {ON} YHR1...   178   1e-47
Kwal_27.11734 s27 complement(923899..925614) [1716 bp, 571 aa] {...   181   1e-47
YHR169W Chr8 (442181..443476) [1296 bp, 431 aa] {ON}  DBP8ATPase...   177   2e-47
Suva_4.494 Chr4 (862220..864772) [2553 bp, 850 aa] {ON} YBR237W ...   184   2e-47
CAGL0K11198g Chr11 complement(1087381..1089129) [1749 bp, 582 aa...   181   2e-47
KAFR0E02810 Chr5 complement(567875..569581) [1707 bp, 568 aa] {O...   180   2e-47
Smik_2.380 Chr2 (678057..680609) [2553 bp, 850 aa] {ON} YBR237W ...   184   3e-47
KLLA0C15433g Chr3 complement(1339439..1341058) [1620 bp, 539 aa]...   179   3e-47
TBLA0E04100 Chr5 (1032727..1035327) [2601 bp, 866 aa] {ON} Anc_8...   184   4e-47
KLTH0H00638g Chr8 complement(64621..65922) [1302 bp, 433 aa] {ON...   176   4e-47
CAGL0I02354g Chr9 (209279..210592) [1314 bp, 437 aa] {ON} highly...   176   7e-47
KAFR0G03480 Chr7 (718012..720570) [2559 bp, 852 aa] {ON} Anc_6.1...   182   7e-47
KLTH0E10890g Chr5 complement(976948..978717) [1770 bp, 589 aa] {...   179   7e-47
TDEL0E03850 Chr5 complement(723551..725836) [2286 bp, 761 aa] {O...   181   8e-47
Ecym_1395 Chr1 complement(818424..820121) [1698 bp, 565 aa] {ON}...   178   9e-47
NCAS0B02570 Chr2 (429423..431195) [1773 bp, 590 aa] {ON} Anc_8.469    179   9e-47
Skud_2.369 Chr2 (660665..663211) [2547 bp, 848 aa] {ON} YBR237W ...   182   9e-47
KAFR0E01640 Chr5 complement(335123..337405) [2283 bp, 760 aa] {O...   181   1e-46
KLLA0A05203g Chr1 complement(462167..463474) [1308 bp, 435 aa] {...   174   1e-46
AFL221C Chr6 complement(22711..23108,23775..25050) [1674 bp, 557...   177   2e-46
TDEL0G00930 Chr7 complement(186836..188146) [1311 bp, 436 aa] {O...   173   4e-46
YDR243C Chr4 complement(948518..950284) [1767 bp, 588 aa] {ON}  ...   177   5e-46
KNAG0M00660 Chr13 complement(107772..110426) [2655 bp, 884 aa] {...   180   5e-46
CAGL0K07029g Chr11 complement(690501..692951) [2451 bp, 816 aa] ...   179   6e-46
SAKL0G11748g Chr7 complement(998525..1000816) [2292 bp, 763 aa] ...   179   8e-46
Ecym_4755 Chr4 complement(1469426..1470622) [1197 bp, 398 aa] {O...   171   1e-45
TPHA0H01160 Chr8 (257728..259029) [1302 bp, 433 aa] {ON} Anc_5.6...   172   1e-45
KLLA0A10659g Chr1 complement(927059..928255) [1197 bp, 398 aa] {...   171   1e-45
NCAS0H01280 Chr8 complement(243749..246412) [2664 bp, 887 aa] {O...   179   1e-45
NCAS0A10430 Chr1 (2073293..2074492) [1200 bp, 399 aa] {ON} Anc_3...   171   1e-45
Kpol_1062.5 s1062 complement(10370..11665) [1296 bp, 431 aa] {ON...   171   3e-45
TPHA0M00900 Chr13 (175733..176935) [1203 bp, 400 aa] {ON} Anc_3....   169   3e-45
KLLA0D09504g Chr4 complement(801783..804095) [2313 bp, 770 aa] {...   176   6e-45
ZYRO0A03476g Chr1 complement(277585..278784) [1200 bp, 399 aa] {...   169   7e-45
AER301C Chr5 complement(1188485..1189792) [1308 bp, 435 aa] {ON}...   169   8e-45
TBLA0D03400 Chr4 (844529..846856) [2328 bp, 775 aa] {ON} Anc_5.2...   175   1e-44
NDAI0C06300 Chr3 complement(1459510..1461354) [1845 bp, 614 aa] ...   172   2e-44
SAKL0D03960g Chr4 complement(321960..323156) [1197 bp, 398 aa] {...   167   2e-44
AGR333C Chr7 complement(1353154..1354668) [1515 bp, 504 aa] {ON}...   170   2e-44
ZYRO0C11660g Chr3 (912287..913594) [1308 bp, 435 aa] {ON} highly...   168   3e-44
SAKL0H11968g Chr8 (1022452..1024152) [1701 bp, 566 aa] {ON} simi...   171   4e-44
Kpol_1036.3 s1036 complement(10496..11695) [1200 bp, 399 aa] {ON...   166   4e-44
YJL033W Chr10 (383837..386149) [2313 bp, 770 aa] {ON}  HCA4Putat...   172   9e-44
TBLA0I01860 Chr9 (418583..419746) [1164 bp, 387 aa] {ON} Anc_3.2...   165   1e-43
TDEL0D03760 Chr4 complement(689455..690651) [1197 bp, 398 aa] {O...   165   1e-43
CAGL0M06567g Chr13 complement(679126..680325) [1200 bp, 399 aa] ...   165   2e-43
Skud_4.505 Chr4 complement(903103..904917) [1815 bp, 604 aa] {ON...   169   2e-43
Skud_10.189 Chr10 (351797..354109) [2313 bp, 770 aa] {ON} YJL033...   171   2e-43
KLTH0A02244g Chr1 (190077..191873) [1797 bp, 598 aa] {ON} simila...   169   3e-43
ZYRO0A10802g Chr1 complement(869465..871780) [2316 bp, 771 aa] {...   171   3e-43
KAFR0B01520 Chr2 (286962..288452) [1491 bp, 496 aa] {ON} Anc_5.4...   166   3e-43
Ecym_7324 Chr7 complement(689228..691021) [1794 bp, 597 aa] {ON}...   168   3e-43
NDAI0A05860 Chr1 complement(1331381..1332580) [1200 bp, 399 aa] ...   164   4e-43
YDR021W Chr4 (486804..488003) [1200 bp, 399 aa] {ON}  FAL1Nucleo...   164   4e-43
Skud_4.273 Chr4 (477488..478687) [1200 bp, 399 aa] {ON} YDR021W ...   163   4e-43
CAGL0L08976g Chr12 complement(981008..982861) [1854 bp, 617 aa] ...   168   4e-43
Kpol_1058.43 s1058 complement(121252..123075) [1824 bp, 607 aa] ...   168   5e-43
Suva_2.171 Chr2 (297542..298741) [1200 bp, 399 aa] {ON} YDR021W ...   163   5e-43
TPHA0C01860 Chr3 (425216..427039) [1824 bp, 607 aa] {ON} Anc_8.4...   167   6e-43
Suva_2.409 Chr2 complement(727948..729717) [1770 bp, 589 aa] {ON...   167   8e-43
KLTH0G07766g Chr7 complement(626094..628388) [2295 bp, 764 aa] {...   169   9e-43
KAFR0E01160 Chr5 (232985..234202) [1218 bp, 405 aa] {ON} Anc_3.2...   162   9e-43
KNAG0H01370 Chr8 complement(243799..244995) [1197 bp, 398 aa] {O...   162   1e-42
Smik_4.490 Chr4 complement(893394..895157) [1764 bp, 587 aa] {ON...   166   1e-42
TDEL0B01670 Chr2 (297786..299525) [1740 bp, 579 aa] {ON}              166   2e-42
Ecym_4775 Chr4 (1507889..1509391) [1503 bp, 500 aa] {ON} similar...   164   2e-42
Smik_4.255 Chr4 (467483..468682) [1200 bp, 399 aa] {ON} YDR021W ...   161   2e-42
KAFR0D01120 Chr4 complement(222704..224536) [1833 bp, 610 aa] {O...   166   2e-42
Kpol_165.1 s165 complement(441..1766) [1326 bp, 441 aa] {ON} com...   162   2e-42
KLTH0C07964g Chr3 complement(679877..681073) [1197 bp, 398 aa] {...   160   4e-42
Smik_6.81 Chr6 complement(152467..154287) [1821 bp, 606 aa] {ON}...   165   4e-42
Kwal_26.8470 s26 complement(798445..799722) [1278 bp, 425 aa] {O...   160   9e-42
SAKL0A06204g Chr1 complement(560276..562807) [2532 bp, 843 aa] {...   166   1e-41
ZYRO0F04312g Chr6 complement(366863..368671) [1809 bp, 602 aa] {...   163   1e-41
TPHA0B02930 Chr2 (666924..668207) [1284 bp, 427 aa] {ON} Anc_6.1...   160   1e-41
KAFR0D04630 Chr4 complement(909161..910624) [1464 bp, 487 aa] {O...   161   2e-41
YOR046C Chr15 complement(414459..415907) [1449 bp, 482 aa] {ON} ...   159   5e-41
Smik_15.224 Chr15 complement(380539..381972) [1434 bp, 477 aa] {...   159   7e-41
KNAG0A04130 Chr1 (559075..560904) [1830 bp, 609 aa] {ON} Anc_8.4...   161   7e-41
Skud_6.72 Chr6 complement(140844..142664) [1821 bp, 606 aa] {ON}...   160   1e-40
Suva_8.98 Chr8 complement(177272..178720) [1449 bp, 482 aa] {ON}...   158   2e-40
AER408W Chr5 (1418694..1419890) [1197 bp, 398 aa] {ON} Syntenic ...   155   2e-40
Suva_6.59 Chr6 complement(110278..112098) [1821 bp, 606 aa] {ON}...   160   2e-40
KNAG0L00410 Chr12 complement(57484..59325) [1842 bp, 613 aa] {ON...   159   3e-40
Skud_15.210 Chr15 complement(374410..375858) [1449 bp, 482 aa] {...   157   3e-40
Kpol_1007.10 s1007 complement(17289..19106) [1818 bp, 605 aa] {O...   159   3e-40
ZYRO0B05852g Chr2 (468295..470550) [2256 bp, 751 aa] {ON} simila...   161   4e-40
Kwal_23.5125 s23 complement(1024642..1026438) [1797 bp, 598 aa] ...   159   4e-40
ZYRO0E02530g Chr5 (197126..198796) [1671 bp, 556 aa] {ON} highly...   157   1e-39
Kwal_23.4288 s23 (654900..656378) [1479 bp, 492 aa] {ON} YMR290C...   155   1e-39
YFL002C Chr6 complement(145114..146934) [1821 bp, 606 aa] {ON}  ...   157   1e-39
Skud_14.219 Chr14 (403781..405088) [1308 bp, 435 aa] {ON} YNL112...   154   1e-39
TBLA0H03240 Chr8 complement(787863..790166) [2304 bp, 767 aa] {O...   158   3e-39
TBLA0C00690 Chr3 complement(136694..138508) [1815 bp, 604 aa] {O...   156   3e-39
TDEL0C01160 Chr3 complement(198802..200613) [1812 bp, 603 aa] {O...   154   1e-38
ACR253C Chr3 complement(802236..803426) [1191 bp, 396 aa] {ON} S...   150   2e-38
SAKL0B02794g Chr2 complement(266645..268441) [1797 bp, 598 aa] {...   153   4e-38
Kpol_473.7 s473 complement(21177..22613) [1437 bp, 478 aa] {ON} ...   150   7e-38
TPHA0J01230 Chr10 complement(289735..291210) [1476 bp, 491 aa] {...   150   7e-38
Kpol_340.2 s340 complement(3233..5245) [2013 bp, 670 aa] {ON} co...   153   9e-38
NCAS0G00610 Chr7 (105992..107407) [1416 bp, 471 aa] {ON} Anc_5.643    149   9e-38
ZYRO0B15576g Chr2 complement(1265375..1266850) [1476 bp, 491 aa]...   150   9e-38
TPHA0D00940 Chr4 complement(186966..188678) [1713 bp, 570 aa] {O...   151   9e-38
KLLA0C11253g Chr3 complement(967067..969457) [2391 bp, 796 aa] {...   154   1e-37
KLLA0F15950g Chr6 (1477113..1478522) [1410 bp, 469 aa] {ON} simi...   148   2e-37
KLLA0A05731g Chr1 (536243..537433) [1191 bp, 396 aa] {ON} highly...   146   4e-37
AGL112C Chr7 complement(495879..497855) [1977 bp, 658 aa] {ON} S...   150   4e-37
CAGL0F05577g Chr6 (559705..561705) [2001 bp, 666 aa] {ON} simila...   150   4e-37
KAFR0C06090 Chr3 complement(1208993..1210417) [1425 bp, 474 aa] ...   147   5e-37
TPHA0B03040 Chr2 complement(690810..692000) [1191 bp, 396 aa] {O...   145   6e-37
SAKL0C10296g Chr3 complement(927939..930377) [2439 bp, 812 aa] {...   150   1e-36
Ecym_5196 Chr5 complement(405570..406760) [1191 bp, 396 aa] {ON}...   145   1e-36
TBLA0J00890 Chr10 complement(199404..200900) [1497 bp, 498 aa] {...   146   1e-36
TPHA0N00940 Chr14 (202770..205085) [2316 bp, 771 aa] {ON} Anc_5....   149   2e-36
TDEL0F05260 Chr6 complement(983324..985291) [1968 bp, 655 aa] {O...   148   2e-36
Kwal_23.3235 s23 (209691..211721) [2031 bp, 676 aa] {ON} YDR194C...   149   2e-36
KLTH0F08382g Chr6 (724794..726767) [1974 bp, 657 aa] {ON} simila...   148   3e-36
Ecym_5488 Chr5 (998651..1000099) [1449 bp, 482 aa] {ON} similar ...   145   3e-36
SAKL0G01496g Chr7 (125044..125050,125133..126568) [1443 bp, 480 ...   145   4e-36
SAKL0H13574g Chr8 (1161196..1163202) [2007 bp, 668 aa] {ON} simi...   147   4e-36
Kpol_1060.58 s1060 complement(135570..136760) [1191 bp, 396 aa] ...   143   5e-36
TDEL0H00930 Chr8 complement(152864..154051) [1188 bp, 395 aa] {O...   143   5e-36
TPHA0D00770 Chr4 (155185..157002) [1818 bp, 605 aa] {ON} Anc_8.8...   147   5e-36
KLTH0F17050g Chr6 complement(1380459..1381888,1381971..1381977) ...   144   6e-36
Skud_2.270 Chr2 (496096..498402) [2307 bp, 768 aa] {ON} YBR142W ...   148   7e-36
NCAS0A14060 Chr1 (2765451..2766983) [1533 bp, 510 aa] {ON} Anc_7...   144   7e-36
KNAG0F02610 Chr6 complement(488956..491244) [2289 bp, 762 aa] {O...   147   7e-36
Ecym_8261 Chr8 complement(528229..530556) [2328 bp, 775 aa] {ON}...   147   9e-36
ADL024C Chr4 complement(657270..658979) [1710 bp, 569 aa] {ON} S...   145   1e-35
NCAS0A01400 Chr1 (274080..276368) [2289 bp, 762 aa] {ON} Anc_5.241    147   1e-35
Smik_10.94 Chr10 complement(151257..152444) [1188 bp, 395 aa] {O...   142   1e-35
Smik_11.321 Chr11 (544869..546056) [1188 bp, 395 aa] {ON} YKR059...   142   1e-35
SAKL0F11088g Chr6 complement(866571..868064) [1494 bp, 497 aa] {...   144   1e-35
KLTH0F05610g Chr6 complement(483243..484433) [1191 bp, 396 aa] {...   141   2e-35
YJL138C Chr10 complement(153504..154691) [1188 bp, 395 aa] {ON} ...   141   2e-35
YKR059W Chr11 (554987..556174) [1188 bp, 395 aa] {ON}  TIF1Trans...   141   2e-35
NDAI0F00700 Chr6 (170569..171699) [1131 bp, 376 aa] {ON} Anc_5.643    140   2e-35
Skud_10.76 Chr10 complement(128551..129738) [1188 bp, 395 aa] {O...   140   3e-35
ZYRO0D03058g Chr4 complement(237526..238713) [1188 bp, 395 aa] {...   140   3e-35
TDEL0D05010 Chr4 (911771..914023) [2253 bp, 750 aa] {ON} Anc_3.1...   145   3e-35
Ecym_4165 Chr4 (350595..352571) [1977 bp, 658 aa] {ON} similar t...   145   3e-35
AER027W Chr5 (685709..687967) [2259 bp, 752 aa] {ON} Syntenic ho...   145   4e-35
Suva_11.294 Chr11 (539139..540329) [1191 bp, 396 aa] {ON} YKR059...   140   4e-35
Kwal_33.14000 s33 complement(477253..478443) [1191 bp, 396 aa] {...   140   4e-35
Kwal_56.23164 s56 (430116..432539) [2424 bp, 807 aa] {ON} YBR142...   145   5e-35
ZYRO0C04378g Chr3 complement(342717..344762) [2046 bp, 681 aa] {...   144   6e-35
Suva_6.218 Chr6 (395411..396601) [1191 bp, 396 aa] {ON} YJL138C ...   139   6e-35
Ecym_4646 Chr4 complement(1259564..1261036) [1473 bp, 490 aa] {O...   142   6e-35
Skud_11.295 Chr11 (536422..537711) [1290 bp, 429 aa] {ON} YKR059...   140   6e-35
TPHA0M00750 Chr13 complement(141794..144082) [2289 bp, 762 aa] {...   145   7e-35
Kwal_56.24005 s56 complement(809954..811555) [1602 bp, 533 aa] {...   142   7e-35
TBLA0D05750 Chr4 (1420975..1422180) [1206 bp, 401 aa] {ON} Anc_1...   139   9e-35
KLTH0H04466g Chr8 (399689..401350) [1662 bp, 553 aa] {ON} simila...   142   1e-34
CAGL0L10021g Chr12 complement(1076197..1077711) [1515 bp, 504 aa...   140   1e-34
KNAG0C01220 Chr3 complement(237478..238671) [1194 bp, 397 aa] {O...   138   1e-34
KAFR0B06170 Chr2 complement(1271195..1273066) [1872 bp, 623 aa] ...   142   1e-34
Skud_16.161 Chr16 complement(295968..297827) [1860 bp, 619 aa] {...   142   2e-34
Smik_4.442 Chr4 complement(801552..803549) [1998 bp, 665 aa] {ON...   142   2e-34
Kwal_55.21609 s55 complement(912148..913269) [1122 bp, 373 aa] {...   137   2e-34
Kwal_23.2883 s23 complement(58087..60381) [2295 bp, 764 aa] {ON}...   143   2e-34
Kpol_2001.67 s2001 (185153..186607) [1455 bp, 484 aa] {ON} (1851...   140   2e-34
Skud_4.458 Chr4 complement(812448..814442) [1995 bp, 664 aa] {ON...   142   2e-34
NDAI0C02320 Chr3 (527244..529538) [2295 bp, 764 aa] {ON} Anc_5.241    143   2e-34
ACR078W Chr3 (501241..502644) [1404 bp, 467 aa] {ON} Syntenic ho...   139   2e-34
NDAI0A01960 Chr1 complement(436462..438066) [1605 bp, 534 aa] {O...   140   2e-34
SAKL0C06336g Chr3 complement(584406..585599) [1194 bp, 397 aa] {...   138   2e-34
YPL119C Chr16 complement(324411..326264) [1854 bp, 617 aa] {ON} ...   142   2e-34
KLLA0C16599g Chr3 (1453655..1455199) [1545 bp, 514 aa] {ON} simi...   140   3e-34
Skud_4.96 Chr4 complement(166027..167550) [1524 bp, 507 aa] {ON}...   140   3e-34
KNAG0K01980 Chr11 (405216..407381) [2166 bp, 721 aa] {ON} Anc_3....   142   4e-34
CAGL0I03476g Chr9 complement(294849..296372) [1524 bp, 507 aa] {...   139   4e-34
Smik_4.77 Chr4 complement(147172..148692) [1521 bp, 506 aa] {ON}...   139   4e-34
Kpol_1004.13 s1004 (25289..27595) [2307 bp, 768 aa] {ON} (25289....   142   5e-34
YDR194C Chr4 complement(845952..847946) [1995 bp, 664 aa] {ON}  ...   141   5e-34
KAFR0G00650 Chr7 complement(164087..165274) [1188 bp, 395 aa] {O...   137   5e-34
KNAG0C03820 Chr3 complement(748934..750475) [1542 bp, 513 aa] {O...   139   6e-34
ACR197W Chr3 (695405..696859) [1455 bp, 484 aa] {ON} Syntenic ho...   138   6e-34
KLLA0A09669g Chr1 complement(847036..848529) [1494 bp, 497 aa] {...   138   7e-34
CAGL0I04356g Chr9 (389225..390415) [1191 bp, 396 aa] {ON} highly...   136   7e-34
TDEL0C02100 Chr3 complement(362760..364199) [1440 bp, 479 aa] {O...   138   7e-34
KLTH0G15840g Chr7 complement(1381355..1383748) [2394 bp, 797 aa]...   141   8e-34
KAFR0H02820 Chr8 (537121..538956) [1836 bp, 611 aa] {ON} Anc_8.6...   140   8e-34
YBR142W Chr2 (528317..530638) [2322 bp, 773 aa] {ON}  MAK5Essent...   141   8e-34
YDL160C Chr4 complement(170410..171930) [1521 bp, 506 aa] {ON}  ...   138   9e-34
NCAS0B08130 Chr2 (1551641..1552831) [1191 bp, 396 aa] {ON} Anc_1...   136   9e-34
Suva_4.86 Chr4 complement(158173..159699) [1527 bp, 508 aa] {ON}...   138   9e-34
KNAG0A04660 Chr1 (663566..665707) [2142 bp, 713 aa] {ON} Anc_8.4...   140   1e-33
Ecym_6049 Chr6 (94618..95934) [1317 bp, 438 aa] {ON} similar to ...   137   1e-33
TPHA0L00960 Chr12 complement(194538..196568) [2031 bp, 676 aa] {...   140   1e-33
CAGL0J01045g Chr10 (101282..103579) [2298 bp, 765 aa] {ON} highl...   140   2e-33
ZYRO0F11440g Chr6 (939613..941184) [1572 bp, 523 aa] {ON} highly...   137   2e-33
TBLA0F02360 Chr6 (582109..583866) [1758 bp, 585 aa] {ON} Anc_7.3...   139   2e-33
KAFR0B00910 Chr2 complement(168186..169724) [1539 bp, 512 aa] {O...   137   2e-33
KLTH0H01562g Chr8 complement(140915..142390) [1476 bp, 491 aa] {...   137   2e-33
TPHA0D04520 Chr4 (985683..987191) [1509 bp, 502 aa] {ON} Anc_7.3...   137   2e-33
NDAI0B05440 Chr2 (1333810..1335000) [1191 bp, 396 aa] {ON} Anc_1...   134   3e-33
KNAG0I02050 Chr9 complement(399547..399554,399758..401021) [1272...   135   3e-33
Kpol_513.15 s513 complement(41334..42839) [1506 bp, 501 aa] {ON}...   136   4e-33
KLLA0E21935g Chr5 (1959770..1961083) [1314 bp, 437 aa] {ON} high...   135   5e-33
TBLA0C00640 Chr3 (129301..131040) [1740 bp, 579 aa] {ON} Anc_8.1...   137   6e-33
ACR040W Chr3 (431343..433634) [2292 bp, 763 aa] {ON} Syntenic ho...   139   6e-33
Kwal_56.24588 s56 (1065225..1066766) [1542 bp, 513 aa] {ON} YDL1...   135   7e-33
SAKL0H20218g Chr8 (1770946..1772670) [1725 bp, 574 aa] {ON} simi...   136   9e-33
SAKL0H01430g Chr8 (149724..151226) [1503 bp, 500 aa] {ON} highly...   135   1e-32
Skud_7.100 Chr7 (187842..189518) [1677 bp, 558 aa] {ON} YGL171W ...   136   1e-32
TPHA0L02160 Chr12 complement(448305..449801) [1497 bp, 498 aa] {...   135   1e-32
KLTH0H08646g Chr8 (750413..752113) [1701 bp, 566 aa] {ON} highly...   136   1e-32
CAGL0M13519g Chr13 complement(1330802..1332286) [1485 bp, 494 aa...   135   1e-32
KLTH0B08998g Chr2 complement(731722..733200) [1479 bp, 492 aa] {...   134   1e-32
NDAI0C03600 Chr3 complement(826718..828277) [1560 bp, 519 aa] {O...   135   2e-32
KLTH0H15686g Chr8 complement(1353647..1354725,1354841..1355081) ...   133   2e-32
Suva_2.362 Chr2 complement(636909..638903) [1995 bp, 664 aa] {ON...   136   3e-32
NCAS0F02200 Chr6 (438960..440486) [1527 bp, 508 aa] {ON} Anc_5.40     134   3e-32
Suva_12.48 Chr12 (66743..69055) [2313 bp, 770 aa] {ON} YJL033W (...   136   4e-32
ZYRO0D07546g Chr4 (657145..658629) [1485 bp, 494 aa] {ON} highly...   133   5e-32
Smik_10.239 Chr10 (380101..382413) [2313 bp, 770 aa] {ON} YJL033...   135   6e-32
TDEL0G00650 Chr7 (132659..134116) [1458 bp, 485 aa] {ON} Anc_5.4...   132   6e-32
KNAG0B03010 Chr2 (582008..583489) [1482 bp, 493 aa] {ON} Anc_5.6...   132   8e-32
TBLA0B09205 Chr2 (2175882..2177243) [1362 bp, 453 aa] {ON}            131   8e-32
TDEL0F01090 Chr6 (196968..198623) [1656 bp, 551 aa] {ON} Anc_8.1...   133   8e-32
Ecym_5326 Chr5 (663464..665737) [2274 bp, 757 aa] {ON} similar t...   135   8e-32
CAGL0L06908g Chr12 complement(779554..780873) [1320 bp, 439 aa] ...   131   9e-32
CAGL0K02387g Chr11 (216795..218492) [1698 bp, 565 aa] {ON} highl...   133   1e-31
Smik_7.100 Chr7 (177395..179068) [1674 bp, 557 aa] {ON} YGL171W ...   132   1e-31
YGL171W Chr7 (182390..184084) [1695 bp, 564 aa] {ON}  ROK1RNA-de...   132   2e-31
YMR290C Chr13 complement(850074..851591) [1518 bp, 505 aa] {ON} ...   131   2e-31
Skud_13.463 Chr13 complement(823646..825163) [1518 bp, 505 aa] {...   131   2e-31
Ecym_2213 Chr2 (419873..421537) [1665 bp, 554 aa] {ON} similar t...   132   2e-31
Smik_13.506 Chr13 complement(832760..834277) [1518 bp, 505 aa] {...   131   2e-31
ADR260C Chr4 complement(1152257..1153573) [1317 bp, 438 aa] {ON}...   129   3e-31
Suva_13.480 Chr13 complement(832037..833554) [1518 bp, 505 aa] {...   130   3e-31
KNAG0D02250 Chr4 (387478..389160) [1683 bp, 560 aa] {ON} Anc_8.1...   131   3e-31
KLLA0E14367g Chr5 (1268901..1270691) [1791 bp, 596 aa] {ON} simi...   131   5e-31
TBLA0C06780 Chr3 complement(1636223..1637713) [1491 bp, 496 aa] ...   130   5e-31
Suva_7.92 Chr7 (178376..180052) [1677 bp, 558 aa] {ON} YGL171W (...   130   6e-31
KNAG0D02780 Chr4 complement(504774..506204) [1431 bp, 476 aa] {O...   129   1e-30
Ecym_8358 Chr8 (719978..721687) [1710 bp, 569 aa] {ON} similar t...   129   1e-30
NDAI0B02410 Chr2 complement(602541..604256) [1716 bp, 571 aa] {O...   129   1e-30
TBLA0B05050 Chr2 (1191456..1192997) [1542 bp, 513 aa] {ON} Anc_6...   129   1e-30
Suva_4.163 Chr4 (294691..296031) [1341 bp, 446 aa] {ON} YDL084W ...   127   2e-30
NCAS0B04630 Chr2 (845866..847557) [1692 bp, 563 aa] {ON} Anc_8.124    129   2e-30
NCAS0A03950 Chr1 (799925..801265) [1341 bp, 446 aa] {ON} Anc_2.384    127   2e-30
NCAS0B03030 Chr2 (522163..524217) [2055 bp, 684 aa] {ON} Anc_8.402    130   2e-30
KNAG0A05850 Chr1 (873957..875306) [1350 bp, 449 aa] {ON} Anc_2.3...   127   2e-30
TPHA0G02050 Chr7 (420332..421648) [1317 bp, 438 aa] {ON} Anc_2.3...   127   3e-30
KLLA0C17424g Chr3 (1529941..1531680) [1740 bp, 579 aa] {ON} simi...   129   3e-30
TPHA0G02585 Chr7 (535997..537313) [1317 bp, 438 aa] {ON}              126   3e-30
YDL084W Chr4 (305237..306577) [1341 bp, 446 aa] {ON}  SUB2Compon...   126   4e-30
Skud_4.171 Chr4 (300716..302056) [1341 bp, 446 aa] {ON} YDL084W ...   126   4e-30
Smik_4.152 Chr4 (281728..283068) [1341 bp, 446 aa] {ON} YDL084W ...   126   4e-30
NDAI0E01750 Chr5 complement(346153..347505) [1353 bp, 450 aa] {O...   125   8e-30
Suva_11.256 Chr11 complement(469196..471424) [2229 bp, 742 aa] {...   128   1e-29
Skud_11.257 Chr11 complement(465439..467658) [2220 bp, 739 aa] {...   128   1e-29
Smik_11.281 Chr11 complement(472555..474783) [2229 bp, 742 aa] {...   128   1e-29
TDEL0G03140 Chr7 (587922..589256) [1335 bp, 444 aa] {ON} Anc_2.3...   125   1e-29
TBLA0B07950 Chr2 complement(1884315..1885496) [1182 bp, 393 aa] ...   124   1e-29
SAKL0A04752g Chr1 (434100..435749) [1650 bp, 549 aa] {ON} simila...   125   2e-29
Kpol_1058.53 s1058 complement(136863..138191) [1329 bp, 442 aa] ...   124   3e-29
KAFR0B02030 Chr2 complement(397276..398991) [1716 bp, 571 aa] {O...   125   3e-29
SAKL0E05148g Chr5 complement(419901..420979,421045..421372) [140...   124   4e-29
Kpol_274.7 s274 complement(11790..13502) [1713 bp, 570 aa] {ON} ...   125   5e-29
ZYRO0A08272g Chr1 (665522..666853) [1332 bp, 443 aa] {ON} highly...   123   6e-29
Kpol_1041.33 s1041 complement(82855..84180) [1326 bp, 441 aa] {O...   122   8e-29
TBLA0B08880 Chr2 complement(2108994..2110322) [1329 bp, 442 aa] ...   122   8e-29
KAFR0F02940 Chr6 (582057..583388) [1332 bp, 443 aa] {ON} Anc_2.3...   122   9e-29
NCAS0J00580 Chr10 (87108..88943) [1836 bp, 611 aa] {ON} Anc_8.87      124   1e-28
NDAI0B05110 Chr2 (1249929..1252217) [2289 bp, 762 aa] {ON} Anc_1...   125   1e-28
AGL004C Chr7 complement(715482..717410) [1929 bp, 642 aa] {ON} S...   124   1e-28
YKR024C Chr11 complement(485144..487372) [2229 bp, 742 aa] {ON} ...   124   2e-28
CAGL0L03047g Chr12 (352032..354179) [2148 bp, 715 aa] {ON} simil...   124   3e-28
TPHA0B01270 Chr2 complement(283532..285754) [2223 bp, 740 aa] {O...   124   3e-28
SAKL0H02178g Chr8 complement(211451..212758) [1308 bp, 435 aa] {...   119   8e-28
NDAI0C05120 Chr3 complement(1191160..1193046) [1887 bp, 628 aa] ...   121   1e-27
NCAS0B07760 Chr2 (1469599..1471845) [2247 bp, 748 aa] {ON} Anc_1...   121   2e-27
Ecym_5095 Chr5 (213368..214684) [1317 bp, 438 aa] {ON} similar t...   115   1e-26
TDEL0H01300 Chr8 (221815..223962) [2148 bp, 715 aa] {ON} Anc_1.2...   118   2e-26
TBLA0E03420 Chr5 (846796..849024) [2229 bp, 742 aa] {ON} Anc_3.1...   117   2e-26
TDEL0G03990 Chr7 (726319..728085) [1767 bp, 588 aa] {ON} Anc_6.7...   114   2e-25
Smik_12.355 Chr12 complement(633462..635246) [1785 bp, 594 aa] {...   114   2e-25
TPHA0K01120 Chr11 (235339..237153) [1815 bp, 604 aa] {ON} Anc_6....   114   3e-25
YLR276C Chr12 complement(695046..696830) [1785 bp, 594 aa] {ON} ...   113   3e-25
SAKL0A08118g Chr1 (718720..720564) [1845 bp, 614 aa] {ON} highly...   112   6e-25
Suva_10.374 Chr10 complement(655832..657616) [1785 bp, 594 aa] {...   111   1e-24
Skud_12.359 Chr12 complement(636149..637930) [1782 bp, 593 aa] {...   111   1e-24
KNAG0K00400 Chr11 (69795..71093) [1299 bp, 432 aa] {ON} Anc_5.69...   109   2e-24
CAGL0A03652g Chr1 complement(373100..375301) [2202 bp, 733 aa] {...   111   2e-24
KAFR0A04960 Chr1 (981797..983572) [1776 bp, 591 aa] {ON} Anc_6.7...   108   2e-23
KAFR0G01440 Chr7 complement(319146..321305) [2160 bp, 719 aa] {O...   108   2e-23
Smik_2.282 Chr2 (512869..515271) [2403 bp, 800 aa] {ON} YBR142W ...   108   2e-23
NCAS0D02940 Chr4 complement(558088..559923) [1836 bp, 611 aa] {O...   107   3e-23
NDAI0A06900 Chr1 (1578643..1580622) [1980 bp, 659 aa] {ON} Anc_3...   107   3e-23
NCAS0I02320 Chr9 (437124..439319) [2196 bp, 731 aa] {ON} Anc_3.1...   107   3e-23
KLLA0C04576g Chr3 complement(417217..419001) [1785 bp, 594 aa] {...   107   3e-23
Kwal_34.15835 s34 (79657..80592) [936 bp, 311 aa] {ON} YOR204W (...   102   4e-23
KNAG0F03020 Chr6 complement(572005..573801) [1797 bp, 598 aa] {O...   107   4e-23
Suva_4.392 Chr4 (697442..699823) [2382 bp, 793 aa] {ON} YBR142W ...   106   1e-22
KLTH0G15224g Chr7 (1332767..1334557) [1791 bp, 596 aa] {ON} high...   105   1e-22
Kwal_56.23291 s56 complement(479073..480842) [1770 bp, 589 aa] {...   104   2e-22
Kpol_1036.17 s1036 (45392..47683) [2292 bp, 763 aa] {ON} (45392....   105   2e-22
NDAI0I01960 Chr9 (457199..459025) [1827 bp, 608 aa] {ON} Anc_6.73     104   3e-22
ZYRO0D14388g Chr4 complement(1218001..1219752) [1752 bp, 583 aa]...   103   4e-22
AFR082C Chr6 complement(576175..578307) [2133 bp, 710 aa] {ON} S...   103   5e-22
AGR278C Chr7 complement(1261914..1263701) [1788 bp, 595 aa] {ON}...   101   2e-21
Kpol_1016.14 s1016 complement(36309..38507) [2199 bp, 732 aa] {O...   101   3e-21
KLLA0F13926g Chr6 complement(1290006..1292228) [2223 bp, 740 aa]...   100   5e-21
CAGL0F04983g Chr6 complement(507217..509004) [1788 bp, 595 aa] {...   100   7e-21
Kwal_56.22971 s56 (351639..352331) [693 bp, 230 aa] {ON} YDR021W...    94   8e-21
KLLA0D18667g Chr4 complement(1574160..1576217) [2058 bp, 685 aa]...   100   1e-20
TBLA0A09740 Chr1 complement(2393212..2395065) [1854 bp, 617 aa] ...    98   2e-20
TBLA0D05490 Chr4 (1352976..1355243) [2268 bp, 755 aa] {ON}             99   2e-20
KLTH0D03190g Chr4 complement(306459..308609) [2151 bp, 716 aa] {...    98   4e-20
Ecym_6354 Chr6 (686603..688819) [2217 bp, 738 aa] {ON} similar t...    97   6e-20
NDAI0C04680 Chr3 complement(1077391..1079541) [2151 bp, 716 aa] ...    97   7e-20
KNAG0C01480 Chr3 complement(294677..296947) [2271 bp, 756 aa] {O...    96   2e-19
Kwal_26.7302 s26 complement(304411..306555) [2145 bp, 714 aa] {O...    94   5e-19
SAKL0D05258g Chr4 complement(416100..418247) [2148 bp, 715 aa] {...    94   5e-19
Kpol_1028.29 s1028 complement(76405..78318) [1914 bp, 637 aa] {O...    94   6e-19
NDAI0K02300 Chr11 (514779..516908) [2130 bp, 709 aa] {ON} Anc_6....    92   2e-18
TDEL0B02800 Chr2 (504332..505726) [1395 bp, 464 aa] {ON} Anc_5.6...    91   3e-18
KNAG0D00300 Chr4 complement(40830..42743) [1914 bp, 637 aa] {ON}...    92   3e-18
KLLA0F06941g Chr6 complement(665970..667862) [1893 bp, 630 aa] {...    91   4e-18
ZYRO0F01826g Chr6 complement(149490..151799) [2310 bp, 769 aa] {...    91   5e-18
SAKL0A00924g Chr1 complement(98231..100150) [1920 bp, 639 aa] {O...    89   2e-17
KAFR0A03450 Chr1 complement(708114..710348) [2235 bp, 744 aa] {O...    87   9e-17
CAGL0G07975g Chr7 (752176..754131) [1956 bp, 651 aa] {ON} simila...    86   2e-16
KAFR0C04690 Chr3 (934039..935928) [1890 bp, 629 aa] {ON} Anc_6.3...    85   3e-16
Kwal_23.6387 s23 (1558522..1560468) [1947 bp, 648 aa] {ON} YNR03...    85   3e-16
TPHA0M01940 Chr13 (401463..403469) [2007 bp, 668 aa] {ON} Anc_6....    84   7e-16
Ecym_2514 Chr2 (1000911..1002773) [1863 bp, 620 aa] {ON} similar...    83   1e-15
AGL225C Chr7 complement(275826..277649) [1824 bp, 607 aa] {ON} S...    83   1e-15
TDEL0A07700 Chr1 (1338381..1340264) [1884 bp, 627 aa] {ON} Anc_6...    83   2e-15
NCAS0A05470 Chr1 (1077464..1079413) [1950 bp, 649 aa] {ON} Anc_6...    82   2e-15
TBLA0F04210 Chr6 (1034478..1036397) [1920 bp, 639 aa] {ON} Anc_6...    82   2e-15
Suva_14.394 Chr14 (676747..678666) [1920 bp, 639 aa] {ON} YNR038...    79   2e-14
ZYRO0C12012g Chr3 (936848..938722) [1875 bp, 624 aa] {ON} simila...    79   4e-14
AFR452C Chr6 complement(1250342..1251203) [862 bp, 287.333333333...    75   5e-14
Smik_14.369 Chr14 (653538..655427) [1890 bp, 629 aa] {ON} YNR038...    78   5e-14
Agos_YGOB_AFR452C Chr6 complement(1250310..1251203) [894 bp, 298...    75   5e-14
KLTH0A07084g Chr1 (587692..589578) [1887 bp, 628 aa] {ON} simila...    78   6e-14
YNR038W Chr14 (695595..697484) [1890 bp, 629 aa] {ON}  DBP6Essen...    76   2e-13
Skud_14.371 Chr14 (663742..665631) [1890 bp, 629 aa] {ON} YNR038...    75   3e-13
NCAS0D04130 Chr4 (779645..781408) [1764 bp, 587 aa] {ON} Anc_6.223     75   3e-13
NDAI0I00790 Chr9 complement(175765..177567) [1803 bp, 600 aa] {O...    75   4e-13
Suva_114.1 Chr114 complement(3..506) [504 bp, 168 aa] {ON} YKR05...    67   5e-12
AFL102W Chr6 (247419..249083) [1665 bp, 554 aa] {ON} Syntenic ho...    71   8e-12
SAKL0A04224g Chr1 (394175..395896) [1722 bp, 573 aa] {ON} simila...    69   2e-11
Smik_7.216 Chr7 complement(376052..377737) [1686 bp, 561 aa] {ON...    69   3e-11
CAGL0M05753g Chr13 complement(610837..612543) [1707 bp, 568 aa] ...    69   3e-11
KLTH0H03960g Chr8 (361653..363323) [1671 bp, 556 aa] {ON} simila...    69   4e-11
Ecym_2193 Chr2 (379905..381545) [1641 bp, 546 aa] {ON} similar t...    68   6e-11
TDEL0E05320 Chr5 complement(973951..975570) [1620 bp, 539 aa] {O...    67   1e-10
Kpol_1002.46 s1002 (135310..136929) [1620 bp, 539 aa] {ON} (1353...    67   1e-10
Kwal_56.24094 s56 complement(846901..848571) [1671 bp, 556 aa] {...    67   2e-10
YGL064C Chr7 complement(381523..383208) [1686 bp, 561 aa] {ON}  ...    67   2e-10
Kwal_56.22974 s56 (352370..352837) [468 bp, 155 aa] {OFF} YPL119...    62   2e-10
Skud_7.216 Chr7 complement(384838..386586) [1749 bp, 582 aa] {ON...    66   2e-10
Suva_7.205 Chr7 complement(374687..376435) [1749 bp, 582 aa] {ON...    65   6e-10
TBLA0A06180 Chr1 (1518694..1520301) [1608 bp, 535 aa] {ON} Anc_6...    64   7e-10
KLLA0B02310g Chr2 (205046..206800) [1755 bp, 584 aa] {ON} simila...    64   1e-09
KAFR0K02330 Chr11 complement(477370..478992) [1623 bp, 540 aa] {...    62   3e-09
TPHA0J02440 Chr10 complement(537553..539259) [1707 bp, 568 aa] {...    62   5e-09
ZYRO0E07040g Chr5 complement(532475..534094) [1620 bp, 539 aa] {...    59   3e-08
KNAG0F01930 Chr6 (371697..373379) [1683 bp, 560 aa] {ON} Anc_6.2...    57   1e-07
Kpol_1009.3 s1009 complement(4730..6169) [1440 bp, 479 aa] {ON} ...    57   2e-07
Suva_2.502 Chr2 (888423..890483) [2061 bp, 686 aa] {ON} YDR332W ...    46   5e-04
TBLA0H01810 Chr8 complement(426223..428346) [2124 bp, 707 aa] {O...    45   8e-04
Kwal_47.19313 s47 complement(1186091..1189306) [3216 bp, 1071 aa...    45   0.001
NCAS0F03010 Chr6 (598773..600782) [2010 bp, 669 aa] {ON} Anc_5.3...    44   0.002
NCAS0E00200 Chr5 complement(26080..29448) [3369 bp, 1122 aa] {ON...    42   0.006
KLLA0D12694g Chr4 (1079740..1083843) [4104 bp, 1367 aa] {ON} sim...    42   0.007
YDR332W Chr4 (1131001..1133070) [2070 bp, 689 aa] {ON}  IRC3Puta...    42   0.008
Smik_9.201 Chr9 complement(333404..336379) [2976 bp, 991 aa] {ON...    42   0.008
Skud_9.179 Chr9 complement(328238..331216) [2979 bp, 992 aa] {ON...    42   0.008
TDEL0E02500 Chr5 complement(483905..485878) [1974 bp, 657 aa] {O...    41   0.012
Suva_9.211 Chr9 complement(344361..347336) [2976 bp, 991 aa] {ON...    41   0.013
YIR002C Chr9 complement(357415..360396) [2982 bp, 993 aa] {ON}  ...    41   0.016
Kpol_1029.1 s1029 (145..148,407..774) [372 bp, 123 aa] {OFF} (14...    38   0.020
Kwal_14.2171 s14 (643215..643973) [759 bp, 252 aa] {ON} YOR204W ...    40   0.021
Skud_4.599 Chr4 (1067036..1069102) [2067 bp, 688 aa] {ON} YDR332...    40   0.024
ZYRO0D10802g Chr4 (911004..912956) [1953 bp, 650 aa] {ON} simila...    40   0.035
Kpol_365.4 s365 (7095..9170) [2076 bp, 691 aa] {ON} (7095..9170)...    40   0.041
KNAG0C05350 Chr3 complement(1044926..1047028) [2103 bp, 700 aa] ...    40   0.043
KLTH0E03630g Chr5 complement(327367..329385) [2019 bp, 672 aa] {...    40   0.045
CAGL0J01980g Chr10 (196812..199970) [3159 bp, 1052 aa] {ON} simi...    39   0.080
Kpol_1018.31 s1018 (87697..91695) [3999 bp, 1332 aa] {ON} (87697...    39   0.097
TPHA0H01510 Chr8 (340988..343018) [2031 bp, 676 aa] {ON} Anc_5.3...    38   0.11 
Kwal_56.24359 s56 complement(966614..970789) [4176 bp, 1391 aa] ...    39   0.11 
KAFR0A07190 Chr1 complement(1453748..1457704) [3957 bp, 1318 aa]...    38   0.13 
AFL159W Chr6 (134254..137706) [3453 bp, 1150 aa] {ON} Syntenic h...    38   0.14 
TPHA0G03720 Chr7 (787108..790563) [3456 bp, 1151 aa] {ON} Anc_3....    38   0.18 
KLLA0E17095g Chr5 (1519323..1521395) [2073 bp, 690 aa] {ON} simi...    37   0.19 
Kwal_55.20938 s55 complement(617612..618622) [1011 bp, 336 aa] {...    37   0.19 
TPHA0I02220 Chr9 (496020..499136) [3117 bp, 1038 aa] {ON} Anc_7....    37   0.21 
NDAI0B01020 Chr2 (236444..239377) [2934 bp, 977 aa] {ON} Anc_7.1...    37   0.25 
NCAS0A13190 Chr1 complement(2593419..2596559) [3141 bp, 1046 aa]...    37   0.26 
KLTH0F13310g Chr6 complement(1090990..1094076) [3087 bp, 1028 aa...    37   0.26 
KLTH0H02706g Chr8 (238367..242578) [4212 bp, 1403 aa] {ON} simil...    37   0.31 
NDAI0I00750 Chr9 (164874..169178) [4305 bp, 1434 aa] {ON} Anc_6....    37   0.31 
KLLA0D13552g Chr4 (1167629..1170655) [3027 bp, 1008 aa] {ON} sim...    37   0.34 
NDAI0C04460 Chr3 (1012182..1014188) [2007 bp, 668 aa] {ON} Anc_5...    37   0.35 
SAKL0G08228g Chr7 complement(700095..702248) [2154 bp, 717 aa] {...    37   0.35 
NCAS0G01110 Chr7 (196418..199387) [2970 bp, 989 aa] {ON} Anc_6.278     37   0.39 
Kpol_328.1 s328 complement(673..3711) [3039 bp, 1012 aa] {ON} co...    36   0.66 
Smik_4.592 Chr4 (1057406..1059475) [2070 bp, 689 aa] {ON} YDR332...    35   0.76 
KNAG0E03530 Chr5 (705077..708016) [2940 bp, 979 aa] {ON} Anc_7.1...    35   0.78 
Ecym_2138 Chr2 (256787..260971) [4185 bp, 1394 aa] {ON} similar ...    35   0.99 
SAKL0F04532g Chr6 (365436..368558) [3123 bp, 1040 aa] {ON} simil...    35   1.0  
KAFR0K01070 Chr11 (221301..224285) [2985 bp, 994 aa] {ON} Anc_7....    35   1.1  
Ecym_8005 Chr8 (9383..11551) [2169 bp, 722 aa] {ON} similar to A...    35   1.2  
CAGL0C02563g Chr3 (259114..262965) [3852 bp, 1283 aa] {ON} simil...    35   1.3  
Kwal_55.20185 s55 complement(286058..288073) [2016 bp, 671 aa] {...    35   1.3  
TBLA0J01920 Chr10 (455227..458469) [3243 bp, 1080 aa] {ON} Anc_7...    35   1.5  
NDAI0I03300 Chr9 (771772..771820,771929..775467) [3588 bp, 1195 ...    35   1.5  
ZYRO0A02706g Chr1 (218642..220858) [2217 bp, 738 aa] {ON} simila...    34   1.6  
Ecym_4473 Chr4 (962193..965228) [3036 bp, 1011 aa] {ON} similar ...    34   2.0  
ADR302W Chr4 (1227985..1230060) [2076 bp, 691 aa] {ON} Syntenic ...    34   2.0  
KAFR0D04360 Chr4 complement(858295..860295) [2001 bp, 666 aa] {O...    34   2.1  
ZYRO0G03938g Chr7 (318186..321206) [3021 bp, 1006 aa] {ON} simil...    34   2.2  
Kwal_23.4187 s23 (607525..611301) [3777 bp, 1258 aa] {ON} YLR398...    34   2.3  
Kpol_2000.24 s2000 complement(45963..46757) [795 bp, 264 aa] {ON...    33   2.7  
KNAG0A02330 Chr1 (219856..222081) [2226 bp, 741 aa] {ON} Anc_8.4...    33   3.0  
Kpol_1075.5 s1075 complement(13967..20494) [6528 bp, 2175 aa] {O...    34   3.1  
Ecym_2529 Chr2 complement(1029384..1031567) [2184 bp, 727 aa] {O...    33   3.1  
KAFR0F01050 Chr6 (198407..201028) [2622 bp, 873 aa] {ON} Anc_6.2...    33   3.7  
NDAI0J02330 Chr10 complement(564963..568895) [3933 bp, 1310 aa] ...    33   3.8  
Kwal_27.11032 s27 (612506..613636) [1131 bp, 376 aa] {ON} YDL007...    33   3.9  
Ecym_3257 Chr3 (491150..494974) [3825 bp, 1274 aa] {ON} similar ...    33   4.0  
TBLA0A06360 Chr1 (1561496..1565389) [3894 bp, 1297 aa] {ON} Anc_...    33   4.2  
SAKL0H11682g Chr8 (996881..999202) [2322 bp, 773 aa] {ON} simila...    33   4.5  
NCAS0J01560 Chr10 complement(276723..280619) [3897 bp, 1298 aa] ...    33   5.0  
Kpol_1055.74 s1055 (201332..205156) [3825 bp, 1274 aa] {ON} (201...    32   6.7  
KAFR0A05880 Chr1 (1191511..1195341) [3831 bp, 1276 aa] {ON} Anc_...    32   7.1  
YLR398C Chr12 complement(915156..919019) [3864 bp, 1287 aa] {ON}...    32   7.3  
TDEL0E01090 Chr5 (222389..226162) [3774 bp, 1257 aa] {ON} Anc_4....    32   8.8  

>AEL086W Chr5 (464521..467403) [2883 bp, 960 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL031W (DBP10)
          Length = 960

 Score = 1687 bits (4368), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 837/945 (88%), Positives = 837/945 (88%)

Query: 1   MGLASKRKRDTEEHSDEGEDFDIAGNIALXXXXXXXXXXXXXNEVQDIIEFSDDEKQNAP 60
           MGLASKRKRDTEEHSDEGEDFDIAGNIAL             NEVQDIIEFSDDEKQNAP
Sbjct: 1   MGLASKRKRDTEEHSDEGEDFDIAGNIALDSEDSDDSVSDSDNEVQDIIEFSDDEKQNAP 60

Query: 61  QVSXXXXXXXXXXXXXPRSDAAFPSLELSXXXXXXXXXXXXXXSYFNTTSQLXXXXXXXX 120
           QVS             PRSDAAFPSLELS              SYFNTTSQL        
Sbjct: 61  QVSKTAKGAKGAKVAAPRSDAAFPSLELSDGEDADNGDKDDVDSYFNTTSQLAASKAKKG 120

Query: 121 XXXXXXLSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIE 180
                 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIE
Sbjct: 121 SFASFGLSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIE 180

Query: 181 KLKMHSAKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSN 240
           KLKMHSAKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSN
Sbjct: 181 KLKMHSAKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSN 240

Query: 241 PDVIIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLL 300
           PDVIIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLL
Sbjct: 241 PDVIIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLL 300

Query: 301 FSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIK 360
           FSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIK
Sbjct: 301 FSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIK 360

Query: 361 IPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTR 420
           IPVATEEQLQRFR                         QPLPSAKDMPSPNSTIIFVSTR
Sbjct: 361 IPVATEEQLQRFRKQSNDDADDSDDETDKKKKHSKKSKQPLPSAKDMPSPNSTIIFVSTR 420

Query: 421 HHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLA 480
           HHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLA
Sbjct: 421 HHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLA 480

Query: 481 NVVNMSLPASSKIFVHRVGRTARAGNKGWAYTIXXXXXXXXXXXXXXXXGKKVLLTPMYE 540
           NVVNMSLPASSKIFVHRVGRTARAGNKGWAYTI                GKKVLLTPMYE
Sbjct: 481 NVVNMSLPASSKIFVHRVGRTARAGNKGWAYTILSESELPYLLDLELFLGKKVLLTPMYE 540

Query: 541 ATCDLLKKKWISEGNEGALFQPPKISYVNRLILGSAPRLDLEAMGDLFKNLVESNFELQN 600
           ATCDLLKKKWISEGNEGALFQPPKISYVNRLILGSAPRLDLEAMGDLFKNLVESNFELQN
Sbjct: 541 ATCDLLKKKWISEGNEGALFQPPKISYVNRLILGSAPRLDLEAMGDLFKNLVESNFELQN 600

Query: 601 LKAVSIKAEKLYLRTRQPASAESIKRAKEVIAAGWDEQNVRFGKNIEKEKLEFLAKLQNR 660
           LKAVSIKAEKLYLRTRQPASAESIKRAKEVIAAGWDEQNVRFGKNIEKEKLEFLAKLQNR
Sbjct: 601 LKAVSIKAEKLYLRTRQPASAESIKRAKEVIAAGWDEQNVRFGKNIEKEKLEFLAKLQNR 660

Query: 661 HNKETVFEFARNHDDEMAILMKXXXXXXXXXXXXXKERQQLLEKERQAGLRHTLEDEILK 720
           HNKETVFEFARNHDDEMAILMK             KERQQLLEKERQAGLRHTLEDEILK
Sbjct: 661 HNKETVFEFARNHDDEMAILMKRRRRQIAPIQQRAKERQQLLEKERQAGLRHTLEDEILK 720

Query: 721 GEENEVGYSVPQELLRDFEDADELAAKRNTKKGFRDENFYLSHFAPASDIQDKQLQVASS 780
           GEENEVGYSVPQELLRDFEDADELAAKRNTKKGFRDENFYLSHFAPASDIQDKQLQVASS
Sbjct: 721 GEENEVGYSVPQELLRDFEDADELAAKRNTKKGFRDENFYLSHFAPASDIQDKQLQVASS 780

Query: 781 FTNEVSKATFDLHNDDKVQVHKQTATVKWDKKRKKYVNVQGIDNKKYIIGESGQKIPASF 840
           FTNEVSKATFDLHNDDKVQVHKQTATVKWDKKRKKYVNVQGIDNKKYIIGESGQKIPASF
Sbjct: 781 FTNEVSKATFDLHNDDKVQVHKQTATVKWDKKRKKYVNVQGIDNKKYIIGESGQKIPASF 840

Query: 841 RSGKFDEWSKARKLAPLKVGARESSIPANLLADPTGSRLANGKFKHKQIKAPKMPDKNRD 900
           RSGKFDEWSKARKLAPLKVGARESSIPANLLADPTGSRLANGKFKHKQIKAPKMPDKNRD
Sbjct: 841 RSGKFDEWSKARKLAPLKVGARESSIPANLLADPTGSRLANGKFKHKQIKAPKMPDKNRD 900

Query: 901 DYQSQLKKVNKAMESGLHVKGYNAPGMKQELRTTEQIRKQRSMAE 945
           DYQSQLKKVNKAMESGLHVKGYNAPGMKQELRTTEQIRKQRSMAE
Sbjct: 901 DYQSQLKKVNKAMESGLHVKGYNAPGMKQELRTTEQIRKQRSMAE 945

>KLTH0C08866g Chr3 (742559..745477) [2919 bp, 972 aa] {ON} highly
           similar to uniprot|Q12389 Saccharomyces cerevisiae
           YDL031W DBP10 Essential protein involved in ribosome
           biogenesis putative ATP-dependent RNA helicase of the
           DEAD-box protein family
          Length = 972

 Score = 1251 bits (3236), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 633/960 (65%), Positives = 734/960 (76%), Gaps = 27/960 (2%)

Query: 5   SKRKRDTEEHSDEGEDFDIAGNIALXXXXXXXXXXX-------XXNEVQDIIEFSDDEKQ 57
           +KR R     SD+ ED DIAGNIAL                     +VQDIIEFSD++++
Sbjct: 6   AKRSRQQSALSDD-EDVDIAGNIALDSSDSSSSSDNDDDGSEDEAGDVQDIIEFSDEDEE 64

Query: 58  NAPQVSXXXXXXXXXXXXXPRSDAAFPSLELSXXXXXXXXX--XXXXXSYFNTTSQLXXX 115
            A   +                +  FP+LELS                 YF+T +     
Sbjct: 65  EARAKAAPQKKKKNA------HEGGFPALELSDNEDHDDGKDGADDVTEYFSTNNP-EAA 117

Query: 116 XXXXXXXXXXXLSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFV 175
                      LSKFI+ NI++KGFRQPTPIQRKTIPLILQ+RDIVGMARTGSGKTAAFV
Sbjct: 118 KHKKGSFASFGLSKFIVSNIAKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFV 177

Query: 176 LPLIEKLKMHSAKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFS 235
           LP+IEKLK HSAKIGARA+ILSPSRELAMQTHKVF+EF++GS+LRSVLLTGG+ LE+QF 
Sbjct: 178 LPMIEKLKGHSAKIGARAVILSPSRELAMQTHKVFREFSRGSDLRSVLLTGGESLEEQFG 237

Query: 236 MMMSNPDVIIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTA 295
           +MMSNPDV+IATPGRFLHLKVEMNLDL S+EY+VFDEADRLFEMGF+EQL+ELL +LP A
Sbjct: 238 LMMSNPDVVIATPGRFLHLKVEMNLDLKSVEYLVFDEADRLFEMGFEEQLSELLAALPVA 297

Query: 296 RQTLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLL 355
           RQTLLFSATLPSSLV+FAKAGLTNPVLVRLD ETKVSENLEMLFLS KN+EREANLLYLL
Sbjct: 298 RQTLLFSATLPSSLVNFAKAGLTNPVLVRLDAETKVSENLEMLFLSSKNEEREANLLYLL 357

Query: 356 QEVIKIPVATEEQLQRFRXXXX----XXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPN 411
           QE +KIPVATEEQL  ++                             + LPSA ++PS +
Sbjct: 358 QEAMKIPVATEEQLLEYKAKVKNSYDSDDSDEDAKAKAKKQRKSAIRKKLPSANELPSEH 417

Query: 412 STIIFVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAA 471
           +TI+FV TRHHVEY+S LLKDCGYLVSYLYGTLDQHARRQQL NFR GLT ILVVTDVAA
Sbjct: 418 ATIVFVPTRHHVEYISQLLKDCGYLVSYLYGTLDQHARRQQLFNFRAGLTTILVVTDVAA 477

Query: 472 RGVDIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWAYTIXXXXXXXXXXXXXXXXGK 531
           RGVDIPLLANVVN SLPASSKIFVHRVGRTARAGNKG+AY+I                GK
Sbjct: 478 RGVDIPLLANVVNYSLPASSKIFVHRVGRTARAGNKGFAYSIVSENELPYLLDLELFLGK 537

Query: 532 KVLLTPMYEATCDLLKKKWISEGNEGALFQPPKISYVNRLILGSAPRLDLEAMGDLFKNL 591
           K+LLTPM+EAT +LLK KWI+EGN    F PPK+SY NR++LG+ PRLDLE  GDLFKNL
Sbjct: 538 KILLTPMFEATTELLKSKWIAEGNSELTFNPPKVSYTNRMVLGACPRLDLETCGDLFKNL 597

Query: 592 VESNFELQNLKAVSIKAEKLYLRTRQPASAESIKRAKEVIAAGWDEQNVRFGKNIEKEKL 651
            +S+F+LQ LK V+ KAEKLY RTR PAS++S+KR+KEVIA+GWDEQN+RFGKNIEKEKL
Sbjct: 598 TQSSFDLQQLKGVAAKAEKLYFRTRPPASSQSMKRSKEVIASGWDEQNLRFGKNIEKEKL 657

Query: 652 EFLAKLQNRHNKETVFEFARNHDDEMAILMKXXXXXXXXXXXXXKERQQLLEKERQAGLR 711
           +FLAKLQNR+NKETVFEFARN DDEM++LMK             KER++LLEKER AGLR
Sbjct: 658 DFLAKLQNRNNKETVFEFARNQDDEMSLLMKKRRIQIAPIQRRAKERKELLEKERMAGLR 717

Query: 712 HTLEDEILKGEENEVGYSVPQELL-RDFEDADEL---AAKRNTKKGFRDENFYLSHFAPA 767
           HT+EDEILKG+ENEVGYSVP+E+L R+F+DADEL    +K    K FRD  F+LSH+APA
Sbjct: 718 HTVEDEILKGDENEVGYSVPEEVLHREFQDADELLGAQSKSKRPKSFRDPAFFLSHYAPA 777

Query: 768 SDIQDKQLQVASSFTNEVSKATFDLHNDDKVQVHKQTATVKWDKKRKKYVNVQGIDNKKY 827
           S+IQDKQL+V + FTNE + ATFDLHNDDKVQ HKQ AT KWDKKR+KYVN QG+DNKKY
Sbjct: 778 SEIQDKQLEVTNGFTNEAANATFDLHNDDKVQNHKQVATTKWDKKRQKYVNTQGLDNKKY 837

Query: 828 IIGESGQKIPASFRSGKFDEWSKARKLAPLKVGARESSIPANLLADPT--GSRLANGKFK 885
           I+GESG KIPASFRSGKFDEWSKARKL PLKVGA+ESS  A +L++PT  G R   G+FK
Sbjct: 838 IMGESGHKIPASFRSGKFDEWSKARKLGPLKVGAKESSTTAKMLSNPTAEGQRSIGGRFK 897

Query: 886 HKQIKAPKMPDKNRDDYQSQLKKVNKAMESGLHVKGYNAPGMKQELRTTEQIRKQRSMAE 945
           H +++APK+PDK+RDDY  Q KKV KA+ SG+ VKGYNAPGMK E+R+T+QI K+R   E
Sbjct: 898 HNKVRAPKLPDKHRDDYHVQKKKVEKAVSSGIPVKGYNAPGMKSEMRSTQQIYKERVAKE 957

>KLLA0F24684g Chr6 complement(2294708..2297629) [2922 bp, 973 aa]
           {ON} similar to uniprot|Q12389 Saccharomyces cerevisiae
           YDL031W DBP10 Essential protein involved in ribosome
           biogenesis
          Length = 973

 Score = 1238 bits (3202), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 622/960 (64%), Positives = 728/960 (75%), Gaps = 23/960 (2%)

Query: 4   ASKRKRDTEEHSDEGED-FDIAGNIALXXXXXXXXXXXXXN-------EVQDIIEFSDDE 55
           +SKR    E++S E ED FDIAG+IAL             N       EVQD+IEFS DE
Sbjct: 4   SSKRALPAEDYSSEDEDAFDIAGDIALNADSEDSDISDDDNDNIGFQAEVQDVIEFSSDE 63

Query: 56  KQNAPQVSXXXXXXXXXXXXXPRSDAAFPSLELSXXXXXXXXXXXXXXS-YFNTTSQLXX 114
           ++                   P  D+ FPSLELS              + YFNTT+    
Sbjct: 64  EEKE--KKPKKQNKKAKVKAGPIVDSKFPSLELSDDEKKATNESDDDLNDYFNTTAD-AA 120

Query: 115 XXXXXXXXXXXXLSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAF 174
                       LSK +L NIS+KGFRQPTPIQRKTIPLILQ+RDIVGMARTGSGKTAAF
Sbjct: 121 AKHKKGSFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAF 180

Query: 175 VLPLIEKLKMHSAKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQF 234
           VLP+IEKLK HSAKIG RA+ILSPSRELA+QTH+VFKEF+KGS+LRS+LLTGGD LEDQF
Sbjct: 181 VLPMIEKLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQF 240

Query: 235 SMMMSNPDVIIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPT 294
            MMM NPDV+IATPGRFLHLKVEMNLDL S+EYVVFDEADRLFEMGFQEQLNELL + PT
Sbjct: 241 GMMMGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPT 300

Query: 295 ARQTLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYL 354
            RQTLLFSATLPSSLVDFAKAGL+NPVLVRLD ETK+SENLEMLF+S+K DEREANLLYL
Sbjct: 301 NRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYL 360

Query: 355 LQEVIKIPVATEEQLQRFRXX--XXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNS 412
           LQE IK+PVATE Q+++ +                           + LP+A +MPS  +
Sbjct: 361 LQEAIKMPVATESQIKKLKQQNDADSDSDDSEDEKKKKAKKAKKSKRRLPNANEMPSEKA 420

Query: 413 TIIFVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAAR 472
           TI+FV TRHHVEYV+ LLK+CGYLVSY+YG L+QHAR+QQL+NFR GLT+ILVVTDVAAR
Sbjct: 421 TIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAAR 480

Query: 473 GVDIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWAYTIXXXXXXXXXXXXXXXXGKK 532
           GVDIPLLANV+N SLP SSKIF+HRVGRTARAGN+GWA++I                GKK
Sbjct: 481 GVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVSENELPYLLDLELFLGKK 540

Query: 533 VLLTPMYEATCDLLKKKWISEGNEGALFQPPKISYVNRLILGSAPRLDLEAMGDLFKNLV 592
           +LLTPMYE++C +L+KK  SEGN    F  PK+SY  R++LG+ PR +++ MGDL+ N++
Sbjct: 541 ILLTPMYESSCQILRKKAESEGNNN--FTDPKVSYTTRMVLGACPRSEIDGMGDLYSNMI 598

Query: 593 ESNFELQNLKAVSIKAEKLYLRTRQPASAESIKRAKEVIAAGWDEQNVRFGKNIEKEKLE 652
           +S+FEL  +K V++KAEKLY RTR PASAES+KR+KE++ +GWDEQN+ FGKN EKEKL+
Sbjct: 599 KSDFELNTVKGVALKAEKLYFRTRTPASAESMKRSKEILRSGWDEQNIYFGKNAEKEKLD 658

Query: 653 FLAKLQNRHNKETVFEFARNHDDEMAILMKXXXXXXXXXXXXXKERQQLLEKERQAGLRH 712
           FLAKLQ+R+NKETVFEFARN DDEM++LMK             KERQ+LLEKER  GLRH
Sbjct: 659 FLAKLQHRNNKETVFEFARNPDDEMSVLMKRRRRQIAPIQRKAKERQELLEKERMIGLRH 718

Query: 713 TLEDEILKGEENEVGYSVPQELLRDFEDADELAA-----KRNTKKGFRDENFYLSHFAPA 767
           ++EDEILKGE+NEVGYSVP E+L++FEDAD L       K+  KK FRD  FYLSHFAP 
Sbjct: 719 SIEDEILKGEDNEVGYSVPDEVLKEFEDADVLLEEQENIKKKQKKTFRDPTFYLSHFAPT 778

Query: 768 SDIQDKQLQVASSFTNEVSKATFDLHNDDKVQVHKQTATVKWDKKRKKYVNVQGIDNKKY 827
           SDIQDKQLQ++S FTN+ S A FDL NDDKVQVHKQTATVKWDKKRKKYVN QG+DNKKY
Sbjct: 779 SDIQDKQLQISSGFTNDASNAAFDLANDDKVQVHKQTATVKWDKKRKKYVNTQGLDNKKY 838

Query: 828 IIGESGQKIPASFRSGKFDEWSKARKLAPLKVGARESSIPANLLADPT--GSRLANGKFK 885
           IIGESGQKIPASFRSGKF +WSKARK+APLKVGARES+IP+NLLADPT    R   GKFK
Sbjct: 839 IIGESGQKIPASFRSGKFQDWSKARKIAPLKVGARESTIPSNLLADPTSPSERTVGGKFK 898

Query: 886 HKQIKAPKMPDKNRDDYQSQLKKVNKAMESGLHVKGYNAPGMKQELRTTEQIRKQRSMAE 945
           HK  KAPK+PDK+RDDY  Q KKV  A+E G+ VKGYN PGMKQE+++ ++IRK R + E
Sbjct: 899 HKTQKAPKLPDKHRDDYAFQKKKVEAALERGVRVKGYNGPGMKQEIKSVDEIRKLREIKE 958

>Kwal_56.22804 s56 complement(286570..289491) [2922 bp, 973 aa] {ON}
           YDL031W (DBP10) - similar to RNA helicases [contig 184]
           FULL
          Length = 973

 Score = 1234 bits (3194), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 622/959 (64%), Positives = 734/959 (76%), Gaps = 26/959 (2%)

Query: 6   KRKRDTEEHSDEGEDFDIAGNIALXXXXXXXXXXXXXNE------VQDIIEFSDDEKQNA 59
           KR R  +  SDE ED DIAGNIAL             +       VQDII+FS DE++ +
Sbjct: 7   KRSRREDPLSDE-EDVDIAGNIALDSDESSESEDDSEDGEGEEGDVQDIIDFSGDEEETS 65

Query: 60  PQVSXXXXXXXXXXXXXPRS-DAAFPSLELSXXXXXXXXX--XXXXXSYFNTTSQLXXXX 116
                            P S  A+FP LELS                 YF TT+      
Sbjct: 66  KNAKKTGKAEKK-----PSSKQASFPLLELSDDEEEQAANDGEDDVTEYF-TTTNAEASK 119

Query: 117 XXXXXXXXXXLSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVL 176
                     LSKFI+ NI++KGFRQPTPIQRKTIPLILQ+RDIVGMARTGSGKTAAFVL
Sbjct: 120 HKKGSFASFGLSKFIISNIAKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVL 179

Query: 177 PLIEKLKMHSAKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSM 236
           P+IE+LK HSAKIGARA+I+SPSRELA+QTHKVF+EF++GS+LRSVLLTGG+ LE+QF +
Sbjct: 180 PMIERLKGHSAKIGARAVIMSPSRELALQTHKVFREFSRGSDLRSVLLTGGESLEEQFGL 239

Query: 237 MMSNPDVIIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTAR 296
           MMSNPDV+IATPGRFLHLKVEMNLDL SIEYVVFDEADRLFEMGF+EQLNELL + P AR
Sbjct: 240 MMSNPDVVIATPGRFLHLKVEMNLDLKSIEYVVFDEADRLFEMGFEEQLNELLAAFPVAR 299

Query: 297 QTLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQ 356
           QTLLFSATLPSSLVDFAKAGLT+PVLVRLDTETKVSENLEML+LS KN+EREANLLYLLQ
Sbjct: 300 QTLLFSATLPSSLVDFAKAGLTSPVLVRLDTETKVSENLEMLYLSSKNEEREANLLYLLQ 359

Query: 357 EVIKIPVATEEQLQRFRXX----XXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNS 412
           E ++IPVATEEQL  +R                             + +P+A ++PS ++
Sbjct: 360 EAMQIPVATEEQLAEYRTKIKDDYDSDDSDSKDKLKAKKKKKAMIRRKMPAANELPSEHA 419

Query: 413 TIIFVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAAR 472
           TI+FV TRHHVEY++ LLKDCGYLVSYLYGTLDQHARRQQL NFR GLT ILVVTDVAAR
Sbjct: 420 TIVFVPTRHHVEYITQLLKDCGYLVSYLYGTLDQHARRQQLFNFRAGLTTILVVTDVAAR 479

Query: 473 GVDIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWAYTIXXXXXXXXXXXXXXXXGKK 532
           GVDIP+LANVVN SLPASSKIFVHRVGRTARAGNKG AY+I                GKK
Sbjct: 480 GVDIPMLANVVNYSLPASSKIFVHRVGRTARAGNKGSAYSIVSDNELPYLLDLELFLGKK 539

Query: 533 VLLTPMYEATCDLLKKKWISEGNEGALFQPPKISYVNRLILGSAPRLDLEAMGDLFKNLV 592
           +LLTPMYEAT ++LK +WI+EG     F  PK+SY NR++LG+ PRL+LE  GDLFK+L+
Sbjct: 540 ILLTPMYEATTEMLKSRWIAEGKSELTFNAPKVSYTNRMVLGACPRLELETCGDLFKSLI 599

Query: 593 ESNFELQNLKAVSIKAEKLYLRTRQPASAESIKRAKEVIAAGWDEQNVRFGKNIEKEKLE 652
           +S+F+L+ LKAV+ KAEKLY RTR PAS++S+KR+KEV+++GWDEQN+RFGKN+EKEKL+
Sbjct: 600 DSSFDLKQLKAVANKAEKLYFRTRPPASSQSMKRSKEVLSSGWDEQNLRFGKNMEKEKLD 659

Query: 653 FLAKLQNRHNKETVFEFARNHDDEMAILMKXXXXXXXXXXXXXKERQQLLEKERQAGLRH 712
           FLAKLQNRH+KETVFEFARNHDDEMA+LMK             KER++LLEKER+AGL H
Sbjct: 660 FLAKLQNRHHKETVFEFARNHDDEMALLMKKRRIQIAPIQRRAKERKELLEKERKAGLVH 719

Query: 713 TLEDEILKGEENEVGYSVPQELL-RDFEDADEL---AAKRNTKKGFRDENFYLSHFAPAS 768
           ++EDEILKG+E EVGYSVP+E+L ++FEDADEL     K   +K FRD  ++LSH+APAS
Sbjct: 720 SVEDEILKGDETEVGYSVPEEVLHQEFEDADELLEGQKKEKKQKSFRDPTYFLSHYAPAS 779

Query: 769 DIQDKQLQVASSFTNEVSKATFDLHNDDKVQVHKQTATVKWDKKRKKYVNVQGIDNKKYI 828
           +IQDKQL+V++ FTNE + ATFDLHNDDKVQ HKQ AT+KWDKKR+KYVN QG+DNKKYI
Sbjct: 780 EIQDKQLEVSNGFTNEAANATFDLHNDDKVQNHKQIATIKWDKKRQKYVNSQGLDNKKYI 839

Query: 829 IGESGQKIPASFRSGKFDEWSKARKLAPLKVGARESSIPANLLADPTGS--RLANGKFKH 886
            GESG KIPASFRSGKFDEWSKARKL P+KVGARESS  + +L++PT +  R+  GKFKH
Sbjct: 840 TGESGHKIPASFRSGKFDEWSKARKLGPIKVGARESSSTSKMLSNPTSNNQRMGGGKFKH 899

Query: 887 KQIKAPKMPDKNRDDYQSQLKKVNKAMESGLHVKGYNAPGMKQELRTTEQIRKQRSMAE 945
            ++KAPK+PDKNRDDY  Q KKV KA+ SG+ VKG+NAPGMK E+RT +QI K+R   E
Sbjct: 900 NKVKAPKLPDKNRDDYHVQKKKVEKAISSGIRVKGFNAPGMKSEMRTPQQIYKERVAKE 958

>NCAS0C03530 Chr3 (703955..706888) [2934 bp, 977 aa] {ON} Anc_3.159
          Length = 977

 Score = 1219 bits (3155), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 616/948 (64%), Positives = 725/948 (76%), Gaps = 25/948 (2%)

Query: 16  DEGED--FDIAGNIALXXXXXXXXXXXXXNE-VQDIIEFSDDEKQNAPQVSXXXXXXXXX 72
           DE +D  FDIAG+IAL              E VQD+IE+SDDE +   +           
Sbjct: 22  DEDQDVGFDIAGDIALNSSESDASESDDDEEDVQDVIEYSDDETETKKKNDKKKNNNKTK 81

Query: 73  XXXXPRSDAAFPSLELSXXXXXXXXXXXX---XXSYFNTTSQLXXXXXXXXXXXXXXLSK 129
                    +FPSLELS                 +YF+TT+ L              LSK
Sbjct: 82  ED------KSFPSLELSDDEADRRNNEDEDDDVNAYFSTTN-LDKSKHKKGSFPSFGLSK 134

Query: 130 FILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHSAKI 189
           FI+ NI+RKGFRQPTPIQRKTIPLILQ RDIVGMARTGSGKTAAF+LP+IEKLK HS KI
Sbjct: 135 FIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIEKLKTHSGKI 194

Query: 190 GARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIATPG 249
           GARA+ILSPSRELAMQTH VFK+F+KG+ LRSVLLTGGD LEDQF MMM+NPDVIIATPG
Sbjct: 195 GARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMMMNNPDVIIATPG 254

Query: 250 RFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSATLPSSL 309
           RFLHLKVEMNLDL SIEY VFDEADRLFEMGFQEQLNELL SLP++RQTLLFSATLPSSL
Sbjct: 255 RFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSSRQTLLFSATLPSSL 314

Query: 310 VDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVATEEQL 369
           VDFAKAGLTNPVLVRLD ETK+SENLEMLFLS KNDEREANLLYLLQEVIKIP+A+ +QL
Sbjct: 315 VDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREANLLYLLQEVIKIPLASRDQL 374

Query: 370 QRFRXXX----XXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEY 425
            +F                              + LP A  +PS  STI+FV TRHHVEY
Sbjct: 375 AKFNAQNIKDNASDSDSDGDDKRQKGKRKKFKKERLPPANQLPSEKSTILFVPTRHHVEY 434

Query: 426 VSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNM 485
           +SNLL++ GYL+SY+YGTLDQHAR++QL+NFR GLT+ILVVTDVAARGVDIP+LANV+N 
Sbjct: 435 ISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARGVDIPMLANVINF 494

Query: 486 SLPASSKIFVHRVGRTARAGNKGWAYTIXXXXXXXXXXXXXXXXGKKVLLTPMYEATCDL 545
           SLPASSKIFVHRVGRTARAGN+GWAY+I                GKK+L+TPMY++  D+
Sbjct: 495 SLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLDLEIFLGKKILMTPMYDSMSDI 554

Query: 546 LKKKWISEGNEGALFQPPKISYVNRLILGSAPRLDLEAMGDLFKNLVESNFELQNLKAVS 605
           + KKWI+EG++   F+PPK+SY NR+ILGSAPRL+LE +GDL++N+++SNFE+Q LK V+
Sbjct: 555 MLKKWIAEGHDEINFKPPKVSYTNRMILGSAPRLELEGLGDLYQNVMKSNFEIQLLKGVA 614

Query: 606 IKAEKLYLRTRQPASAESIKRAKEVIAAGWDEQNVRFGKNIEKEKLEFLAKLQNRHNKET 665
           +KAEKLY RTR  AS ES+KR+KE+IA+GWDEQN+ FGKN EKEKL+FLAKLQNR NKET
Sbjct: 615 MKAEKLYFRTRPAASPESLKRSKEIIASGWDEQNIMFGKNAEKEKLDFLAKLQNRRNKET 674

Query: 666 VFEFARNHDDEMAILMKXXXXXXXXXXXXXKERQQLLEKERQAGLRHTLEDEILKGEENE 725
           VFEFA N DDEM++ MK             KER +LL+KE+ AGL HT+EDE+LKG+  E
Sbjct: 675 VFEFASNPDDEMSVFMKRRRRQLAPIQRKAKERHELLQKEKLAGLTHTMEDEVLKGDNAE 734

Query: 726 -VGYSVPQELLRDFEDADELAAKRNT---KKGFRDENFYLSHFAPASDIQDKQLQVASSF 781
              Y++ ++ L+ FED DEL A +     KK F+D  F+LSH+APASDIQDKQLQVA+ F
Sbjct: 735 DNSYTISEDTLKQFEDGDELLAGQENKKKKKTFKDPTFFLSHYAPASDIQDKQLQVANGF 794

Query: 782 TNEVSKATFDLHNDDKVQVHKQTATVKWDKKRKKYVNVQGIDNKKYIIGESGQKIPASFR 841
            NE ++A +DL+NDDKVQVHKQTATVKWDKKRKKYVNVQG+DNKKYIIGESGQKI ASFR
Sbjct: 795 ANEAAQAAYDLNNDDKVQVHKQTATVKWDKKRKKYVNVQGLDNKKYIIGESGQKIAASFR 854

Query: 842 SGKFDEWSKARKLAPLKVGARESSIPANLLADPTGSRLAN----GKFKHKQIKAPKMPDK 897
           SGKFDEW+KARKL PLKVGARESSIP+NLL+DPT    A     GKFKHKQ+KAPK+PDK
Sbjct: 855 SGKFDEWTKARKLKPLKVGARESSIPSNLLSDPTQGPGAQNSVRGKFKHKQLKAPKLPDK 914

Query: 898 NRDDYQSQLKKVNKAMESGLHVKGYNAPGMKQELRTTEQIRKQRSMAE 945
           +RDDYQ+Q KKV KA+E+G+ V+G+  PGMK EL++TE+IRKQR+  E
Sbjct: 915 HRDDYQTQKKKVAKALENGVQVRGFRGPGMKSELKSTEEIRKQRAFME 962

>SAKL0C08778g Chr3 (804617..807628) [3012 bp, 1003 aa] {ON} similar
           to uniprot|Q12389 Saccharomyces cerevisiae YDL031W DBP10
           Essential protein involved in ribosome biogenesis
           putative ATP-dependent RNA helicase of the DEAD- box
           protein family
          Length = 1003

 Score = 1215 bits (3144), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 619/986 (62%), Positives = 739/986 (74%), Gaps = 47/986 (4%)

Query: 1   MGLAS-KRKRDTEEHS-----DEGEDFDIAGNIALXXXXXXXXXXXXX-----NEVQDII 49
           MG  S KRKR++   S     +E + FDIAG+IAL                   EVQD+I
Sbjct: 1   MGSTSLKRKRESNNPSVEEEEEEEDVFDIAGDIALDSSEDDDDDDDDGEQDSEQEVQDVI 60

Query: 50  EFSDDEKQNAPQVSXXXXXXX----XXXXXXPRSDAAFPSLELSXXXXXXXXXXXXXXS- 104
           EFSD E+Q     S                 PR   +FP+LELS              + 
Sbjct: 61  EFSDGEEQGKKNQSKGAAKSAAKGNSKGAKQPR--PSFPTLELSDAEDEAPDADKDAVND 118

Query: 105 YFNTTSQLXXXXXXXXXXXXXXLSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMA 164
           YF+TT+                 SKFIL NISRKGFRQPTPIQRKTIPLILQ RDIVGMA
Sbjct: 119 YFSTTAAAAAGKHKKGSFPSFGFSKFILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMA 178

Query: 165 RTGSGKTAAFVLPLIEKLKMHSAKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLL 224
           RTGSGKTAAF LP+IEKLK HSAKIG RA+ILSPSRELAMQT+KVFKEF++GS+LRSVLL
Sbjct: 179 RTGSGKTAAFTLPMIEKLKGHSAKIGVRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLL 238

Query: 225 TGGDGLEDQFSMMMSNPDVIIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQ 284
           TGGD LE+QF MMM NPDV+IATPGRFLHLKVEMNLDL ++EYVVFDEADRLFEMGFQEQ
Sbjct: 239 TGGDSLEEQFGMMMGNPDVVIATPGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQ 298

Query: 285 LNELLGSLPTARQTLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKN 344
           LNELL +LP  RQTLLFSATLP SLVDFAKAGLTNPVLVRLD E+KVSENLEMLFL+ KN
Sbjct: 299 LNELLAALPPTRQTLLFSATLPHSLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKN 358

Query: 345 DEREANLLYLLQEVIKIPVATEEQLQRFRX---XXXXXXXXXXXXXXXXXXXXXXXXQPL 401
            EREANLLYLLQEVI+IPVAT EQL++ R                            + +
Sbjct: 359 GEREANLLYLLQEVIRIPVATAEQLKQLRALNDRSDSDADSDANDKNDRKKRKKQARRKM 418

Query: 402 PSAKDMPSPNSTIIFVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLT 461
           PSA ++PS  +TI+FV TRHHVEYVS LLKD GYLVSY+YGTLDQ+AR+QQL NFR GLT
Sbjct: 419 PSANELPSEKATILFVPTRHHVEYVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLT 478

Query: 462 NILVVTDVAARGVDIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWAYTIXXXXXXXX 521
           +ILVVTDVAARGVDIP+LANV+N SLP+SSKIF+HRVGRTARAGN GWAY+I        
Sbjct: 479 SILVVTDVAARGVDIPMLANVINFSLPSSSKIFIHRVGRTARAGNSGWAYSIVSENELPY 538

Query: 522 XXXXXXXXGKKVLLTPMYEATCDLLKKKWISEGNEGALFQPPKISYVNRLILGSAPRLDL 581
                   GKK+LL PMY+ATC+L++K+W++EG + + F  P++SY NR++LGS PRL++
Sbjct: 539 LLDLELFLGKKILLAPMYDATCELMRKQWVAEGKQESEFVAPRVSYTNRMVLGSCPRLEM 598

Query: 582 EAMGDLFKNLVESNFELQNLKAVSIKAEKLYLRTRQPASAESIKRAKEVIAAGWDEQNVR 641
           E+MGDL+KNLVES+F+LQ LK+V++KAEKLY RTR PAS E++KR+KE+IA+GWDEQN++
Sbjct: 599 ESMGDLYKNLVESSFDLQLLKSVALKAEKLYFRTRAPASTEAMKRSKEIIASGWDEQNLK 658

Query: 642 FGKNIEKEKLEFLAKLQNRHNKETVFEFARNHDDEMAILMKXXXXXXXXXXXXXKERQQL 701
           FGKN+EKEKL+FLAKLQNR++KETVFEFARN +DEMA+LM+             +ERQ+L
Sbjct: 659 FGKNLEKEKLDFLAKLQNRNHKETVFEFARNQEDEMAVLMRRRRRQIAPIQRKARERQEL 718

Query: 702 LEKERQAGLRHTLEDEILKGEENEVGYSVPQELL-RDFEDADELAAKRNT---------K 751
           LEKER AGLRHTLEDE+LKG + E GYSVP+E+L ++FEDAD++  ++           +
Sbjct: 719 LEKERMAGLRHTLEDEVLKGGDGEFGYSVPEEVLAQEFEDADKILDEQENKKKTKTMKTR 778

Query: 752 KG--------------FRDENFYLSHFAPASDIQDKQLQVASSFTNEVSKATFDLHNDDK 797
           +G              ++D NF+LSH+APA DIQDKQLQ+ S FTN+ + ATFDLH+D+K
Sbjct: 779 QGETKPKPKPKPKPKTYKDPNFFLSHYAPAGDIQDKQLQLTSGFTNDAADATFDLHDDNK 838

Query: 798 VQVHKQTATVKWDKKRKKYVNVQGIDNKKYIIGESGQKIPASFRSGKFDEWSKARKLAPL 857
           VQVHKQTATVKWDKKRKKYVN QG+DNKKYIIGESGQKIPASFRSGKF EWSKARKL PL
Sbjct: 839 VQVHKQTATVKWDKKRKKYVNAQGLDNKKYIIGESGQKIPASFRSGKFAEWSKARKLGPL 898

Query: 858 KVGARESSIPANLLADPT--GSRLANGKFKHKQIKAPKMPDKNRDDYQSQLKKVNKAMES 915
           KVGARE+S P+NLL+DP   G R+A G+FKHK  KAPK+PD++RDDY++Q KKV  A+E 
Sbjct: 899 KVGARETSGPSNLLSDPASGGRRVAGGRFKHKLDKAPKLPDRHRDDYKTQQKKVANALER 958

Query: 916 GLHVKGYNAPGMKQELRTTEQIRKQR 941
           G+ VKG+ APG K E+++TEQIR QR
Sbjct: 959 GISVKGFGAPGAKSEMKSTEQIRSQR 984

>KAFR0C01060 Chr3 complement(215822..218743) [2922 bp, 973 aa] {ON}
           Anc_3.159 YDL031W
          Length = 973

 Score = 1209 bits (3128), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 602/960 (62%), Positives = 716/960 (74%), Gaps = 29/960 (3%)

Query: 8   KRDTEEHSDEGE-----DFDIAGNIALXXXXXXXXXX--XXXNEVQDIIEFSDDEKQNAP 60
           KR  +EH  + E     +FDIA NIAL                EV+DII +SDDEK    
Sbjct: 6   KRTLQEHDSDSETESANEFDIASNIALNSSDSDSDSDVDEQDGEVEDIISYSDDEKSQVE 65

Query: 61  QVSXXXXXXXXXXXXXPRSDAAFPSLELSXXXXXXXXXXXX---XXSYFNTTSQLXXXXX 117
           +V                    FP LELS                 SYF+T +       
Sbjct: 66  EVPKKSKKEKKVIKD-------FPLLELSDDEDSKKQANDNDDDVNSYFSTNNLNTKTKH 118

Query: 118 XXXXXXXXXLSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLP 177
                    LSK IL NIS++GFRQPTPIQRKTIPLILQ RDIVGMARTGSGKTAAFVLP
Sbjct: 119 KKGSFASFGLSKLILTNISKRGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFVLP 178

Query: 178 LIEKLKMHSAKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMM 237
           +IEKLK HS+KIGARA+ILSPSRELAMQTH VFKEF+KGS+LRSVLLTGGD LEDQF M+
Sbjct: 179 MIEKLKTHSSKIGARAIILSPSRELAMQTHNVFKEFSKGSDLRSVLLTGGDSLEDQFGMI 238

Query: 238 MSNPDVIIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQ 297
           M+NPDVIIATPGRFLHLKVEMNLDL S+EY+ FDEADRLFEMGFQEQLNEL+ SLP+ RQ
Sbjct: 239 MANPDVIIATPGRFLHLKVEMNLDLKSVEYICFDEADRLFEMGFQEQLNELIYSLPSNRQ 298

Query: 298 TLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQE 357
           TLLFSATLPSSLVDFAKAGLTNPVLVRLDTETK+SENLEMLFLS+KN+EREANLLYLLQE
Sbjct: 299 TLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKISENLEMLFLSIKNEEREANLLYLLQE 358

Query: 358 VIKIPVATEEQLQRF----RXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNST 413
            I IP+ATEEQ+++     +                         Q LP A  +PS  +T
Sbjct: 359 EICIPLATEEQIKKLNNESKIDDDSDSEDDEATRRQKRKSKNFKKQRLPPANQLPSEKAT 418

Query: 414 IIFVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARG 473
           IIFV TRHHVEY+S LLKDCGYLVSY+YGTLDQ AR +QL+NFR GLT+ILVVTDVAARG
Sbjct: 419 IIFVPTRHHVEYISQLLKDCGYLVSYIYGTLDQRARNRQLYNFRLGLTSILVVTDVAARG 478

Query: 474 VDIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWAYTIXXXXXXXXXXXXXXXXGKKV 533
           VDIP+LANV+N SLP SSK+FVHRVGRTARAGN+GWAY+I                GKK+
Sbjct: 479 VDIPMLANVINFSLPVSSKVFVHRVGRTARAGNRGWAYSIVSENELPYLLDLELFLGKKI 538

Query: 534 LLTPMYEATCDLLKKKWISEGNEGALFQPPKISYVNRLILGSAPRLDLEAMGDLFKNLVE 593
           LLT MY+ATCD++KKKW+SEG     FQ PK SY NR++LGSAPRL +E + DL+  ++ 
Sbjct: 539 LLTSMYDATCDIMKKKWVSEGKSELTFQDPKPSYTNRMVLGSAPRLQVEDLNDLYTGVLS 598

Query: 594 SNFELQNLKAVSIKAEKLYLRTRQPASAESIKRAKEVIAAGWDEQNVRFGKNIEKEKLEF 653
            +F+L+ +K  ++KAEKLY RTR  AS ES+KR+KE+I +GWDEQN+RFGKN+EKEK +F
Sbjct: 599 GSFDLKMMKQTALKAEKLYFRTRTSASPESMKRSKEIILSGWDEQNIRFGKNVEKEKFQF 658

Query: 654 LAKLQNRHNKETVFEFARNHDDEMAILMKXXXXXXXXXXXXXKERQQLLEKERQAGLRHT 713
           LAKLQNRHNKETVFEFARN DDEM++LMK             +ER++L+EKER AGL H 
Sbjct: 659 LAKLQNRHNKETVFEFARNPDDEMSVLMKRRRRQLAPIQRKAEERRELMEKERLAGLTHR 718

Query: 714 LEDEILKGEENEVGYSVPQELLRDFEDAD---ELAAKRNTKKGFRDENFYLSHFAPASDI 770
           +ED+ILKG++ E GY+VP++ L++FEDAD   E + K++ +K FRDENF+LSH+AP S I
Sbjct: 719 IEDQILKGDDFEAGYTVPEDALKEFEDADKVLEASNKKSEQKTFRDENFFLSHYAPTSAI 778

Query: 771 QDKQLQVASSFTNEVSKATFDLHNDDKVQVHKQTATVKWDKKRKKYVNVQGIDNKKYIIG 830
           QD+Q ++++ FTN  ++A +DL++DDKVQVHKQTATVKWDKKRKKYVN+QGIDNKKYI+G
Sbjct: 779 QDQQYKLSTGFTNAAAEAAYDLNSDDKVQVHKQTATVKWDKKRKKYVNMQGIDNKKYIVG 838

Query: 831 ESGQKIPASFRSGKFDEWSKARKLAPLKVGARESSIPANLLADPT-----GSRLANGKFK 885
           ESGQKI ASFRSGKF+EWSKARKL PLKVGARES++  NLL++PT     G +   GKFK
Sbjct: 839 ESGQKIAASFRSGKFEEWSKARKLKPLKVGARESTMQTNLLSNPTENNSNGQKTVRGKFK 898

Query: 886 HKQIKAPKMPDKNRDDYQSQLKKVNKAMESGLHVKGYNAPGMKQELRTTEQIRKQRSMAE 945
           HKQ+K+PK+PDK RDDY+ Q KKV  A+  G HVKGY+ PGMK EL++TEQIRK+R   E
Sbjct: 899 HKQMKSPKLPDKFRDDYEKQKKKVASALARGAHVKGYSGPGMKNELKSTEQIRKERMAKE 958

>YDL031W Chr4 (394217..397204) [2988 bp, 995 aa] {ON}  DBP10Putative
           ATP-dependent RNA helicase of the DEAD-box protein
           family, constituent of 66S pre-ribosomal particles;
           essential protein involved in ribosome biogenesis
          Length = 995

 Score = 1201 bits (3106), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 607/981 (61%), Positives = 717/981 (73%), Gaps = 37/981 (3%)

Query: 1   MGLASKRKRDTEEHSDEGED-----FDIAGNIALXXXXXXXXXXXXX-------NEVQDI 48
           M    KRKRD E+  D G +     FDIA  IAL                    N+VQD+
Sbjct: 1   MAGVQKRKRDLEDQDDNGSEEDDIAFDIANEIALNDSESDANDSDSEVEADYGPNDVQDV 60

Query: 49  IEFSDDEKQNAPQVSXXXXXXXXXXXXXPRSDAAFPSLELSXXXXXXXXXXXX------X 102
           IE+S DE++                    +  AAFP LE+S                   
Sbjct: 61  IEYSSDEEEGVNNKKKAENKDIKKKKNSKKEIAAFPMLEMSDDENNASGKTQTGDDEDDV 120

Query: 103 XSYFNTTSQLXXXXXXXXXXXXXXLSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVG 162
             YF +T+ L              LSK +L NI RKGFRQPTPIQRKTIPLILQ RDIVG
Sbjct: 121 NEYF-STNNLEKTKHKKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVG 179

Query: 163 MARTGSGKTAAFVLPLIEKLKMHSAKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSV 222
           MARTGSGKTAAF+LP++EKLK HS KIGARA+ILSPSRELAMQT  VFK+FA+G+ LRSV
Sbjct: 180 MARTGSGKTAAFILPMVEKLKSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSV 239

Query: 223 LLTGGDGLEDQFSMMMSNPDVIIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQ 282
           LLTGGD LE+QF MMM+NPDVIIATPGRFLHLKVEMNLDL S+EYVVFDEADRLFEMGFQ
Sbjct: 240 LLTGGDSLEEQFGMMMTNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQ 299

Query: 283 EQLNELLGSLPTARQTLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSV 342
           EQLNELL SLPT RQTLLFSATLP+SLVDF KAGL NPVLVRLD ETKVSENLEMLFLS 
Sbjct: 300 EQLNELLASLPTTRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSS 359

Query: 343 KNDEREANLLYLLQEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXX-----XXXXXX 397
           KN +REANLLY+LQE+IKIP+AT EQLQ+ +                             
Sbjct: 360 KNADREANLLYILQEIIKIPLATSEQLQKLQNSNNEADSDSDDENDRQKKRRNFKKEKFR 419

Query: 398 XQPLPSAKDMPSPNSTIIFVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFR 457
            Q +P+A ++PS  +TI+FV TRHHVEY+S LL+DCGYL+SY+YGTLDQHAR++QL+NFR
Sbjct: 420 KQKMPAANELPSEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKRQLYNFR 479

Query: 458 CGLTNILVVTDVAARGVDIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWAYTIXXXX 517
            GLT+ILVVTDVAARGVDIP+LANV+N +LP SSKIFVHRVGRTARAGNKGWAY+I    
Sbjct: 480 AGLTSILVVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVAEN 539

Query: 518 XXXXXXXXXXXXGKKVLLTPMYEATCDLLKKKWISEGNEGALFQPPKISYVNRLILGSAP 577
                       GKK+LLTPMY++  D++KK+WI EG     FQPPK+SY  RL+LGS P
Sbjct: 540 ELPYLLDLELFLGKKILLTPMYDSLVDVMKKRWIDEGKPEYQFQPPKLSYTKRLVLGSCP 599

Query: 578 RLDLEAMGDLFKNLVESNFELQNLKAVSIKAEKLYLRTRQPASAESIKRAKEVIAAGWDE 637
           RLD+E +GDL+KNL+ SNF+LQ  K  ++KAEKLY RTR  AS ES+KR+KE+I++GWD 
Sbjct: 600 RLDVEGLGDLYKNLMSSNFDLQLAKKTAMKAEKLYYRTRTSASPESLKRSKEIISSGWDA 659

Query: 638 QNVRFGKNIEKEKLEFLAKLQNRHNKETVFEFARNHDDEMAILMKXXXXXXXXXXXXXKE 697
           QN  FGKN EKEKL+FLAKLQNR NKETVFEF RN DDEMA+ MK              E
Sbjct: 660 QNAFFGKNEEKEKLDFLAKLQNRRNKETVFEFTRNPDDEMAVFMKRRRKQLAPIQRKATE 719

Query: 698 RQQLLEKERQAGLRHTLEDEILKGEENEVGYSVPQELLRDFEDADE-LAAKRN------T 750
           R++LLEKER AGL H++EDEILKG++ E GY+V ++ L++FEDAD+ L A+ N       
Sbjct: 720 RRELLEKERMAGLSHSIEDEILKGDDGETGYTVSEDALKEFEDADQLLEAQENENKKKKK 779

Query: 751 KKGFRDENFYLSHFAPASDIQDKQLQVASSFTNEVSKATFDLHNDDKVQVHKQTATVKWD 810
            K F+D  F+LSH+APA DIQDKQLQ+ + F N+ ++A +DL++DDKVQVHKQTATVKWD
Sbjct: 780 PKSFKDPTFFLSHYAPAGDIQDKQLQITNGFANDAAQAAYDLNSDDKVQVHKQTATVKWD 839

Query: 811 KKRKKYVNVQGIDNKKYIIGESGQKIPASFRSGKFDEWSKARKLAPLKVGARESSIPANL 870
           KKRKKYVN QGIDNKKYIIGESGQKI ASFRSG+FD+WSKAR L PLKVG+RE+SIP+NL
Sbjct: 840 KKRKKYVNTQGIDNKKYIIGESGQKIAASFRSGRFDDWSKARNLKPLKVGSRETSIPSNL 899

Query: 871 LADPTGSRLAN-----GKFKHKQIKAPKMPDKNRDDYQSQLKKVNKAMESGLHVKGY-NA 924
           L DP+    AN     GKFKHKQ+KAPKMPDK+RD+Y SQ KKV KA++SG+ VKGY NA
Sbjct: 900 LEDPSQGPAANGRTVRGKFKHKQMKAPKMPDKHRDNYYSQKKKVEKALQSGISVKGYNNA 959

Query: 925 PGMKQELRTTEQIRKQRSMAE 945
           PG++ EL++TEQIRK R +AE
Sbjct: 960 PGLRSELKSTEQIRKDRIIAE 980

>Skud_4.220 Chr4 (389016..392021) [3006 bp, 1001 aa] {ON} YDL031W
           (REAL)
          Length = 1001

 Score = 1193 bits (3086), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 617/987 (62%), Positives = 718/987 (72%), Gaps = 43/987 (4%)

Query: 1   MGLASKRKRDTEEHSDEGED-----FDIAGNIALXXXXXXXXXXXXXNE-------VQDI 48
           M    KRKRD E+    G +     FDIA +IAL              E       VQD+
Sbjct: 1   MSGVQKRKRDLEDQDVSGSEEEDTAFDIANDIALNGSDSDSDGSSSGTEADYGLGDVQDV 60

Query: 49  IEFSDDEKQNAPQVSXXXXXXXXXXX------XXPRSDAAFPSLELSXXXXXXXXXXXX- 101
           I++S DE++                          +  AAFP+LELS             
Sbjct: 61  IKYSSDEEREGDSKKKANGKNGKKNKSDNKKKSGKKEVAAFPTLELSDDENDASGKTQAD 120

Query: 102 -----XXSYFNTTSQLXXXXXXXXXXXXXXLSKFILGNISRKGFRQPTPIQRKTIPLILQ 156
                   YF+TT+ L              LSK +L NI RKGFRQPTPIQRKTIPLILQ
Sbjct: 121 DDEDDVNEYFSTTN-LEKTKHKKGSFPSFGLSKVVLNNIKRKGFRQPTPIQRKTIPLILQ 179

Query: 157 QRDIVGMARTGSGKTAAFVLPLIEKLKMHSAKIGARAMILSPSRELAMQTHKVFKEFAKG 216
            RDIVGMARTGSGKTAAF+LP++EKLK HS KIGARA+ILSPSRELAMQT  VFK+FAKG
Sbjct: 180 SRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIGARAVILSPSRELAMQTFNVFKDFAKG 239

Query: 217 SNLRSVLLTGGDGLEDQFSMMMSNPDVIIATPGRFLHLKVEMNLDLHSIEYVVFDEADRL 276
           + LRSVLLTGGD LE+QFSMMMSNPDVIIATPGRFLHLKVEMNLDL S+EYVVFDEADRL
Sbjct: 240 TELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRL 299

Query: 277 FEMGFQEQLNELLGSLPTARQTLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLE 336
           FEMGFQEQLNELL SLP  RQTLLFSATLP+SLVDF KAGL NPVLVRLDTETKVSENLE
Sbjct: 300 FEMGFQEQLNELLASLPARRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDTETKVSENLE 359

Query: 337 MLFLSVKNDEREANLLYLLQEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXX 396
           MLFLS KN +REANLLY+LQEVIKIP+AT EQLQ+ +                       
Sbjct: 360 MLFLSSKNADREANLLYILQEVIKIPLATSEQLQKLQKSNNEADSDSDDENDRHKKKRNF 419

Query: 397 -----XXQPLPSAKDMPSPNSTIIFVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQ 451
                  Q +P+A ++PS  +TI+FV TRHHVEY+S LL+DCGYL+SY+YGTLDQHAR++
Sbjct: 420 KKEKFRKQKMPAANELPSERATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKR 479

Query: 452 QLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWAY 511
           QL+NFR GLT+ILVVTDVAARGVDIP+LANV+N +LP SSKIFVHRVGRTARAGNKGWAY
Sbjct: 480 QLYNFRAGLTSILVVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAY 539

Query: 512 TIXXXXXXXXXXXXXXXXGKKVLLTPMYEATCDLLKKKWISEGNEGALFQPPKISYVNRL 571
           +I                GKK+LL PMY+   D +KK+WI EGN    FQPPK+SY  RL
Sbjct: 540 SIVSENELPYLLDLELFLGKKILLAPMYDNLVDSIKKRWIDEGNLEFQFQPPKLSYTKRL 599

Query: 572 ILGSAPRLDLEAMGDLFKNLVESNFELQNLKAVSIKAEKLYLRTRQPASAESIKRAKEVI 631
           +LGS PRLD+E +GDL+KNL+ SNF+LQ     S+KAEKLY RTR  AS ES+KR+KE+I
Sbjct: 600 VLGSCPRLDVEGLGDLYKNLMTSNFDLQLAMKTSMKAEKLYYRTRTSASPESLKRSKEII 659

Query: 632 AAGWDEQNVRFGKNIEKEKLEFLAKLQNRHNKETVFEFARNHDDEMAILMKXXXXXXXXX 691
           A+GWD QN  FGKN EKEKL+FLAKLQNR NKETVFEF RN DDEMA+LMK         
Sbjct: 660 ASGWDAQNAFFGKNEEKEKLDFLAKLQNRRNKETVFEFTRNPDDEMAVLMKRRRKQLAPI 719

Query: 692 XXXXKERQQLLEKERQAGLRHTLEDEILKGEENEVGYSVPQELLRDFEDADE-LAAKRN- 749
                ER++LLEKER AGL H++E+EILKG++ E GY+V +E L++FEDAD+ L A+ N 
Sbjct: 720 QRKASERRKLLEKERMAGLSHSIENEILKGDDGETGYTVSEEALKEFEDADQLLEAQEND 779

Query: 750 -----TKKGFRDENFYLSHFAPASDIQDKQLQVASSFTNEVSKATFDLHNDDKVQVHKQT 804
                  K F+D  F+LSH+APA +IQDKQLQ+AS F N+ + A +DL+ DDKVQVHKQT
Sbjct: 780 SKKKKKPKTFKDPTFFLSHYAPAGEIQDKQLQIASGFANDAAHAAYDLNTDDKVQVHKQT 839

Query: 805 ATVKWDKKRKKYVNVQGIDNKKYIIGESGQKIPASFRSGKFDEWSKARKLAPLKVGARES 864
           ATVKWDKKRKKYVN QGIDNKKYIIGESGQKI ASFRSG+FD+WSKAR L PLK G+RES
Sbjct: 840 ATVKWDKKRKKYVNTQGIDNKKYIIGESGQKIAASFRSGRFDDWSKARNLKPLKAGSRES 899

Query: 865 SIPANLLADPT---GS--RLANGKFKHKQIKAPKMPDKNRDDYQSQLKKVNKAMESGLHV 919
           SIP+NLLADP+   GS  R A GKFKHKQ+KAPKMPDK+RD+Y SQ KKV KA++SG++V
Sbjct: 900 SIPSNLLADPSQGPGSNGRTARGKFKHKQMKAPKMPDKHRDNYYSQKKKVEKALQSGVNV 959

Query: 920 KGY-NAPGMKQELRTTEQIRKQRSMAE 945
           KG+ NAPG+  EL++TEQIRK R MAE
Sbjct: 960 KGHNNAPGLSSELKSTEQIRKDRVMAE 986

>CAGL0K01551g Chr11 (136421..139330) [2910 bp, 969 aa] {ON} highly
           similar to uniprot|Q12389 Saccharomyces cerevisiae
           YDL031w
          Length = 969

 Score = 1192 bits (3083), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 601/959 (62%), Positives = 709/959 (73%), Gaps = 29/959 (3%)

Query: 6   KRKRDTEEHSDEGEDFDIAGNIA--LXXXXXXXXXXXXXNEVQDIIEFSDDEKQNAPQVS 63
           KRK   E  SD  E+ DIAGN+                  EVQD+IE+S DE++ A    
Sbjct: 6   KRKERDEHESDSDEEIDIAGNLVADGSDSESDDSSDGSDEEVQDVIEYSSDEEEPAKPAK 65

Query: 64  XXXXXXXXXXXXXPRSDAAFPSLELSX---XXXXXXXXXXXXXSYFNTTSQLXXXXXXXX 120
                           D +FPSLELS                 +YF+  +          
Sbjct: 66  AVKKKV---------EDKSFPSLELSDDEDEKKKVDNDDDDVNAYFSVNTD-AKSKHKKG 115

Query: 121 XXXXXXLSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIE 180
                 LSK IL NIS++GFRQPTPIQRKTIPLILQ RDIVGMARTGSGKTAAFVLP+IE
Sbjct: 116 SFASFGLSKLILVNISKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIE 175

Query: 181 KLKMHSAKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSN 240
           KLK HS+KIGARA+ILSPSRELAMQTH VFKEF++G++LRSVLLTGGD LEDQF MMM+N
Sbjct: 176 KLKTHSSKIGARAIILSPSRELAMQTHSVFKEFSRGTHLRSVLLTGGDSLEDQFGMMMTN 235

Query: 241 PDVIIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLL 300
           PDVIIATPGRFLHLKVEMNLDL S+EY VFDEADRLFEMGFQEQLNELL +LP++RQTLL
Sbjct: 236 PDVIIATPGRFLHLKVEMNLDLKSVEYAVFDEADRLFEMGFQEQLNELLAALPSSRQTLL 295

Query: 301 FSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIK 360
           FSATLP+SLVDFAKAGL NPVLVRLD E+K+S+NLEMLFLS KNDEREANLLY+LQEVIK
Sbjct: 296 FSATLPTSLVDFAKAGLVNPVLVRLDAESKISDNLEMLFLSTKNDEREANLLYILQEVIK 355

Query: 361 IPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXX--XQPLPSAKDMPSPNSTIIFVS 418
           +P+AT EQ+++                             + +P A ++PS  +T++FV 
Sbjct: 356 LPLATPEQIKQLNDNKADDSDESAEEDEDKKRRKRKSFNRKAMPKANELPSEKATVVFVP 415

Query: 419 TRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPL 478
           TRHHVEY+SNLLKDCGYLVSY+YG LDQHAR+ QL+NFR GLT+ILVVTDVAARGVDIP+
Sbjct: 416 TRHHVEYLSNLLKDCGYLVSYIYGALDQHARKSQLYNFRIGLTSILVVTDVAARGVDIPM 475

Query: 479 LANVVNMSLPASSKIFVHRVGRTARAGNKGWAYTIXXXXXXXXXXXXXXXXGKKVLLTPM 538
           LANVVN SLPASSKIF+HRVGRTARAGN+GWAY+I                G+K+LLTPM
Sbjct: 476 LANVVNYSLPASSKIFIHRVGRTARAGNRGWAYSIVSENELPYLLDLELFLGRKILLTPM 535

Query: 539 YEATCDLLKKKWISEGNEGALFQPPKISYVNRLILGSAPRLDLEAMGDLFKNLVESNFEL 598
           YEA   L K+KW++EGN+  LFQ PKISY +R++LGS PRLD+EA+ +L+ NL++SNF+L
Sbjct: 536 YEALERLSKEKWVAEGNDETLFQSPKISYTSRMVLGSCPRLDIEALSELYNNLMKSNFDL 595

Query: 599 QNLKAVSIKAEKLYLRTRQPASAESIKRAKEVIAAGWDEQNVRFGKNIEKEKLEFLAKLQ 658
              K  ++KAEKLY RTR  AS ES+KR+KE+I++GWDEQNV FGKN+EKEK  FL KLQ
Sbjct: 596 DMAKKTALKAEKLYFRTRTSASPESLKRSKEIISSGWDEQNVLFGKNLEKEKNAFLEKLQ 655

Query: 659 NRHNKETVFEFARNHDDEMAILMKXXXXXXXXXXXXXKERQQLLEKERQAGLRHTLEDEI 718
           NR NKETVFEF RN +DEMA LM              KER++LLEKER AGL H LEDEI
Sbjct: 656 NRRNKETVFEFTRNPEDEMANLMHRRRRAIAPIQRKAKERKELLEKERMAGLTHALEDEI 715

Query: 719 LKGEENEVGYSVPQELLRDFEDADELAAK-----RNTKKGFRDENFYLSHFAPASDIQDK 773
           LKG++ EVGY+V ++ L+ FEDAD + A+     +  KK FRD NF+LSH+APA++IQDK
Sbjct: 716 LKGDDAEVGYTVTEDTLKAFEDADTILAEQENASKKKKKTFRDPNFFLSHYAPANEIQDK 775

Query: 774 QLQVASSFTNEVSKATFDLHNDDKVQVHKQTATVKWDKKRKKYVNVQGIDNKKYIIGESG 833
           QL+++  F NE +++ +DL++DDKVQVHKQTATVKWDKKRKKYVN+ GIDNKKYIIGESG
Sbjct: 776 QLELSGGFINEAAQSAYDLNSDDKVQVHKQTATVKWDKKRKKYVNMNGIDNKKYIIGESG 835

Query: 834 QKIPASFRSGKFDEWSKARKLAPLKVGARESSIPANLLADPT------GSRLANGKFKHK 887
           QKI ASFRSGKFDEWSKARKLAPLK GA ESSIP+NLL DPT      GS+L NGKFKHK
Sbjct: 836 QKIAASFRSGKFDEWSKARKLAPLKTGANESSIPSNLLVDPTRGPGKSGSKLPNGKFKHK 895

Query: 888 QIKAPKMPDKNRDDYQSQLKKVNKAMESGLHVKGY-NAPGMKQELRTTEQIRKQRSMAE 945
             KAP++PDK RDDY  Q KKV  A+E G+ VKGY NAP  K EL++  QIRK R   E
Sbjct: 896 LEKAPRLPDKKRDDYHKQKKKVESALERGIAVKGYNNAPAFKSELKSVAQIRKDRKTKE 954

>KNAG0K01110 Chr11 (215540..218545) [3006 bp, 1001 aa] {ON}
           Anc_3.159 YDL031W
          Length = 1001

 Score = 1191 bits (3082), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 599/960 (62%), Positives = 715/960 (74%), Gaps = 33/960 (3%)

Query: 15  SDEGED---FDIAGNIALXXXXXXXXXXXXXNEVQDIIEFSDDEKQNAPQVSXXXXXXXX 71
           S E ED    DIAG+IAL              ++ DII++SD+E   A            
Sbjct: 31  SAEEEDDALVDIAGDIALESSDEEEEEDVQ-GDIADIIDYSDEEPAEAKGKQQKQKQKPS 89

Query: 72  XXXXXPRSDAAFPSLELSXXXXXXXXXXXX---XXSYFNTTSQLXXXXXXXXXXXXXXLS 128
                   + AFPSLELS                 +YF+T +Q               LS
Sbjct: 90  KKSP---KENAFPSLELSDDESSKAAGDASDDDVNAYFSTNNQAEKQKFKKGSFASFGLS 146

Query: 129 KFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHSAK 188
           K IL N++RKGFRQPTPIQRKTIPLILQ RDIVGMARTGSGKTAAFVLP+IEKLK HS+K
Sbjct: 147 KAILSNVTRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKTHSSK 206

Query: 189 IGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIATP 248
           IG RA+ILSPSRELA+QTH VFK+F+KG++LRSVLLTGGD LE+QF MMMSNPDV+IATP
Sbjct: 207 IGVRAIILSPSRELALQTHNVFKDFSKGTHLRSVLLTGGDSLEEQFGMMMSNPDVVIATP 266

Query: 249 GRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSATLPSS 308
           GRFLHLKVEMNL L ++EY VFDEADRLFEMGFQEQLNELL +LP++RQTLLFSATLPSS
Sbjct: 267 GRFLHLKVEMNLVLKTVEYAVFDEADRLFEMGFQEQLNELLAALPSSRQTLLFSATLPSS 326

Query: 309 LVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVATEEQ 368
           LV+FAKAGLTNPVLVRLD E+K+SENL+MLFLS+KNDEREANLLYLLQ VIKIP+AT EQ
Sbjct: 327 LVEFAKAGLTNPVLVRLDAESKISENLQMLFLSIKNDEREANLLYLLQNVIKIPLATPEQ 386

Query: 369 LQRFRXXXXXXXXXXXXXXXXXXX----------XXXXXXQPLPSAKDMPSPNSTIIFVS 418
           L++ R                                   Q LP+A ++PS N+T++FV 
Sbjct: 387 LKKLRDSDAKFSESESEDESNEKRGGKRDFKKNGKKKFVKQRLPAANELPSENATVVFVP 446

Query: 419 TRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPL 478
           TRHHVEY+S +LKDCGYLVSY+YG+LDQ+AR+ QL+NFR GLT+ILVVTDVAARGVDIP+
Sbjct: 447 TRHHVEYISQVLKDCGYLVSYIYGSLDQNARKSQLYNFRLGLTSILVVTDVAARGVDIPM 506

Query: 479 LANVVNMSLPASSKIFVHRVGRTARAGNKGWAYTIXXXXXXXXXXXXXXXXGKKVLLTPM 538
           LANV+N SLP+SSKIF+HRVGRTARAGNKGWAYTI                 KKVLLTPM
Sbjct: 507 LANVINYSLPSSSKIFIHRVGRTARAGNKGWAYTIVSESELPYLLDLELFLSKKVLLTPM 566

Query: 539 YEATCDLLKKKWISEGNEGALFQPPKISYVNRLILGSAPRLDLEAMGDLFKNLVESNFEL 598
            EA   +LK+KWI +GN+   F+PP +SY +R++LGS PRLDLE+MGDLFKN++E+NF+L
Sbjct: 567 LEAKNAILKQKWIDQGNDEMSFKPPAVSYTDRIVLGSCPRLDLESMGDLFKNILENNFDL 626

Query: 599 QNLKAVSIKAEKLYLRTRQPASAESIKRAKEVIAAGWDEQNVRFGKNIEKEKLEFLAKLQ 658
             +KA S+KAEKLY RTR  AS ES+KR+KEVIA+GWDEQN+ FG N+EKEK+ FLAKLQ
Sbjct: 627 SLMKATSLKAEKLYFRTRTHASLESLKRSKEVIASGWDEQNIIFGSNVEKEKINFLAKLQ 686

Query: 659 NRHNKETVFEFARNHDDEMAILMKXXXXXXXXXXXXXKERQQLLEKERQAGLRHTLEDEI 718
           NR NKETVFEF+RN DDEM++ MK             KER++LLEKER++GL H++EDEI
Sbjct: 687 NRRNKETVFEFSRNPDDEMSVFMKRRRRQLAPVQKKAKERRELLEKERRSGLSHSIEDEI 746

Query: 719 LKGEEN---EVGYSVPQELLRDFEDADELAAKRNTK----KGFRDENFYLSHFAPASDIQ 771
                N   E GY+V +E L+ FEDADEL  K++ K    K ++D NF+LSH+APA+DIQ
Sbjct: 747 FNQNNNTEMETGYTVSEEALKQFEDADELLQKQSEKKTKPKNYKDPNFFLSHYAPAADIQ 806

Query: 772 DKQLQVASSFTNEVSKATFDLHNDDKVQVHKQTATVKWDKKRKKYVNVQGIDNKKYIIGE 831
           DKQLQV S FTN+ ++A +DL++DDKVQVHKQTATVKWDKKRKKYVN+QGIDNKKYIIGE
Sbjct: 807 DKQLQVTSGFTNDAAQAAYDLNDDDKVQVHKQTATVKWDKKRKKYVNMQGIDNKKYIIGE 866

Query: 832 SGQKIPASFRSGKFDEWSKARKLAPLKVGARESSIPANLLADPT------GSRLANGKFK 885
           SGQKI ASFRSGKFDEWSKAR + PLKVGA+E SI  +LL DPT      G+R A+GK+K
Sbjct: 867 SGQKIAASFRSGKFDEWSKARHIKPLKVGAKEDSIETHLLRDPTGRSNISGNRTASGKYK 926

Query: 886 HKQIKAPKMPDKNRDDYQSQLKKVNKAMESGLHVKGYNAPGMKQELRTTEQIRKQRSMAE 945
           HKQ KAPK+PDK+RD+Y SQ KK+  AME G +VKG+N PG + EL++T QIRK R  AE
Sbjct: 927 HKQDKAPKLPDKHRDNYHSQKKKIASAMERGTYVKGFNGPGTQSELKSTAQIRKGRLQAE 986

>Smik_4.204 Chr4 (374339..377335) [2997 bp, 998 aa] {ON} YDL031W
           (REAL)
          Length = 998

 Score = 1191 bits (3080), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 608/984 (61%), Positives = 721/984 (73%), Gaps = 40/984 (4%)

Query: 1   MGLASKRKRDTEEHSDEGED-----FDIAGNIALXXXXXXXXXXXXX-------NEVQDI 48
           M    KR+R+ E+    G +     FDIA +IAL                    ++VQDI
Sbjct: 1   MAGMQKRRRNLEDQDVIGSEEDDIAFDIANDIALNDSESDSNDSENEIEAGYGPSDVQDI 60

Query: 49  IEFSDDEKQNAPQVSXXXXXXXX---XXXXXPRSDAAFPSLELS------XXXXXXXXXX 99
           IE+S D+++   + +                 +  AAFP LELS                
Sbjct: 61  IEYSSDDEEEGKKSNKKKKTNDKKPGKNKHNKKEVAAFPILELSDDENNISGQTQAGEEE 120

Query: 100 XXXXSYFNTTSQLXXXXXXXXXXXXXXLSKFILGNISRKGFRQPTPIQRKTIPLILQQRD 159
                YF +T+ L              LSK +L NI RKGFRQPTPIQRKTIPLILQ RD
Sbjct: 121 DDVNEYF-STNNLEKQKHKKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRD 179

Query: 160 IVGMARTGSGKTAAFVLPLIEKLKMHSAKIGARAMILSPSRELAMQTHKVFKEFAKGSNL 219
           IVGMARTGSGKTAAF+LP++EKLK HS KIGARA+ILSPSRELAMQT  VFK+FA+G+ L
Sbjct: 180 IVGMARTGSGKTAAFILPMVEKLKSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTEL 239

Query: 220 RSVLLTGGDGLEDQFSMMMSNPDVIIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEM 279
           RSVLLTGGD LE+QFSMMMSNPDVIIATPGRFLHLKVEMNLDL S+EYVVFDEADRLFEM
Sbjct: 240 RSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEM 299

Query: 280 GFQEQLNELLGSLPTARQTLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLF 339
           GFQEQLNELL SLPT RQTLLFSATLP+SLVDF KAGL NPVLVRLD ETKVSENLEMLF
Sbjct: 300 GFQEQLNELLASLPTTRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLF 359

Query: 340 LSVKNDEREANLLYLLQEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXX--- 396
           LS KN +REANLLY+LQEVI+IP+AT EQL + +                          
Sbjct: 360 LSSKNADREANLLYILQEVIRIPLATSEQLLKLQKSTNEADSDSDDENDRQKKKINFKKE 419

Query: 397 --XXQPLPSAKDMPSPNSTIIFVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLH 454
               Q +P+A ++PS  +TI+FV TRHHVEY+S LL+DCGYL+SY+YGTLDQHAR+ QL+
Sbjct: 420 KFRKQKMPAANELPSEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLY 479

Query: 455 NFRCGLTNILVVTDVAARGVDIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWAYTIX 514
           NFR GLT+ILVVTDVAARGVDIP+LANV+N +LP SSKIFVHRVGRTARAGNKGWAY+I 
Sbjct: 480 NFRAGLTSILVVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIV 539

Query: 515 XXXXXXXXXXXXXXXGKKVLLTPMYEATCDLLKKKWISEGNEGALFQPPKISYVNRLILG 574
                          GKK+LLTPMY++  D++KK+W+ EGN    FQ PK+SY  RL+LG
Sbjct: 540 AENELPYLLDLELFLGKKILLTPMYDSLVDVMKKRWVEEGNSAYNFQLPKLSYTKRLVLG 599

Query: 575 SAPRLDLEAMGDLFKNLVESNFELQNLKAVSIKAEKLYLRTRQPASAESIKRAKEVIAAG 634
           S PRLD+E +GDL+KNL+ SNF+LQ  K  ++KAEKLY RTR  AS ES+KR+KE+IA+G
Sbjct: 600 SCPRLDVEGLGDLYKNLMTSNFDLQLAKKTAMKAEKLYYRTRTSASPESLKRSKEIIASG 659

Query: 635 WDEQNVRFGKNIEKEKLEFLAKLQNRHNKETVFEFARNHDDEMAILMKXXXXXXXXXXXX 694
           WD QN  FGKN EKEKL+FLAKLQNR NKETVFEF RN DDEMA+ MK            
Sbjct: 660 WDAQNAYFGKNEEKEKLDFLAKLQNRRNKETVFEFTRNPDDEMAVFMKRRRKQLAPIQRK 719

Query: 695 XKERQQLLEKERQAGLRHTLEDEILKGEENEVGYSVPQELLRDFEDADE-LAAKRN---- 749
             ER++LLEKER AGL H++EDEILKG++ E GY+V ++ L++FEDAD+ L A+ N    
Sbjct: 720 ATERRELLEKERMAGLSHSIEDEILKGDDGETGYTVSEDALKNFEDADQLLEAQENESKK 779

Query: 750 --TKKGFRDENFYLSHFAPASDIQDKQLQVASSFTNEVSKATFDLHNDDKVQVHKQTATV 807
               K F+D  F+LSH+APA +IQDKQLQ+ + F N+ ++A +DL++DDKVQVHKQTATV
Sbjct: 780 KKKPKTFKDPTFFLSHYAPAGEIQDKQLQITNGFANDAAQAAYDLNSDDKVQVHKQTATV 839

Query: 808 KWDKKRKKYVNVQGIDNKKYIIGESGQKIPASFRSGKFDEWSKARKLAPLKVGARESSIP 867
           KWDKKRKKYVN QGIDNKKYIIGESGQKI ASFRSG+FD+WSKAR L PLKVG+RESSIP
Sbjct: 840 KWDKKRKKYVNTQGIDNKKYIIGESGQKIAASFRSGRFDDWSKARNLKPLKVGSRESSIP 899

Query: 868 ANLLADP---TGS--RLANGKFKHKQIKAPKMPDKNRDDYQSQLKKVNKAMESGLHVKGY 922
           +NLL DP   TGS  R   GKFKHKQ+KAPKMPDK+RD+Y SQ KKV+KA++SG+ VKGY
Sbjct: 900 SNLLQDPSQGTGSNGRTVRGKFKHKQMKAPKMPDKHRDNYYSQKKKVDKALQSGISVKGY 959

Query: 923 -NAPGMKQELRTTEQIRKQRSMAE 945
            NAPG++ EL++TEQIRK R+MAE
Sbjct: 960 NNAPGLRNELKSTEQIRKDRNMAE 983

>NDAI0G02870 Chr7 (664526..667501) [2976 bp, 991 aa] {ON} 
          Length = 991

 Score = 1186 bits (3068), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 601/982 (61%), Positives = 724/982 (73%), Gaps = 43/982 (4%)

Query: 1   MGLASKRKRDTEEHSDEGE----DFDIAGNIALXXXXXXXXXXXXXNE-VQDIIEFSDDE 55
           M L  KR RDT   S + E    DFDIA +IAL             NE VQD+I++SD E
Sbjct: 1   MALKEKRTRDTAVDSSDSENDAADFDIATDIALNASDSDDASSDSDNEDVQDVIDYSDSE 60

Query: 56  KQNAPQVSXXXXXXXXXXXXXPRSDAAFPSLELSXXXXXXXXXXXXXX-----------S 104
            Q                      D +FP LELS                         +
Sbjct: 61  HQQEDNKIARKEKQKKQDI-----DKSFPILELSDDEDTKKKSNSKNNGSDNDDDDDINA 115

Query: 105 YFNTTSQLXXXXXXXXXXXXXXLSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMA 164
           YF+TT+ L              LSK I+ NI+++GFRQPTPIQRKTIPLILQ RDIVGMA
Sbjct: 116 YFSTTN-LEKSKHKKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMA 174

Query: 165 RTGSGKTAAFVLPLIEKLKMHSAKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLL 224
           RTGSGKTAAF+LP+I K+K HS+KIGARA+ILSPSRELAMQTH VFKEF+KG+ LRSVLL
Sbjct: 175 RTGSGKTAAFILPMIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLL 234

Query: 225 TGGDGLEDQFSMMMSNPDVIIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQ 284
           TGGD LEDQF MMM+NPDVIIATPGRFLHLKVEM+LDL SIEY VFDEADRLFEMGFQ+Q
Sbjct: 235 TGGDSLEDQFGMMMNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQ 294

Query: 285 LNELLGSLPTARQTLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKN 344
           LNELL SLP+ RQTLLFSATLPSSLVDFAKAGLTNPVLVRLD E+K+SENLEMLFLS KN
Sbjct: 295 LNELLASLPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKN 354

Query: 345 DEREANLLYLLQEVIKIPVATEEQLQRF-----RXXXXXXXXXXXXXXXXXXXXXXXXXQ 399
           DEREANLLYLLQ+VIKIP+AT+EQ ++F     +                         +
Sbjct: 355 DEREANLLYLLQDVIKIPLATKEQQRKFNDQNKKDNESDSDADDNNNNNKNKKKRKFKKE 414

Query: 400 PLPSAKDMPSPNSTIIFVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCG 459
            LP A  +PS  +TI+FV TRHHVEY+S LLKD GYL+SY+YGTLDQHAR++QL+NFR G
Sbjct: 415 RLPPANQLPSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTG 474

Query: 460 LTNILVVTDVAARGVDIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWAYTIXXXXXX 519
           LT+ILVVTDVAARGVDIP+LANV+N SLPASSKIF+HRVGRTARAGN+GWAY+I      
Sbjct: 475 LTSILVVTDVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVSESEL 534

Query: 520 XXXXXXXXXXGKKVLLTPMYEATCDLLKKKWISEGNEGALFQPPKISYVNRLILGSAPRL 579
                     GKK++LTPMY++ C+++K KWI+EGN+ + F  PKI+Y +RLILGSAPRL
Sbjct: 535 PYLLDLELFLGKKIMLTPMYDSLCEIMKNKWIAEGNDESSFVNPKIAYTDRLILGSAPRL 594

Query: 580 DLEAMGDLFKNLVESNFELQNLKAVSIKAEKLYLRTRQPASAESIKRAKEVIAAGWDEQN 639
           ++E +GDL+KN++++NFEL+ +K V++KAEKLY RTR  AS ES+KR+KE+IA+GWDEQN
Sbjct: 595 EVEGLGDLYKNMMQNNFELKLIKDVAMKAEKLYFRTRTSASPESLKRSKEIIASGWDEQN 654

Query: 640 VRFGKNIEKEKLEFLAKLQNRHNKETVFEFARNHDDEMAILMKXXXXXXXXXXXXXKERQ 699
           V FGKN EKEKL+FLAKLQNR NKETVFEF+RN DDEM++ MK             +ER+
Sbjct: 655 VLFGKNQEKEKLDFLAKLQNRRNKETVFEFSRNPDDEMSVFMKRRRRQLAPIQRKARERK 714

Query: 700 QLLEKERQAGLRHTLEDEILKGEENEVGYSVPQELLR-DFEDADELAAKRNTKKGFRDE- 757
           +LL+ E+ AGL H++EDEILKG++NE GYSV ++ L+  F+DADEL A +  K     + 
Sbjct: 715 ELLQMEKMAGLTHSVEDEILKGDDNEAGYSVSEDTLKQQFQDADELLADQENKSKKDKKS 774

Query: 758 -------NFYLSHFAPASDIQDKQLQVASSFTNEVSKATFDLHNDDKVQVHKQTATVKWD 810
                  NF+LSH+APA DIQDKQL++ + F N+ +K  +DL+NDDKVQVHKQTA VKWD
Sbjct: 775 KKSFKDPNFFLSHYAPAGDIQDKQLELTTGFVNDAAKVAYDLNNDDKVQVHKQTAMVKWD 834

Query: 811 KKRKKYVNVQGIDNKKYIIGESGQKIPASFRSGKFDEWSKARKLAPLKVGARESSIPANL 870
           KKRKKYVN QG+DNKKYIIGE GQKI ASFRSGKFDEW+K RK+ PLKVGARE++IP+N+
Sbjct: 835 KKRKKYVNTQGLDNKKYIIGEGGQKIAASFRSGKFDEWAKKRKMKPLKVGARETTIPSNI 894

Query: 871 LADPT----GSR--LANGKFKHKQIKAPKMPDKNRDDYQSQLKKVNKAMESGLHVKGY-N 923
           LA+PT    GS+     GKFKHKQ+KAPKMPDK+RDDY  Q KKV KA+ +G+ V+GY N
Sbjct: 895 LANPTNGSHGSQGNTIRGKFKHKQMKAPKMPDKHRDDYHIQKKKVEKALANGIQVRGYGN 954

Query: 924 APGMKQELRTTEQIRKQRSMAE 945
           APGM  EL++TEQI K R++ E
Sbjct: 955 APGMSNELKSTEQIMKDRNVKE 976

>Kpol_1032.11 s1032 complement(27093..30026) [2934 bp, 977 aa] {ON}
           complement(27093..30026) [2934 nt, 978 aa]
          Length = 977

 Score = 1182 bits (3057), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 594/973 (61%), Positives = 720/973 (73%), Gaps = 39/973 (4%)

Query: 1   MGLASKRKRDTEEHSDEGE---DFDIAGNIALXXXXXXXXXXXXXNE---VQDIIEFSDD 54
           MG+ SKRKR  E+ +   +    FDI  NI L             ++   VQDI++FSD+
Sbjct: 1   MGIISKRKRHVEDSNSSSDDDDGFDITSNIGLNTADSSDESESSGDDEEEVQDIVDFSDE 60

Query: 55  E-KQNAPQVSXXXXXXXXXXXXXPRSDAAFPSLELSXXXXXXXX-----XXXXXXSYFNT 108
           E  +  P+ S                + +FPSLE+S                    YF+ 
Sbjct: 61  EDTKKKPKSSNKTLT----------DNNSFPSLEISDDEDSNNKGDHEDDDDDLNDYFSI 110

Query: 109 TSQLXXXXXXXXXXXXXXLSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGS 168
            +                 SK IL N+ +KGFRQPTPIQRKTIPLILQ+RDIVGMARTGS
Sbjct: 111 NNS-EKSKHKKGSFPSFGFSKLILSNVHKKGFRQPTPIQRKTIPLILQKRDIVGMARTGS 169

Query: 169 GKTAAFVLPLIEKLKMHSAKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGD 228
           GKTAAFVLP+IEKLK HS+KIGARA+ILSPSRELA+QTH+VFKEF+KG++LRSVLLTGGD
Sbjct: 170 GKTAAFVLPMIEKLKSHSSKIGARAVILSPSRELALQTHRVFKEFSKGTHLRSVLLTGGD 229

Query: 229 GLEDQFSMMMSNPDVIIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNEL 288
            LEDQFSMMMSNPDVI+ATPGRFLHLKVEM+LDL ++EYVVFDEADRLFEMGFQEQLNEL
Sbjct: 230 SLEDQFSMMMSNPDVIVATPGRFLHLKVEMSLDLKTVEYVVFDEADRLFEMGFQEQLNEL 289

Query: 289 LGSLPTARQTLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDERE 348
           L +LP  RQTLLFSATLPSSLVDFAKAGLTNPVLVRLD ETK+SENLE+LFLS KN+ERE
Sbjct: 290 LAALPMNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEILFLSTKNEERE 349

Query: 349 ANLLYLLQEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQP-------L 401
            NLLYLLQ+VIKIP+ T++Q+++                           +        +
Sbjct: 350 NNLLYLLQDVIKIPLGTDDQIKKLSDFNKSLSDSDSEDEDNKGKQNSRKSKKGKFQKLKV 409

Query: 402 PSAKDMPSPNSTIIFVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLT 461
            ++ ++P+  STI+F  TRHHVEY++ LLKD G+LVSYLYGTLDQHAR++QL NFR GLT
Sbjct: 410 SASNELPTEKSTIVFAPTRHHVEYITQLLKDSGFLVSYLYGTLDQHARKRQLLNFRAGLT 469

Query: 462 NILVVTDVAARGVDIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWAYTIXXXXXXXX 521
           +ILVVTDVAARGVDIP+LANV+N SLPASSKIF+HRVGRTARAGN+GWAY+I        
Sbjct: 470 SILVVTDVAARGVDIPMLANVINYSLPASSKIFIHRVGRTARAGNRGWAYSIVSETELPY 529

Query: 522 XXXXXXXXGKKVLLTPMYEATCDLLKKKWISEGNEGALFQPPKISYVNRLILGSAPRLDL 581
                   GKK+LLT MYEA+C L+K KWI++GN  + F+ PKISY NRL+LGSAPR D+
Sbjct: 530 MLDLELFLGKKILLTSMYEASCKLMKSKWIADGNTESSFEDPKISYTNRLVLGSAPRYDI 589

Query: 582 EAMGDLFKNLVESNFELQNLKAVSIKAEKLYLRTRQPASAESIKRAKEVIAAGWDEQNVR 641
           E++GDL+KN++ESNF+LQ  K VS+KAEKLY RTR  AS ESIKR+KEVIA+GWDEQN+R
Sbjct: 590 ESVGDLYKNIIESNFDLQMAKKVSLKAEKLYCRTRTAASPESIKRSKEVIASGWDEQNIR 649

Query: 642 FGKNIEKEKLEFLAKLQNRHNKETVFEFARNHDDEMAILMKXXXXXXXXXXXXXKERQQL 701
           FG+N+EKEKL FLAK QNR NKETVFEF +N +D+ AILM+             ++RQ+L
Sbjct: 650 FGRNLEKEKLNFLAKFQNRRNKETVFEFGKNPNDDTAILMQKRRKQIAPIQRKARKRQEL 709

Query: 702 LEKERQAGLRHTLEDEILKGEENEVGYSVPQELLRDFEDADEL-----AAKRNTKKGFRD 756
           L+KER AGL H +EDEILKGE++E GYSVP+E L+ FEDAD++     ++++   K FRD
Sbjct: 710 LDKERVAGLTHKIEDEILKGEDHEAGYSVPEEALKSFEDADKILEEQESSRKKKSKTFRD 769

Query: 757 ENFYLSHFAPASDIQDKQLQVASSFTNEVSKATFDLHNDDKVQVHKQTATVKWDKKRKKY 816
            NF++SH+APA DIQDKQLQ+ S FTN+ ++A +DL++DDKVQVHKQTATVKWDKKRKKY
Sbjct: 770 PNFFISHYAPAGDIQDKQLQITSGFTNDAAQAAYDLNDDDKVQVHKQTATVKWDKKRKKY 829

Query: 817 VNVQGIDNKKYIIGESGQKIPASFRSGKFDEWSKARKLAPLKVGARESSIPANLLADPT- 875
           VN+QGIDNKKYIIGESGQKIPASF+SGKF EWSK+R +  +K GARE+SIP NLL+DPT 
Sbjct: 830 VNMQGIDNKKYIIGESGQKIPASFKSGKFAEWSKSRNIKGIKTGARETSIPTNLLSDPTT 889

Query: 876 --GS-RLANGKFKHKQIKAPKMPDKNRDDYQSQLKKVNKAMESGLHVKGYNAPGMKQELR 932
             GS R   G+FKHKQ KAP++PDK RDDYQSQ KKV  A+E G+ VKG+       EL+
Sbjct: 890 DSGSQRGPGGRFKHKQNKAPRLPDKFRDDYQSQKKKVQSAIERGVSVKGFGGSSGNTELK 949

Query: 933 TTEQIRKQRSMAE 945
           TT QIRK+R   E
Sbjct: 950 TTAQIRKERMAKE 962

>Suva_4.218 Chr4 (384623..387646) [3024 bp, 1007 aa] {ON} YDL031W
           (REAL)
          Length = 1007

 Score = 1175 bits (3040), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 602/993 (60%), Positives = 717/993 (72%), Gaps = 49/993 (4%)

Query: 1   MGLASKRKRDTEEHSDEGED-----FDIAGNIALXXXXXXXXXXXXX-------NEVQDI 48
           M    KRKRD  +    G +     FDIA +IAL                    + VQD+
Sbjct: 1   MAGVQKRKRDLGDQDGSGSEEEDAAFDIANDIALNASESDSDDSGSEEEADYGLSGVQDV 60

Query: 49  IEFSDDE------------KQNAPQVSXXXXXXXXXXXXXPRSDAAFPSLELSXXXXXXX 96
           IE+S DE            K                     +  AAFP+LELS       
Sbjct: 61  IEYSSDEEEKGKNKKKTDAKNTKKNKEDNKTKTKTKTKNGKKEAAAFPTLELSDDENSVP 120

Query: 97  XXXXX------XXSYFNTTSQLXXXXXXXXXXXXXXLSKFILGNISRKGFRQPTPIQRKT 150
                         YF+TT+ L              LSK +L NI RKGFRQPTPIQRKT
Sbjct: 121 GKNQADDDEDDVNEYFSTTN-LEKTKHKKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKT 179

Query: 151 IPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHSAKIGARAMILSPSRELAMQTHKVF 210
           IPLILQ RDIVGMARTGSGKTAAF+LP++EKLK HS KIGARA+ILSPSRELAMQT  VF
Sbjct: 180 IPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIGARAVILSPSRELAMQTFNVF 239

Query: 211 KEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIATPGRFLHLKVEMNLDLHSIEYVVF 270
           KEFA+G+ LRSVLLTGGD LE+QFSMMMSNPDVIIATPGRFLHLKVEMNLDL S+EYVVF
Sbjct: 240 KEFARGTALRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVF 299

Query: 271 DEADRLFEMGFQEQLNELLGSLPTARQTLLFSATLPSSLVDFAKAGLTNPVLVRLDTETK 330
           DEADRLFEMGFQEQLNELL SLPTARQTLLFSATLP+SLVDF KAGL NPVLVRLDTETK
Sbjct: 300 DEADRLFEMGFQEQLNELLASLPTARQTLLFSATLPNSLVDFVKAGLVNPVLVRLDTETK 359

Query: 331 VSENLEMLFLSVKNDEREANLLYLLQEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXX 390
           VSENLEMLF+S KND+REANLLY+LQEVIKIP+AT EQLQ+ +                 
Sbjct: 360 VSENLEMLFVSTKNDDREANLLYILQEVIKIPLATSEQLQKLQKSNNEADSESDDDNDRQ 419

Query: 391 XXXXXX-----XXQPLPSAKDMPSPNSTIIFVSTRHHVEYVSNLLKDCGYLVSYLYGTLD 445
                        Q +P   ++PS  +TI+FV TRHHVEY+S LL+DCG+L+SY+YGTLD
Sbjct: 420 KKRKNFKKEKFRKQRMPGGNELPSEKATILFVPTRHHVEYISQLLRDCGFLISYIYGTLD 479

Query: 446 QHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSLPASSKIFVHRVGRTARAG 505
           QHAR++QL+NFR GLT+ILVVTDVAARGVDIP+LANV+N +LP SSKIFVHRVGRTARAG
Sbjct: 480 QHARKRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAG 539

Query: 506 NKGWAYTIXXXXXXXXXXXXXXXXGKKVLLTPMYEATCDLLKKKWISEGNEGALFQPPKI 565
           NKGWAY+I                GKK+LL PMY++   L+KK+W+ EG     FQPP +
Sbjct: 540 NKGWAYSIVAENELPYLLDLELFLGKKILLAPMYDSLAGLMKKRWVDEGKPEYTFQPPTL 599

Query: 566 SYVNRLILGSAPRLDLEAMGDLFKNLVESNFELQNLKAVSIKAEKLYLRTRQPASAESIK 625
           SY  RL+LGS PRLD+E +GDL+KNL+ SNF+LQ  K  ++KAE+LY RTR  AS ES+K
Sbjct: 600 SYTKRLVLGSCPRLDVEGLGDLYKNLMTSNFDLQLAKKTALKAEQLYYRTRTAASPESLK 659

Query: 626 RAKEVIAAGWDEQNVRFGKNIEKEKLEFLAKLQNRHNKETVFEFARNHDDEMAILMKXXX 685
           R+KE+IA+GWD QN  FGKN EKEKL+FLAKLQNR NKETVFEF RN DDEM++LMK   
Sbjct: 660 RSKEIIASGWDAQNAYFGKNEEKEKLDFLAKLQNRRNKETVFEFTRNPDDEMSVLMKRRR 719

Query: 686 XXXXXXXXXXKERQQLLEKERQAGLRHTLEDEILKGEENEVGYSVPQELLRDFEDADE-L 744
                     +ER++LLEKER AGL H++EDEILKG + E GY++ ++ L++FEDAD+ L
Sbjct: 720 KQLAPIQRKSRERRELLEKERMAGLSHSIEDEILKGNDGETGYTISEDALKEFEDADQLL 779

Query: 745 AAKRN------TKKGFRDENFYLSHFAPASDIQDKQLQVASSFTNEVSKATFDLHNDDKV 798
            A+ N        K F+D +F+LSH+APA +IQDKQL++   F N+ + A +DL+ DDKV
Sbjct: 780 EAQENDSKKKKKPKTFKDPSFFLSHYAPAGEIQDKQLEITGGFANDAAHAAYDLNGDDKV 839

Query: 799 QVHKQTATVKWDKKRKKYVNVQGIDNKKYIIGESGQKIPASFRSGKFDEWSKARKLAPLK 858
           QVHKQTATVKWDKKRKKYVN QG+DNKKYIIGESGQKI ASFRSG+FD+WSKAR L PLK
Sbjct: 840 QVHKQTATVKWDKKRKKYVNTQGLDNKKYIIGESGQKIAASFRSGRFDDWSKARNLKPLK 899

Query: 859 VGARESSIPANLLADPT---GSR--LANGKFKHKQIKAPKMPDKNRDDYQSQLKKVNKAM 913
           VG+RESSIP+NLLADP+   G+R     GKFKHKQ+KAPKMPDK+RD+Y +Q KKV KA+
Sbjct: 900 VGSRESSIPSNLLADPSQGPGARGGAVRGKFKHKQMKAPKMPDKHRDNYYTQKKKVEKAL 959

Query: 914 ESGLHVKGY-NAPGMKQELRTTEQIRKQRSMAE 945
           +SG++V+GY NAPG++ EL++T+QIRK R+ A+
Sbjct: 960 QSGVNVRGYNNAPGLRSELKSTDQIRKDRAAAD 992

>ZYRO0B04972g Chr2 complement(401735..404674) [2940 bp, 979 aa] {ON}
           similar to uniprot|Q12389 Saccharomyces cerevisiae
           YDL031W DBP10 Essential protein involved in ribosome
           biogenesis putative ATP-dependent RNA helicase of the
           DEAD- box protein family
          Length = 979

 Score = 1146 bits (2964), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 579/948 (61%), Positives = 699/948 (73%), Gaps = 34/948 (3%)

Query: 21  FDIAGNIALXXXXXXXXXXXXXNE---VQDIIEFSDDEKQNAPQVSXXXXXXXXXXXXXP 77
           FDIAGNIAL             +     QD+I++SDD+K+                    
Sbjct: 22  FDIAGNIALTSSESEGEDGSDEDSEENYQDVIDYSDDDKEKEAGKKKKEPVKKSDKHD-- 79

Query: 78  RSDAAFPSLELSXXXXXXXXXXXXXX------SYFNTTSQLXXXXXXXXXXXXXXLSKFI 131
                FP LELS                    S + TT+                 SKFI
Sbjct: 80  -----FPILELSDNEEDADAKKKKEDGDADDISEYFTTNNSESKKHKKGSFPSFGFSKFI 134

Query: 132 LGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHSAKIGA 191
           L NI++KGFRQPTPIQRKTIPLILQ RDIVGMARTGSGKTAAFVLP+IEKLK HS+KIGA
Sbjct: 135 LNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIGA 194

Query: 192 RAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIATPGRF 251
           RA+ILSPSRE+AMQT+KVFKEF+KGS+LRSVLLTGGD LEDQF MMMSNPDV++ATPGRF
Sbjct: 195 RAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRF 254

Query: 252 LHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSATLPSSLVD 311
           LHLKVEMNL+L S+EY VFDEADRLFEMGF EQLNELL SLP  RQTLLFSATLP++LVD
Sbjct: 255 LHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTLVD 314

Query: 312 FAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVATEEQL-- 369
           FAKAGLTNPVLVRLD E+K+SENLEMLF+S K+DEREANL YLLQEVIKIP+ATEEQ   
Sbjct: 315 FAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQKMI 374

Query: 370 -----QRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVE 424
                +                              LPSA ++PS  +TI+FV TRHHVE
Sbjct: 375 LGEGNKALSDSEDSDAENGKKDRRKKGKKNKAKRPKLPSANELPSEKATIVFVPTRHHVE 434

Query: 425 YVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVN 484
           Y+S LLK CGYLVSY+YGTLDQHARR+QL+NFR GLT+ILVVTDVAARGVDIP+LANV+N
Sbjct: 435 YISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANVIN 494

Query: 485 MSLPASSKIFVHRVGRTARAGNKGWAYTIXXXXXXXXXXXXXXXXGKKVLLTPMYEATCD 544
            ++P+SSKIFVHRVGRTARAGN+GWAY+I                GKK+LL PMYEATC+
Sbjct: 495 FTMPSSSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLDLELFLGKKILLAPMYEATCN 554

Query: 545 LLKKKWISEGNEGALFQPPKISYVNRLILGSAPRLDLEAMGDLFKNLVESNFELQNLKAV 604
           LLK+KW++EGN+   FQPPK+SY +R++LGS PR++LE+MGDL+KNL++SN++L + + V
Sbjct: 555 LLKEKWVNEGNDEFRFQPPKVSYTDRMVLGSCPRIELESMGDLYKNLMDSNYDLGSTRGV 614

Query: 605 SIKAEKLYLRTRQPASAESIKRAKEVIAAGWDEQNVRFGKNIEKEKLEFLAKLQNRHNKE 664
           SIKAE +Y+RTRQPASAES+KRAK++I +GWDEQN+ FGKN+E EK +FLAKLQ+R NKE
Sbjct: 615 SIKAEIMYMRTRQPASAESMKRAKQMIISGWDEQNILFGKNMEAEKNKFLAKLQDRRNKE 674

Query: 665 TVFEFARNHDDEMAILMKXXXXXXXXXXXXXKERQQLLEKERQAGLRHTLEDEILKGEEN 724
           TVFEFARN DD+M++LMK             K+RQ+L+EKE+ AGL H+LEDE+L   + 
Sbjct: 675 TVFEFARNPDDKMSVLMKKRRQQLEPVQLRAKQRQELMEKEKLAGLTHSLEDEVLDKYKG 734

Query: 725 EVGYSVPQELLRDFEDADELAAKRNTK--------KGFRDENFYLSHFAPASDIQDKQLQ 776
           EVGYSVP  +L +FEDAD++   + T+        K F+D NF++SH+APA  +QD QL 
Sbjct: 735 EVGYSVPDAVLEEFEDADQVLEDQETEGKKQKQKSKSFKDSNFFMSHYAPAQSVQDSQLN 794

Query: 777 VASSFTNEVSKATFDLHNDDKVQVHKQTATVKWDKKRKKYVNVQGIDNKKYIIGESGQKI 836
           ++S FT + ++A++DL++DDK+QVHKQTATVKWDKK+KKYVN QG DN +YI  ESGQKI
Sbjct: 795 ISSGFTTDAAQASYDLNDDDKIQVHKQTATVKWDKKKKKYVNPQGADNVRYITSESGQKI 854

Query: 837 PASFRSGKFDEWSKARKLAPLKVGARESSIPANLLADPTGSRLA--NGKFKHKQIKAPKM 894
           PAS+RSGKFDEWSK RKL   KVG+RESS+  NLL DPT    +  N +F HKQ+KAPK+
Sbjct: 855 PASYRSGKFDEWSKKRKLKMPKVGSRESSMATNLLQDPTRGNPSSNNRRFMHKQVKAPKV 914

Query: 895 PDKNRDDYQSQLKKVNKAMESGLHVKGY-NAPGMKQELRTTEQIRKQR 941
           PDK RDDY  Q  KV KA+E G+HVKG+ NAPGM  ELR+ +QIRKQR
Sbjct: 915 PDKYRDDYGKQKTKVAKALEKGIHVKGHNNAPGMTNELRSADQIRKQR 962

>TPHA0M00330 Chr13 complement(61976..64921) [2946 bp, 981 aa] {ON} 
          Length = 981

 Score = 1136 bits (2938), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 556/836 (66%), Positives = 653/836 (78%), Gaps = 17/836 (2%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHS 186
           LSK IL NI++KGFRQPTPIQRKTIPLILQ+RDIVGMARTGSGKTAAF+LP+IEKLK HS
Sbjct: 131 LSKLILSNINKKGFRQPTPIQRKTIPLILQRRDIVGMARTGSGKTAAFILPMIEKLKTHS 190

Query: 187 AKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIA 246
            KIGARA+ILSPSRELAMQTHKVFK+F++GS LRSVLLTGGD LE+QFSMMMSNPDVI+A
Sbjct: 191 GKIGARAVILSPSRELAMQTHKVFKDFSRGSQLRSVLLTGGDSLEEQFSMMMSNPDVIVA 250

Query: 247 TPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSATLP 306
           TPGRF+HLKVEM LDL ++EYVVFDEADRLFEMGFQEQLNELL SLP  RQTLLFSATLP
Sbjct: 251 TPGRFMHLKVEMGLDLKTVEYVVFDEADRLFEMGFQEQLNELLASLPMNRQTLLFSATLP 310

Query: 307 SSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVATE 366
           +SLVDFAKAGLTNPVLVRLD E+K+SENL++ F S KN+EREA LLY+LQ+VI + + TE
Sbjct: 311 NSLVDFAKAGLTNPVLVRLDAESKISENLQLAFFSTKNEEREATLLYILQDVIDLQIGTE 370

Query: 367 EQLQRFRXXXXXXXXXXXXXXXXXX--------XXXXXXXQPLPSAKDMPSPNSTIIFVS 418
           E++++                                     LPSA ++PS  +TI+FV 
Sbjct: 371 EEIKKLTASNKRSDEIDSDNEREQADRKLNKKKKFEKFIKPKLPSANELPSEKATIVFVP 430

Query: 419 TRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPL 478
           TRHHVEY+SNLLKDCGYLVSYLYGTLDQHAR+ QL NFR GLT+ILVVTDVAARGVDIP+
Sbjct: 431 TRHHVEYISNLLKDCGYLVSYLYGTLDQHARKHQLFNFRAGLTSILVVTDVAARGVDIPM 490

Query: 479 LANVVNMSLPASSKIFVHRVGRTARAGNKGWAYTIXXXXXXXXXXXXXXXXGKKVLLTPM 538
           LANV+N SLPASSKIFVHRVGRTARAGNKGWAY+I                GKK+LLT M
Sbjct: 491 LANVINYSLPASSKIFVHRVGRTARAGNKGWAYSIASETELPYLLDLELFLGKKILLTQM 550

Query: 539 YEATCDLLKKKWISEGNEGALFQPPKISYVNRLILGSAPRLDLEAMGDLFKNLVESNFEL 598
           YEATC L K KWI+ GNE   FQPPK SY +R+ILGS PRL+LE +GDL+KN++ ++F+L
Sbjct: 551 YEATCSLAKNKWIAAGNEEYTFQPPKPSYTDRMILGSCPRLELENIGDLYKNIMSASFDL 610

Query: 599 QNLKAVSIKAEKLYLRTRQPASAESIKRAKEVIAAGWDEQNVRFGKNIEKEKLEFLAKLQ 658
           Q  K  S+KAEKLY RTR  AS ESIKR KE+IA+GWDEQ++ FGKN+EKEKL+FL+K Q
Sbjct: 611 QMAKKTSLKAEKLYFRTRTAASPESIKRGKELIASGWDEQHIMFGKNVEKEKLDFLSKFQ 670

Query: 659 NRHNKETVFEFARNHDDEMAILMKXXXXXXXXXXXXXKERQQLLEKERQAGLRHTLEDEI 718
           NR+NKETVFEF RN  D  A+LM               ER++LLEKER AGL H LEDEI
Sbjct: 671 NRNNKETVFEFGRNPTDATAVLMNRRRRQLAPIQRKAVERRKLLEKERLAGLSHALEDEI 730

Query: 719 LKGEENEVGYSVPQELLRDFEDADELAAKRN----TKKGFRDENFYLSHFAPASDIQDKQ 774
           LKGE++E GY++ +E L  FEDAD+L  ++       K ++D  F+LSH+APA DIQDKQ
Sbjct: 731 LKGEDHESGYTISKEALAAFEDADKLLQEQEKKKRKPKTYKDPQFFLSHYAPAKDIQDKQ 790

Query: 775 LQVASSFTNEVSKATFDLHNDDKVQVHKQTATVKWDKKRKKYVNVQGIDNKKYIIGESGQ 834
           L + S FTN+ ++A +DL+NDDKVQVHKQTA +KWDK RKKYVN+ G+DNKKYIIGE GQ
Sbjct: 791 LNLTSGFTNDAAQAAYDLNNDDKVQVHKQTANIKWDKGRKKYVNINGLDNKKYIIGEGGQ 850

Query: 835 KIPASFRSGKFDEWSKARKLAPLKVGARESSIPANLLADPT----GSRLANGKFKHKQIK 890
           KIPASF+SG+FDEWSKAR + PLK G RE SIP NLLAD T    GSR   G+FKHKQ K
Sbjct: 851 KIPASFKSGRFDEWSKARHIKPLKAGVREDSIPTNLLADVTGPSDGSRTFGGRFKHKQNK 910

Query: 891 APKMPDKNRDDYQSQLKKVNKAMESGLHVKGYNA-PGMKQELRTTEQIRKQRSMAE 945
           AP++PDK+RDDY+SQ KKV  A+E G+ VKGYN    +K EL+T  QIRK+R + E
Sbjct: 911 APRLPDKHRDDYESQKKKVQNALERGVQVKGYNNRNSVKSELKTVAQIRKERMVNE 966

>TDEL0D04630 Chr4 complement(849268..852174) [2907 bp, 968 aa] {ON}
           Anc_3.159 YDL031W
          Length = 968

 Score = 1118 bits (2891), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 573/969 (59%), Positives = 703/969 (72%), Gaps = 40/969 (4%)

Query: 1   MGLASKRKRDTEEHSDEG------EDFDIAGNIALXXXXXXXXXXXXXNE--VQDIIEFS 52
           M ++ KRK   +    +G      ED+DI  +IAL             +E   QDIIE+S
Sbjct: 1   MKVSGKRKLGDDASLSDGSESGSEEDYDIVNDIALNSSDSDEDDSSEDSEGGEQDIIEYS 60

Query: 53  DDEKQNAPQVSXXXXXXXXXXXXXPRSDAAFPSLELSXXXXXXXXXXXXXXSYFNTTSQL 112
           D+E+++  +               P+ D +FP LE S               YF+TT+Q 
Sbjct: 61  DEEEEHQHEKKKSA----------PK-DKSFPKLEASGDEAEDDADDVN--EYFSTTAQ- 106

Query: 113 XXXXXXXXXXXXXXLSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTA 172
                         LSK IL NISRKGF QPTPIQRKTIPLILQ RDIVG+ARTGSGKTA
Sbjct: 107 TNKKHKKGSFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTA 166

Query: 173 AFVLPLIEKLKMHSAKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLED 232
           AF+LP+IEKLK HS+K+GARA+ILSPSRELAMQTHKVFK+F++G++LRSVLLTGGD LE+
Sbjct: 167 AFILPMIEKLKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEE 226

Query: 233 QFSMMMSNPDVIIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSL 292
           QF MMMSNPDVI+ATPGRFLHLKVEMNLDL SIEY VFDE+DRLFEMGF+EQLNELL +L
Sbjct: 227 QFGMMMSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAAL 286

Query: 293 PTARQTLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLL 352
           P+ RQTLLFSATLP+SLVDFAKAGLTNPVLVRLD E+K+SENLEMLFLS K+DEREA LL
Sbjct: 287 PSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAALL 346

Query: 353 YLLQEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQP----LPSAKDMP 408
           YL+QEVI+IP+ATEEQ++  +                         +     +P+A  +P
Sbjct: 347 YLIQEVIQIPLATEEQIKLIKDKSPDSDEESDDDNGKRSHNKHKKEKFKKVRMPAANQLP 406

Query: 409 SPNSTIIFVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTD 468
           S  STI+FV TRHHVEY++NLLK+CGYLVSY+YG+LDQ AR +QL+NFR GLT+ILVVTD
Sbjct: 407 SEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTD 466

Query: 469 VAARGVDIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWAYTIXXXXXXXXXXXXXXX 528
           VAARGVDIP+LANV+N S P+SSKIFVHRVGRTARAGN+GWAY+I               
Sbjct: 467 VAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIISESELPYLLDLELF 526

Query: 529 XGKKVLLTPMYEATCDLLKKKWISEGNEGALFQPPKISYVNRLILGSAPRLDLEAMGDLF 588
            GKK+L TPMYEA  DLL+K+W+ EG E  LF+ PK SY NRL+LGS PRLD+++MGDL+
Sbjct: 527 LGKKILTTPMYEAATDLLEKRWVEEGKEKILFKAPKPSYTNRLVLGSCPRLDIDSMGDLY 586

Query: 589 KNLVESNFELQNLKAVSIKAEKLYLRTRQPASAESIKRAKEVIAAGWDEQNVRFGKNIEK 648
           KNL+ S+FEL+ L+ V+ KAEKLYLRTR  AS ES+KR++E++ +GWDEQNV FGKN+EK
Sbjct: 587 KNLM-SSFELETLRGVAKKAEKLYLRTRTAASVESVKRSRELMTSGWDEQNVMFGKNLEK 645

Query: 649 EKLEFLAKLQNRHNKETVFEFARNHDDEMAILMKXXXXXXXXXXXXXKERQQLLEKERQA 708
           EKL+FLAKLQ+R NKETVFEFARN DDE ++LMK             K+R++LLE ++ A
Sbjct: 646 EKLDFLAKLQDRTNKETVFEFARNADDETSMLMKKRRFQVAPITEKAKKRKELLELQKAA 705

Query: 709 GLRHTLEDEILKGEENEVGYSVPQELLRDFEDADELAAK-----RNTKKGFRDENFYLSH 763
           G  H +EDE+L   E  +  SVP+E+L++FEDAD+L        R   K FRD NF+LSH
Sbjct: 706 GFSHAMEDELLNDNE-LIKESVPEEVLQEFEDADKLLEDQEKLGRKKSKSFRDPNFFLSH 764

Query: 764 FAPASDIQDKQLQVASSFTNEVSKATFDLHNDDKVQVHKQTATVKWDKKRKKYVNVQGID 823
           +AP   + + +L + S FT + ++A  D++ DDKVQVHKQ ATVKWD K+KKY+N QG D
Sbjct: 765 YAPQGGLHENELNLTSGFTTDAAQAACDINGDDKVQVHKQNATVKWDSKKKKYINSQGAD 824

Query: 824 NKKYIIGESGQKIPASFRSGKFDEWSKARKLAPLKVGARESSIPANLLADPT------GS 877
           NKKYI+GESGQKIPASFRSGK+ EWSKAR L P+KVGARES   AN+L +P       G 
Sbjct: 825 NKKYIVGESGQKIPASFRSGKYAEWSKARNLQPIKVGARESPTAANMLRNPAQNHPTDGQ 884

Query: 878 RLANGKFKHKQIKAPKMPDKNRDDYQSQLKKVNKAMESGLHVKGYNAPGM-KQELRTTEQ 936
           R   GKFKHKQ+KAPK+PDK+RDDY  Q KKV +A++ G++VKGYN  G  K EL++  Q
Sbjct: 885 RTVGGKFKHKQVKAPKLPDKHRDDYHKQKKKVKEALDKGINVKGYNTRGAPKNELQSIAQ 944

Query: 937 IRKQRSMAE 945
           IRKQR  +E
Sbjct: 945 IRKQRQTSE 953

>TBLA0B01590 Chr2 (349441..352230) [2790 bp, 929 aa] {ON} Anc_3.159
           YDL031W
          Length = 929

 Score =  713 bits (1840), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/675 (55%), Positives = 453/675 (67%), Gaps = 30/675 (4%)

Query: 9   RDTEEHSDEGEDFDIAGNIALXXXXXXXXXXXXX--NEVQDIIEFSDDEKQNAPQVSXXX 66
           R T +  +   + DI  NIAL                EVQD IE+SD++++   +     
Sbjct: 2   RTTSDIEESDSEIDIGQNIALNSDSSSDSESDNSSETEVQDEIEYSDNQEEEVKE----- 56

Query: 67  XXXXXXXXXXPRSDAAFPSLELSXXXXXXXXXXXXXXSYFNTTSQLXXXXXXXXXXXXXX 126
                      +S   FP L+                 YF TT  L              
Sbjct: 57  -DKRTDKENNTKSKNDFPQLD---GNVEVESDDDDINDYFATT-HLDTKKFKKGSFASFG 111

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHS 186
            ++FI+ NI++KG++QPTPIQRKTIPLILQ+RDIVGMARTGSGKTAAF+LP+IEKLK HS
Sbjct: 112 FNRFIMNNINKKGYKQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFLLPMIEKLKTHS 171

Query: 187 AKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIA 246
           +KIG R +ILSPSRE+A+QTH+VFKEF+K + LRSVLLTGGD LEDQF MMMSNPDV+IA
Sbjct: 172 SKIGVRGVILSPSREIAIQTHRVFKEFSKNTELRSVLLTGGDSLEDQFGMMMSNPDVVIA 231

Query: 247 TPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSATLP 306
           TPGRFLHLKVEM LDL S+EY+VFDEADRLFEMGF+EQLNELL +LP  RQ+LLFSATLP
Sbjct: 232 TPGRFLHLKVEMKLDLKSVEYIVFDEADRLFEMGFEEQLNELLAALPDNRQSLLFSATLP 291

Query: 307 SSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVATE 366
           +SLV+FAKAGL NPVLV+LD E+K+S+NLEMLFLS K +ERE+NLL+LLQ+VI +PVA+ 
Sbjct: 292 NSLVEFAKAGLKNPVLVKLDQESKISDNLEMLFLSCKKEERESNLLFLLQDVIGVPVAST 351

Query: 367 EQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYV 426
           E+++RF+                              + ++P   +TIIFV TRHHVEY+
Sbjct: 352 EEMKRFQTDSREVEEKEEKEKEKGKEKEKRAK--YYKSDEIPHEQATIIFVPTRHHVEYI 409

Query: 427 SNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMS 486
           S LL  CGYLVSYLYGTLDQHARR QL  F  G+T ILVVTDVAARGVDIPLL NV+N S
Sbjct: 410 SQLLMKCGYLVSYLYGTLDQHARRNQLRQFCFGITRILVVTDVAARGVDIPLLPNVINYS 469

Query: 487 LPASSKIFVHRVGRTARAGNKGWAYTIXXXXXXXXXXXXXXXXGKKVLLTPMYEATCDLL 546
           LP SSKIFVHRVGRTARAGN+GWAY+I                GKKV+ T M E      
Sbjct: 470 LPGSSKIFVHRVGRTARAGNRGWAYSIVSESELPYLVELGTFLGKKVITTGMVEKL---- 525

Query: 547 KKKWISEGNEGALFQPPKISYVNRLILGSAPRLDLEAMGDLFKNLVESNFELQNLKAVSI 606
                     G  F   KISY   ++LGS PR+D+E+ GDL+KN+ +  F+LQ  K    
Sbjct: 526 ----------GVSFD--KISYNKWMVLGSGPRVDVESFGDLYKNVYDQEFDLQMSKKTCE 573

Query: 607 KAEKLYLRTRQPASAESIKRAKEVIAAGWDEQNVRFGKNIEKEKLEFLAKLQNRHNKETV 666
           KAEKLYLRTR  AS +S+KR+KE+I   WD QNV+FG+++E+ KLE L K   R NKETV
Sbjct: 574 KAEKLYLRTRGGASNDSVKRSKELILQKWDGQNVKFGQDLERAKLELLNKFALRKNKETV 633

Query: 667 FEFARNHDDEMAILM 681
           FEF +N +DEM+ LM
Sbjct: 634 FEFGKNGEDEMSTLM 648

>Kpol_534.53 s534 (137204..139462) [2259 bp, 752 aa] {ON}
           (137204..139462) [2259 nt, 753 aa]
          Length = 752

 Score =  234 bits (598), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 137/391 (35%), Positives = 214/391 (54%), Gaps = 52/391 (13%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHS 186
           LS+ +L  +S  G+ +P+PIQ  TIP+ L  +DI+  A TGSGKTAAF++P+IE+L    
Sbjct: 238 LSRPVLKGLSDLGYTKPSPIQSATIPIGLSGKDIIAGAVTGSGKTAAFMIPIIERLLYKP 297

Query: 187 AKIGA-RAMILSPSRELAMQTHKVFKEFAK-GSNLRSVLLTGGDGLEDQFSMMMSNPDVI 244
           AK+ + R ++L+P+RELA+Q   V K+  K  S L   L  GG  L  Q   + + PD++
Sbjct: 298 AKVASTRVIVLTPTRELAIQIADVGKKIGKYVSGLTFGLAVGGLNLRQQEQELKTRPDIV 357

Query: 245 IATPGRFL-HLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSA 303
           IATPGRF+ H++   + ++ S+E +V DEADR+ E GFQE+LNE+L  LP+ RQTLLFSA
Sbjct: 358 IATPGRFIDHVRNSSSFNVDSVEVLVMDEADRMLEEGFQEELNEILTLLPSKRQTLLFSA 417

Query: 304 TLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDE--REANLLYLLQEVIKI 361
           T+ S +       L  PV + ++   + +  L   F+ ++  +  + A L YL++++   
Sbjct: 418 TMNSRIKSLISLSLRKPVRIMINPPKQAAARLTQEFVRIRKRDHLKPALLFYLIRKL--- 474

Query: 362 PVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRH 421
                                                       D       ++FV+ + 
Sbjct: 475 --------------------------------------------DGTGQKRIVVFVARKE 490

Query: 422 HVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLAN 481
               +  +L   G  V  L+G+L Q  R Q ++NF+     +L+ TD+A+RG+DIP +  
Sbjct: 491 MAHKLRIILGLLGMKVGELHGSLTQEQRLQSVNNFKSLEVPVLICTDLASRGLDIPKIEV 550

Query: 482 VVNMSLPASSKIFVHRVGRTARAGNKGWAYT 512
           V+N  +P S +I++HRVGRTARAG +G + T
Sbjct: 551 VINFDMPKSYEIYLHRVGRTARAGREGRSVT 581

>TPHA0N00700 Chr14 (157186..159453) [2268 bp, 755 aa] {ON} Anc_5.208
           YLL008W
          Length = 755

 Score =  234 bits (597), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 138/391 (35%), Positives = 213/391 (54%), Gaps = 52/391 (13%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHS 186
           LS+ +L  +S  G+ +P+PIQ  TIP+ L  +DI+  A TGSGKTAAF++P+IE+L    
Sbjct: 227 LSRPVLKGLSDLGYTKPSPIQSATIPIGLLGKDIIAGAVTGSGKTAAFMIPIIERLLYKP 286

Query: 187 AKIGA-RAMILSPSRELAMQTHKVFKEFAKGSN-LRSVLLTGGDGLEDQFSMMMSNPDVI 244
           A I + R ++L+P+RELA+Q   V K   K  N L   L  GG  L  Q   + + PDV+
Sbjct: 287 ANIASTRVIVLTPTRELAIQVSDVGKRIGKYVNGLTFGLAVGGLNLRQQEQELKTRPDVV 346

Query: 245 IATPGRFL-HLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSA 303
           IATPGRF+ H++   + ++ S+E +V DEADR+ E GFQE+LNE++  LPT RQTLLFSA
Sbjct: 347 IATPGRFIDHIRNSASFNVDSVEVLVIDEADRMLEDGFQEELNEIMSLLPTKRQTLLFSA 406

Query: 304 TLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDE--REANLLYLLQEVIKI 361
           T+ S +       L  PV + ++   + +  L   F+ ++  +  + A L YL++++   
Sbjct: 407 TMNSKIKQLISLSLRRPVRIMINPPKQAAARLTQEFVRIRKRDLLKPALLYYLIRKL--- 463

Query: 362 PVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRH 421
                                                       D  S    ++FVS + 
Sbjct: 464 --------------------------------------------DSSSQKRIVVFVSRKE 479

Query: 422 HVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLAN 481
               +  ++   G  V+ L+G+L Q  R Q ++ F+     +L+ TD+A+RG+DIP +  
Sbjct: 480 MAHRLRIIMGLLGMKVAELHGSLTQEQRLQSVNQFKSLEVPVLICTDLASRGLDIPKIEV 539

Query: 482 VVNMSLPASSKIFVHRVGRTARAGNKGWAYT 512
           V+N  +P S +I++HRVGRTARAG +G + T
Sbjct: 540 VINYDMPKSYEIYLHRVGRTARAGREGRSVT 570

>ZYRO0B10318g Chr2 complement(808717..810969) [2253 bp, 750 aa] {ON}
           similar to uniprot|P32892 Saccharomyces cerevisiae
           YLL008W DRS1 Nucleolar DEAD-box protein required for
           ribosome assembly and function including synthesis of
           60S ribosomal subunits
          Length = 750

 Score =  233 bits (593), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 132/391 (33%), Positives = 215/391 (54%), Gaps = 52/391 (13%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHS 186
           LS+ +L  +   G+  P+PIQ  TIP+ L  +DI+  A TGSGKTAAF++P+IE+L    
Sbjct: 244 LSRPVLKALGDLGYATPSPIQGATIPIALLGKDIIAGAVTGSGKTAAFMIPIIERLIYKP 303

Query: 187 AKIGA-RAMILSPSRELAMQTHKVFKEFAKGSN-LRSVLLTGGDGLEDQFSMMMSNPDVI 244
           AK+ + R ++L+P+RELA+Q   V K+  K  N L   +  GG  L  Q  ++ + PD++
Sbjct: 304 AKVASTRVIVLAPTRELAIQVADVGKKLGKYVNGLTFGIAVGGLNLRQQEQILKTRPDIV 363

Query: 245 IATPGRFL-HLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSA 303
           IATPGRF+ H++   + ++ S+E +V DEADR+ E GFQ+++NE++  LP+ RQT+LFSA
Sbjct: 364 IATPGRFIDHIRNSSSFNVDSVEVLVIDEADRMLEEGFQDEINEIMHLLPSKRQTMLFSA 423

Query: 304 TLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDE--REANLLYLLQEVIKI 361
           T+ S +       L  PV V  D   +    L+  F+ ++  +  + + L YL++++   
Sbjct: 424 TMNSKIKQLVSLSLKRPVRVMTDPPQQAVSKLQQEFVRIRKRDHLKPSTLFYLIKKL--- 480

Query: 362 PVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRH 421
                                                       D  +    ++FVS + 
Sbjct: 481 --------------------------------------------DGAAQKRMVVFVSKKE 496

Query: 422 HVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLAN 481
            V  +  +L   G  V+ L+G+L+Q  R Q ++ F+     +L+ TD+A+RG+DIP +  
Sbjct: 497 MVHRLRIILGLLGMAVAELHGSLNQEQRLQSINKFKSLEVPVLICTDLASRGLDIPKIEV 556

Query: 482 VVNMSLPASSKIFVHRVGRTARAGNKGWAYT 512
           V+N  +P S +I++HRVGRTARAG +G + +
Sbjct: 557 VINYDMPKSFEIYLHRVGRTARAGREGRSVS 587

>CAGL0D03124g Chr4 complement(321029..323206) [2178 bp, 725 aa] {ON}
           highly similar to uniprot|P32892 Saccharomyces
           cerevisiae YLL008w DRS1 RNA helicase of the DEAD box
           family
          Length = 725

 Score =  232 bits (592), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 139/390 (35%), Positives = 219/390 (56%), Gaps = 50/390 (12%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHS 186
           LS+ ++  +S  G+ +P+PIQ  TIP+ L  +DI+  A TGSGKTAAF++P+IE+L    
Sbjct: 213 LSRPVMKGLSNLGYVKPSPIQSATIPIALLGKDIIAGAVTGSGKTAAFMIPIIERLLYKP 272

Query: 187 AKIGA-RAMILSPSRELAMQTHKVFKEFAK-GSNLRSVLLTGGDGLEDQFSMMMSNPDVI 244
           AK+ + R ++L+P+RELA+Q   V K+  +  SNL   L  GG  L  Q  M+ + PD++
Sbjct: 273 AKVASTRVIVLTPTRELAIQVADVGKKIGQFVSNLTFGLAVGGLNLRQQEQMLKTRPDIV 332

Query: 245 IATPGRFL-HLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSA 303
           IATPGRF+ H++   + ++ S+E +V DEADR+ E GFQ++LNE++  LP+ RQTLLFSA
Sbjct: 333 IATPGRFIDHIRNSASFNVDSVEVLVIDEADRMLEDGFQDELNEIMSLLPSKRQTLLFSA 392

Query: 304 TLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSV-KNDEREANLLYLLQEVIKIP 362
           T+ S +       L  PV + +D   + +  L   F+ + K D  + +LL+ L  + K+ 
Sbjct: 393 TMNSRIKQLISLSLKRPVRIMIDPPKQAATKLTQEFVRIRKRDHLKPSLLFNL--IRKLD 450

Query: 363 VATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHH 422
              ++++  F                              + KDM             H 
Sbjct: 451 PNGQKRIVVF-----------------------------VARKDMA------------HK 469

Query: 423 VEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANV 482
           +  +  LL   G  V+ L+G+L Q  R   ++ F+     +L+ TD+A+RG+DIP +  V
Sbjct: 470 LRIILGLL---GMAVAELHGSLTQEQRLDSVNKFKSLQVPVLICTDLASRGLDIPKIEVV 526

Query: 483 VNMSLPASSKIFVHRVGRTARAGNKGWAYT 512
           +N  +P S +I++HRVGRTARAG +G + T
Sbjct: 527 INYDMPKSYEIYLHRVGRTARAGREGRSIT 556

>KLLA0C14608g Chr3 (1276354..1277817) [1464 bp, 487 aa] {ON} highly
           similar to uniprot|P38712 Saccharomyces cerevisiae
           YHR065C RRP3 Required for maturation of the 35S primary
           transcript of pre-rRNA and is required for cleavages
           leading to mature 18S RNA RRP3 is a DEAD box gene
           homologous to eIF-4a which encodes an RNA-dependent
           ATPase possessing helicase activity which is not
           specific for RNA
          Length = 487

 Score =  226 bits (576), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 135/376 (35%), Positives = 194/376 (51%), Gaps = 54/376 (14%)

Query: 140 FRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHSAKIGARAMILSPS 199
           + +PTPIQ K IP  L+  DI+G+A+TGSGKTAAF +P++ +L  H  +    A IL+P+
Sbjct: 87  YNKPTPIQSKAIPPALKGSDIIGLAQTGSGKTAAFAIPILNQL-WHDQQ-PYYACILAPT 144

Query: 200 RELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIATPGRFL-HLKVEM 258
           RELA Q  + F        +RS  + GG  + DQ   +M  P +IIATPGR + HL+   
Sbjct: 145 RELAQQIKETFDSLGSLMGVRSTCIVGGMSMMDQARDLMRKPHIIIATPGRLMDHLENTK 204

Query: 259 NLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPT-ARQTLLFSATLPSSLVDFAKAGL 317
             +L  ++Y+V DEADRL +M F   L+ +L  +PT  R T LFSAT+ S +    +A L
Sbjct: 205 GFNLRKLKYLVMDEADRLLDMEFGPVLDRILNIIPTQGRTTYLFSATMTSKIDKLQRASL 264

Query: 318 TNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVATEEQLQRFRXXXX 377
           TNPV   +  + +  + L    + V    +   L+YLL E I                  
Sbjct: 265 TNPVKCAVSNKYQTVDTLVQTLMVVPGGLKNTFLIYLLNEFIG----------------- 307

Query: 378 XXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYVSNLLKDCGYLV 437
                                             STI+F  T+ + E +SNL     +  
Sbjct: 308 ---------------------------------KSTIVFTRTKANAERISNLCNLLEFSA 334

Query: 438 SYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSLPASSKIFVHR 497
           + L+G L+Q+ R   L  F+ G  +ILV TDVAARG+DIP +  V+N  +P  SK ++HR
Sbjct: 335 TALHGDLNQNQRTGALDLFKAGKRSILVATDVAARGLDIPSVDIVINYDIPVDSKSYIHR 394

Query: 498 VGRTARAGNKGWAYTI 513
           VGRTARAG  G + ++
Sbjct: 395 VGRTARAGRSGKSISL 410

>TDEL0E04210 Chr5 complement(786151..788373) [2223 bp, 740 aa] {ON}
           Anc_5.208 YLL008W
          Length = 740

 Score =  231 bits (590), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 136/391 (34%), Positives = 212/391 (54%), Gaps = 50/391 (12%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHS 186
           LS+ +L  +   G+ +P+PIQ  TIP+ L  +DI+  A TGSGKTAAF++P+IE+L    
Sbjct: 226 LSRPVLKGLGDLGYTRPSPIQSATIPIALLGKDIIAGAVTGSGKTAAFMIPIIERLLYKP 285

Query: 187 AKIGA-RAMILSPSRELAMQTHKVFKEFAK-GSNLRSVLLTGGDGLEDQFSMMMSNPDVI 244
           AKI + R ++L+P+RELA+Q   V K+  K  S L   L  GG  L  Q   + + PD++
Sbjct: 286 AKIASTRVIVLTPTRELAIQVSDVAKKLGKYVSGLTFGLAVGGLNLRQQEQSLKARPDIV 345

Query: 245 IATPGRFL-HLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSA 303
           +ATPGRF+ H++   + ++ S+E +V DEADR+ E GFQE+LNE+L  LP+ RQTLLFSA
Sbjct: 346 VATPGRFIDHIRNSASFNVDSVEVLVIDEADRMLEEGFQEELNEILSLLPSKRQTLLFSA 405

Query: 304 TLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSV-KNDEREANLLYLLQEVIKIP 362
           T+ S +       L  PV V +D   + +  L   F+ + K D  + ++L+ L + +   
Sbjct: 406 TMNSKIKQLVSLTLKRPVRVMIDPPKQAASKLTQEFVRIRKRDHLKPSVLFHLIKKL--- 462

Query: 363 VATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHH 422
                                                      D       ++FV+ +  
Sbjct: 463 -------------------------------------------DGTGQKRMVVFVARKEM 479

Query: 423 VEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANV 482
              +  +L   G  V  L+G+L Q  R Q ++ F+     ILV TD+A+RG+DIP +  V
Sbjct: 480 AHRLRIILGLLGISVGELHGSLSQEQRLQSVNQFKSLEVPILVCTDLASRGLDIPKIEVV 539

Query: 483 VNMSLPASSKIFVHRVGRTARAGNKGWAYTI 513
           +N  +P + ++++HRVGRTARAG +G + ++
Sbjct: 540 INYDMPKNYEVYLHRVGRTARAGREGRSVSL 570

>YLL008W Chr12 (131729..133987) [2259 bp, 752 aa] {ON}
           DRS1Nucleolar DEAD-box protein required for ribosome
           assembly and function, including synthesis of 60S
           ribosomal subunits; constituent of 66S pre-ribosomal
           particles
          Length = 752

 Score =  232 bits (591), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 140/393 (35%), Positives = 217/393 (55%), Gaps = 56/393 (14%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHS 186
           LS+ +L  ++  G+ +P+PIQ  TIP+ L  +DI+  A TGSGKTAAF++P+IE+L    
Sbjct: 238 LSRPVLKGLASLGYVKPSPIQSATIPIALLGKDIIAGAVTGSGKTAAFMIPIIERLLYKP 297

Query: 187 AKIGA-RAMILSPSRELAMQTHKVFKEFAK-GSNLRSVLLTGGDGLEDQFSMMMSNPDVI 244
           AKI + R ++L P+RELA+Q   V K+ A+  S +   L  GG  L  Q  M+ S PD++
Sbjct: 298 AKIASTRVIVLLPTRELAIQVADVGKQIARFVSGITFGLAVGGLNLRQQEQMLKSRPDIV 357

Query: 245 IATPGRFL-HLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSA 303
           IATPGRF+ H++   + ++ S+E +V DEADR+ E GFQ++LNE++G LP+ RQ LLFSA
Sbjct: 358 IATPGRFIDHIRNSASFNVDSVEILVMDEADRMLEEGFQDELNEIMGLLPSNRQNLLFSA 417

Query: 304 TLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSV-KNDEREANLLYLLQEVIKIP 362
           T+ S +       L  PV + +D   K +  L   F+ + K D  +  LL+ L  + K+ 
Sbjct: 418 TMNSKIKSLVSLSLKKPVRIMIDPPKKAATKLTQEFVRIRKRDHLKPALLFNL--IRKLD 475

Query: 363 VATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVS---T 419
              ++++                                            ++FV+   T
Sbjct: 476 PTGQKRI--------------------------------------------VVFVARKET 491

Query: 420 RHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLL 479
            H +  +  LL   G  V  L+G+L Q  R   ++ F+     +L+ TD+A+RG+DIP +
Sbjct: 492 AHRLRIIMGLL---GMSVGELHGSLTQEQRLDSVNKFKNLEVPVLICTDLASRGLDIPKI 548

Query: 480 ANVVNMSLPASSKIFVHRVGRTARAGNKGWAYT 512
             V+N  +P S +I++HRVGRTARAG +G + T
Sbjct: 549 EVVINYDMPKSYEIYLHRVGRTARAGREGRSVT 581

>Smik_12.55 Chr12 (118743..120950) [2208 bp, 735 aa] {ON} YLL008W
           (REAL)
          Length = 735

 Score =  231 bits (590), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 141/393 (35%), Positives = 214/393 (54%), Gaps = 56/393 (14%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHS 186
           LS+ +L  ++  G+ +P+PIQ  TIP+ L  +DI+  A TGSGKTAAF++P+IE+L    
Sbjct: 221 LSRPVLKGLASLGYAKPSPIQSATIPIALLGKDIIAGAVTGSGKTAAFMIPIIERLLYKP 280

Query: 187 AKIGA-RAMILSPSRELAMQTHKVFKEFAK-GSNLRSVLLTGGDGLEDQFSMMMSNPDVI 244
           AKI + R ++L P+RELA+Q   V K+ A+  S +   L  GG  L  Q  M+ S PD++
Sbjct: 281 AKIASTRVIVLLPTRELAIQVADVGKQIARFVSGITFGLAVGGLNLRQQEQMLKSRPDIV 340

Query: 245 IATPGRFL-HLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSA 303
           IATPGRF+ H++   + ++ S+E +V DEADR+ E GFQ++LNE++G LP+ RQ LLFSA
Sbjct: 341 IATPGRFIDHIRNSASFNVDSVEILVMDEADRMLEEGFQDELNEIMGLLPSNRQNLLFSA 400

Query: 304 TLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSV-KNDEREANLLYLLQEVIKIP 362
           T+ S +       L  PV + +D   K +  L   F+ + K D  +  LL+ L   +  P
Sbjct: 401 TMNSKIKSLVSLSLKKPVRIMIDPPKKAATKLTQEFVRIRKRDHLKPALLFNLIRKLD-P 459

Query: 363 VATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVS---T 419
           V  +                                               ++FV+   T
Sbjct: 460 VGQKR---------------------------------------------IVVFVARKET 474

Query: 420 RHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLL 479
            H +  +  LL   G  V  L+G+L Q  R   ++ F+     +L+ TD+A+RG+DIP +
Sbjct: 475 AHRLRIIMGLL---GMSVGELHGSLTQEQRLDSVNKFKNLEVPVLICTDLASRGLDIPKI 531

Query: 480 ANVVNMSLPASSKIFVHRVGRTARAGNKGWAYT 512
             V+N  +P S +I++HRVGRTARAG +G + T
Sbjct: 532 EVVINYDMPKSHEIYLHRVGRTARAGREGRSVT 564

>KNAG0B04660 Chr2 complement(900857..902341) [1485 bp, 494 aa] {ON}
           Anc_5.337 YHR065C
          Length = 494

 Score =  225 bits (574), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 135/376 (35%), Positives = 195/376 (51%), Gaps = 54/376 (14%)

Query: 140 FRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHSAKIGARAMILSPS 199
           + +PTPIQ ++IP  L+ +DI+G+A+TGSGKTAAF +P++  L  H  +    A ILSP+
Sbjct: 94  YSKPTPIQSRSIPPALKGKDIIGLAQTGSGKTAAFAIPILNSL-WHDQQ-PYYACILSPT 151

Query: 200 RELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIATPGRFL-HLKVEM 258
           RELA Q  + F        +RSV + GG  + DQ   +M  P +II TPGR + HL+   
Sbjct: 152 RELAQQIKETFDSLGSLMGVRSVCIVGGMNMMDQARDLMRKPHIIIGTPGRLMDHLENTR 211

Query: 259 NLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPT-ARQTLLFSATLPSSLVDFAKAGL 317
              L +++Y+V DEADRL +M F   L+ +L  +PT  R T LFSAT+ S +    +A L
Sbjct: 212 GFSLRNLKYLVMDEADRLLDMEFGPVLDRILKIIPTQGRTTYLFSATMTSKIDKLQRASL 271

Query: 318 TNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVATEEQLQRFRXXXX 377
           TNPV   + T+ +  + L    + V    ++  L+YLL E I                  
Sbjct: 272 TNPVKCAVSTKYQTVDTLVQTLMVVPGGVKDTYLVYLLNEFIG----------------- 314

Query: 378 XXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYVSNLLKDCGYLV 437
                                             S IIF  T+ + E +S L     +  
Sbjct: 315 ---------------------------------KSMIIFTRTKANAERISGLANLLQFSA 341

Query: 438 SYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSLPASSKIFVHR 497
           + L+G L+Q+ R   L  F+ G  +ILV TDVAARG+DIP +  V+N  +P  SK ++HR
Sbjct: 342 TALHGDLNQNQRTGALDLFKAGRRSILVATDVAARGLDIPSVDVVINYDIPVDSKSYIHR 401

Query: 498 VGRTARAGNKGWAYTI 513
           VGRTARAG  G + ++
Sbjct: 402 VGRTARAGRSGKSISL 417

>NDAI0C04250 Chr3 (968216..969730) [1515 bp, 504 aa] {ON} Anc_5.337
          Length = 504

 Score =  225 bits (573), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 138/376 (36%), Positives = 192/376 (51%), Gaps = 54/376 (14%)

Query: 140 FRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHSAKIGARAMILSPS 199
           + +PTPIQ K+IP  L+  DI+G+A+TGSGKTAAF +P++  L  H  +    A IL+P+
Sbjct: 104 YSKPTPIQSKSIPPALKGHDIIGLAQTGSGKTAAFAIPILNSL-WHDQQ-PYYACILAPT 161

Query: 200 RELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIATPGRFL-HLKVEM 258
           RELA Q  + F        +RSV + GG  + DQ   +M  P VIIATPGR + HL+   
Sbjct: 162 RELAQQIKETFDSLGSLMGVRSVCIVGGMNMMDQARDLMRKPHVIIATPGRLMDHLENTK 221

Query: 259 NLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPT-ARQTLLFSATLPSSLVDFAKAGL 317
              L  ++Y+V DEADRL +M F   L+ +L  LPT  R T LFSAT+ S +    +A L
Sbjct: 222 GFSLRKLKYLVMDEADRLLDMEFGPVLDRILKILPTQGRTTYLFSATMTSKIDKLQRASL 281

Query: 318 TNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVATEEQLQRFRXXXX 377
           TNPV   +  + +  + L    + V    +   L+YLL E I                  
Sbjct: 282 TNPVKCAVSNKYQTVDTLVQTLIVVPGGLKNTFLIYLLNEYIG----------------- 324

Query: 378 XXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYVSNLLKDCGYLV 437
                                             STIIF  T+ + E +S L     +  
Sbjct: 325 ---------------------------------KSTIIFTRTKANAERISGLCNLLEFNA 351

Query: 438 SYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSLPASSKIFVHR 497
           + L+G L+Q+ R   L  F+ G   ILV TDVAARG+DIP +  V+N  +P  SK ++HR
Sbjct: 352 TALHGDLNQNQRTGALDLFKAGRKTILVATDVAARGLDIPSVDIVINYDIPVDSKSYIHR 411

Query: 498 VGRTARAGNKGWAYTI 513
           VGRTARAG  G + ++
Sbjct: 412 VGRTARAGRSGKSISL 427

>Ecym_3217 Chr3 complement(411925..413385) [1461 bp, 486 aa] {ON}
           similar to Ashbya gossypii AAL041C
          Length = 486

 Score =  224 bits (572), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 135/376 (35%), Positives = 192/376 (51%), Gaps = 54/376 (14%)

Query: 140 FRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHSAKIGARAMILSPS 199
           F +PTPIQ K IP  LQ  DI+G+A+TGSGKTAAF +P++ +L  H  +    A IL+P+
Sbjct: 86  FTKPTPIQSKAIPPALQGNDIIGLAQTGSGKTAAFAIPILNQL-WHDQQ-PYYACILAPT 143

Query: 200 RELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIATPGRFL-HLKVEM 258
           RELA Q  + F        +RS  + GG  + DQ   +M  P +IIATPGR + HL+   
Sbjct: 144 RELAQQIKETFDSLGSLMGVRSTCIMGGMNMMDQARDLMRKPHIIIATPGRLMDHLENTK 203

Query: 259 NLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPT-ARQTLLFSATLPSSLVDFAKAGL 317
              L  + ++V DEADRL +M F   L+ +L ++PT  R T LFSAT+ S +    +A L
Sbjct: 204 GFSLRKLRFLVIDEADRLLDMEFGAVLDRILKNIPTKGRTTYLFSATMTSKIDKLQRASL 263

Query: 318 TNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVATEEQLQRFRXXXX 377
           TNPV   +  + +  + L    + V    +   L+YLL E I                  
Sbjct: 264 TNPVKCSVSNKYQTVDTLIQTLMVVPGGLKNTYLIYLLNEFIG----------------- 306

Query: 378 XXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYVSNLLKDCGYLV 437
                                             STI+F  T+ + E +S L     +  
Sbjct: 307 ---------------------------------KSTIVFTRTKANAERISGLCNLLEFSA 333

Query: 438 SYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSLPASSKIFVHR 497
           + L+G L+Q+ R   L  F+ G  +ILV TDVAARG+DIP +  V+N  +P  SK ++HR
Sbjct: 334 TALHGDLNQNQRTGALDLFKAGRRSILVATDVAARGLDIPSVDIVINYDIPVDSKSYIHR 393

Query: 498 VGRTARAGNKGWAYTI 513
           VGRTARAG  G + ++
Sbjct: 394 VGRTARAGRSGKSISL 409

>KLLA0F15752g Chr6 (1454735..1456981) [2247 bp, 748 aa] {ON} similar
           to uniprot|P32892 Saccharomyces cerevisiae YLL008W DRS1
           Nucleolar DEAD-box protein required for ribosome
           assembly and function
          Length = 748

 Score =  230 bits (587), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 140/393 (35%), Positives = 208/393 (52%), Gaps = 56/393 (14%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHS 186
           LS+ +L  +   G+  P+PIQ   IP+ L  +DI+  A TGSGKTAAF++P+IE+L    
Sbjct: 240 LSRPVLKGLGSLGYTSPSPIQSAAIPIALLGKDIIAGAVTGSGKTAAFMIPIIERLLYKP 299

Query: 187 AKIGA-RAMILSPSRELAMQTHKVFKEFAKGSN-LRSVLLTGGDGLEDQFSMMMSNPDVI 244
           A I + R ++L+P+RELA+Q   V K   K  N L   L  GG  L  Q   + + PD++
Sbjct: 300 AHIASTRVVVLTPTRELAIQVADVGKNIGKFVNGLTFGLAVGGLNLRQQEQALKTRPDIV 359

Query: 245 IATPGRFL-HLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSA 303
           IATPGRF+ HL+   +  + S+E +V DEADR+ E GFQE+L E++  +P+ RQTLLFSA
Sbjct: 360 IATPGRFIDHLRNSASFSVDSVEILVIDEADRMLEEGFQEELQEIMSLIPSKRQTLLFSA 419

Query: 304 TLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSV-KNDEREANLLYLLQEVIKIP 362
           T+ S +       L  PV + +D   + ++ L   F+ + K D  +  LLY L   +   
Sbjct: 420 TMNSKIKQLISLSLKKPVRIMIDPPKQAADKLTQEFIRIRKRDHLKPALLYQLIRKL--- 476

Query: 363 VATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVS---T 419
                                                      D  S    ++FV+   T
Sbjct: 477 -------------------------------------------DNTSQKRIVVFVARKET 493

Query: 420 RHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLL 479
            H +  V  LL   G  V  L+G+L Q  R Q ++NF+     +L+ TD+A+RG+DIP +
Sbjct: 494 AHKLRIVLGLL---GMQVGELHGSLTQEQRLQSVNNFKSLQVPVLICTDLASRGLDIPKI 550

Query: 480 ANVVNMSLPASSKIFVHRVGRTARAGNKGWAYT 512
             V+N  +P + +I++HRVGRTARAG +G + T
Sbjct: 551 EVVINFDMPKTYEIYLHRVGRTARAGREGRSVT 583

>NCAS0A01550 Chr1 complement(302857..305103) [2247 bp, 748 aa] {ON}
           Anc_5.208
          Length = 748

 Score =  230 bits (587), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 136/390 (34%), Positives = 211/390 (54%), Gaps = 50/390 (12%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHS 186
           LS+ +L  ++  G+ +P+PIQ  TIP+ L  +DI+  A TGSGKTAAF++P+IE+L   S
Sbjct: 233 LSRPVLKGLATLGYTKPSPIQSATIPVALSGKDIIAGAVTGSGKTAAFMIPVIERLLFKS 292

Query: 187 AKIGA-RAMILSPSRELAMQTHKVFKEFAKGSN-LRSVLLTGGDGLEDQFSMMMSNPDVI 244
           AKI A R ++L+P+RELA+Q   V K+  K  N +   L  GG  L  Q   + + PD++
Sbjct: 293 AKIAATRVIVLTPTRELAIQISDVGKKIGKFINGITFGLAVGGLNLRQQEQELKARPDIV 352

Query: 245 IATPGRFL-HLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSA 303
           IATPGRF+ H++   + ++ S+E +V DEADR+ E GFQE+LNE++  LP  RQTLLFSA
Sbjct: 353 IATPGRFIDHIRNSASFNVDSVEILVIDEADRMLEEGFQEELNEIMQLLPNKRQTLLFSA 412

Query: 304 TLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVK-NDEREANLLYLLQEVIKIP 362
           T+ S +       L  PV + +D   + +  L   F+ ++  D  +  LL+ L + +   
Sbjct: 413 TMNSKIKQLVSLSLRKPVRIMIDPPKQAASRLTQEFVRIRARDHLKPALLFNLIKKL--- 469

Query: 363 VATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHH 422
                                                      D       ++FVS +  
Sbjct: 470 -------------------------------------------DGYGQKRMVVFVSRKEM 486

Query: 423 VEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANV 482
              +  +L   G  V+ L+G+L Q  R + +  F+     +L+ TD+A+RG+DIP +  V
Sbjct: 487 AHRLRIILGLLGMNVAELHGSLSQEQRLESVTKFKSLEIPVLICTDLASRGLDIPKIEVV 546

Query: 483 VNMSLPASSKIFVHRVGRTARAGNKGWAYT 512
           +N  +P S +I++HRVGRTARAG +G + +
Sbjct: 547 INYDMPKSYEIYLHRVGRTARAGREGRSVS 576

>KAFR0C06420 Chr3 complement(1286002..1288221) [2220 bp, 739 aa]
           {ON} Anc_5.208 YLL008W
          Length = 739

 Score =  228 bits (582), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 138/390 (35%), Positives = 208/390 (53%), Gaps = 50/390 (12%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHS 186
           LS+ +L  +S  GF +P+PIQ  TIP+ L  +DIV  A TGSGKTAAF++P+IE+L    
Sbjct: 221 LSRPVLKGLSSLGFTKPSPIQSATIPIALLGKDIVAGAVTGSGKTAAFMIPIIERLLYKP 280

Query: 187 AKIGA-RAMILSPSRELAMQTHKVFKEFAKGSN-LRSVLLTGGDGLEDQFSMMMSNPDVI 244
           AK+ + R +IL+P+RELA+Q   V K+     N L   L  GG  L  Q  ++ S PD++
Sbjct: 281 AKVASTRVVILTPTRELAIQISDVAKKIGHFVNGLTFGLAVGGLNLRQQEQILKSRPDIV 340

Query: 245 IATPGRFL-HLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSA 303
           IATPGRF+ H++   +  +  +E +V DEADR+ E GFQ++L+E++  LPT RQ LLFSA
Sbjct: 341 IATPGRFIDHVRNSASFSVDRVEILVLDEADRMLEEGFQDELSEIMTLLPTRRQNLLFSA 400

Query: 304 TLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSV-KNDEREANLLYLLQEVIKIP 362
           T+ S +       L  PV + +D   + ++ L   F+ + K D  +  LLY L   +   
Sbjct: 401 TMNSKIKQLVSLSLKKPVRIMIDPPKQAADRLVQEFVRIRKRDHLKPALLYNLIRKL--- 457

Query: 363 VATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHH 422
                                                      D       ++FVS +  
Sbjct: 458 -------------------------------------------DSTGQKRIVVFVSRKEV 474

Query: 423 VEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANV 482
              +  +L   G  V+ L+G+L Q  R   ++ F+     +L+ TD+A+RG+DIP +  V
Sbjct: 475 AHRLRIILGLLGMGVAELHGSLSQEQRLDSVNKFKSLDVPVLICTDLASRGLDIPKIEIV 534

Query: 483 VNMSLPASSKIFVHRVGRTARAGNKGWAYT 512
           +N  +P S +I++HRVGRTARAG +G + T
Sbjct: 535 INYDMPKSYEIYLHRVGRTARAGREGRSVT 564

>NCAS0F02790 Chr6 (561303..562811) [1509 bp, 502 aa] {ON} Anc_5.337
          Length = 502

 Score =  222 bits (566), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 134/376 (35%), Positives = 193/376 (51%), Gaps = 54/376 (14%)

Query: 140 FRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHSAKIGARAMILSPS 199
           + +PTPIQ ++IP  L+  DI+G+A+TGSGKTAAF +P++  L  H  +    A IL+P+
Sbjct: 102 YTKPTPIQSRSIPPALKGNDIIGLAQTGSGKTAAFAIPILNSL-WHDQQ-PYYACILAPT 159

Query: 200 RELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIATPGRFL-HLKVEM 258
           RELA Q  + F        +RS  + GG  + DQ   +M  P +IIATPGR + HL+   
Sbjct: 160 RELAQQIKETFDSLGSLMGVRSTCIVGGMNMMDQARDLMRKPHIIIATPGRLMDHLENTK 219

Query: 259 NLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPT-ARQTLLFSATLPSSLVDFAKAGL 317
              L  ++Y+V DEADRL +M F   L+ +L  LPT  R T LFSAT+ S +    +A L
Sbjct: 220 GFSLRKLKYLVMDEADRLLDMEFGPVLDRILKILPTQGRTTYLFSATMTSKIDKLQRASL 279

Query: 318 TNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVATEEQLQRFRXXXX 377
           TNPV   +  + +  + L    + V    ++  L+YLL E I                  
Sbjct: 280 TNPVKCAVSNKYQTVDTLVQTLIVVPGGLKDTYLVYLLNEFIG----------------- 322

Query: 378 XXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYVSNLLKDCGYLV 437
                                             +TIIF  T+ + E +S L     +  
Sbjct: 323 ---------------------------------KTTIIFTRTKANAERISGLCNLLEFNA 349

Query: 438 SYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSLPASSKIFVHR 497
           + L+G L+Q+ R   L  F+ G  +ILV TDVAARG+DIP +  V+N  +P  SK ++HR
Sbjct: 350 TALHGDLNQNQRTGALDLFKAGRKSILVATDVAARGLDIPSVDIVINYDIPVDSKSYIHR 409

Query: 498 VGRTARAGNKGWAYTI 513
           VGRTARAG  G + ++
Sbjct: 410 VGRTARAGRSGKSISL 425

>Skud_12.59 Chr12 (122973..125249) [2277 bp, 758 aa] {ON} YLL008W
           (REAL)
          Length = 758

 Score =  228 bits (580), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 134/390 (34%), Positives = 212/390 (54%), Gaps = 50/390 (12%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHS 186
           LS+ +L  ++  G+  P+PIQ  TIP+ L  +DI+  A TGSGKTAAF++P+IE+L    
Sbjct: 244 LSRPVLKGLANLGYVTPSPIQSATIPIALLGKDIIAGAVTGSGKTAAFMIPIIERLLYKP 303

Query: 187 AKIGA-RAMILSPSRELAMQTHKVFKEFAK-GSNLRSVLLTGGDGLEDQFSMMMSNPDVI 244
           AKI + R ++L P+RELA+Q   V K+ A+   ++   L  GG  L  Q  M+ S PD++
Sbjct: 304 AKIASTRVIVLLPTRELALQVADVGKQIARFVPSITFGLAVGGLNLRQQEQMLKSRPDIV 363

Query: 245 IATPGRFL-HLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSA 303
           IATPGRF+ H++   + ++ S+E +V DEADR+ E GFQ++LNE++G LP++RQ LLFSA
Sbjct: 364 IATPGRFIDHIRNSASFNVDSVEILVMDEADRMLEEGFQDELNEIMGLLPSSRQNLLFSA 423

Query: 304 TLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSV-KNDEREANLLYLLQEVIKIP 362
           T+ S +       L  PV + +D   K +  L   F+ + K D  +  L++ L   +  P
Sbjct: 424 TMNSKIKSLVSLSLKRPVRIMIDPPKKAATKLTQEFVRIRKRDHLKPALIFNLIRKLD-P 482

Query: 363 VATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHH 422
           +A +                                               ++FV+ +  
Sbjct: 483 MAQKR---------------------------------------------IVVFVARKES 497

Query: 423 VEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANV 482
              +  ++   G  V  L+G+L Q  R   +  F+     +L+ TD+A+RG+DIP +  V
Sbjct: 498 AHRLRIIMGLLGMSVGELHGSLTQEQRLDSVSKFKNLEVPVLICTDLASRGLDIPKIEVV 557

Query: 483 VNMSLPASSKIFVHRVGRTARAGNKGWAYT 512
           +N  +P S ++++HRVGRTARAG +G + T
Sbjct: 558 INYDMPKSHEVYLHRVGRTARAGREGRSVT 587

>TBLA0C06160 Chr3 (1494579..1496852) [2274 bp, 757 aa] {ON}
           Anc_5.208 YLL008W
          Length = 757

 Score =  228 bits (580), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 134/390 (34%), Positives = 213/390 (54%), Gaps = 50/390 (12%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHS 186
           LS+ +L  ++  G+ +P+PIQ   IP+ L  +DI+  A TGSGKTAAF++P+IE+L    
Sbjct: 243 LSRPVLKGLAALGYSKPSPIQSAAIPIALLGKDIIAGAVTGSGKTAAFMIPIIERLLYKP 302

Query: 187 AKI-GARAMILSPSRELAMQTHKVFKEFAKGSNLRSV-LLTGGDGLEDQFSMMMSNPDVI 244
           AK+   R ++L+P+RELA+Q   V K+  K  N  +  L  GG  L  Q   + S PD++
Sbjct: 303 AKVTSTRVIVLTPTRELAIQVSDVGKKVGKFVNGVTFGLAVGGLNLRQQEQQLKSRPDIV 362

Query: 245 IATPGRFL-HLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSA 303
           +ATPGRF+ H++   + ++ S+E +V DEADR+ E GFQ++LNE++  LP+ RQTLLFSA
Sbjct: 363 VATPGRFIDHIRNSASFNVDSVEILVIDEADRMLEDGFQDELNEIMSLLPSKRQTLLFSA 422

Query: 304 TLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSV-KNDEREANLLYLLQEVIKIP 362
           T+ S +       L  PV + +D   + +  L   F+ + K D  +  LLY L  + K+ 
Sbjct: 423 TMNSKIKQLISLSLKKPVRIMIDPPKQAAAKLVQEFVRIRKRDNLKPALLYTL--IRKLD 480

Query: 363 VATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHH 422
            A ++++                                            ++FV+ +  
Sbjct: 481 GAGQKRI--------------------------------------------VVFVARKET 496

Query: 423 VEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANV 482
              +  +L   G  V  L+G+L Q  R   ++ F+     +L+ TD+A+RG+DIP +  V
Sbjct: 497 AHKLRIILGLLGQSVGELHGSLTQEQRLDSVNKFKSLEVPVLLCTDLASRGLDIPKIEVV 556

Query: 483 VNMSLPASSKIFVHRVGRTARAGNKGWAYT 512
           +N  +P S +I++HRVGRTARAG +G + T
Sbjct: 557 INYDMPKSYEIYLHRVGRTARAGREGRSVT 586

>KNAG0H02520 Chr8 complement(463527..465791) [2265 bp, 754 aa] {ON}
           Anc_5.208 YLL008W
          Length = 754

 Score =  227 bits (578), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 130/391 (33%), Positives = 210/391 (53%), Gaps = 50/391 (12%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHS 186
           LS+ +L  ++  G+ +P+PIQ  TIP+ LQ +D++  A TGSGKTAAF++P+IE+L    
Sbjct: 246 LSRPVLKGLAHLGYTKPSPIQSATIPVALQGKDVIAGAVTGSGKTAAFMIPIIERLLFKP 305

Query: 187 AKIG-ARAMILSPSRELAMQTHKVFKEFAK-GSNLRSVLLTGGDGLEDQFSMMMSNPDVI 244
           +K+   R ++L+P+RELA+Q   V K+  +  S L   L  GG  L  Q   + + PD++
Sbjct: 306 SKVAMTRVIVLTPTRELAIQISDVAKKIGQFVSGLTFGLAVGGLNLRQQEQALKARPDIV 365

Query: 245 IATPGRFL-HLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSA 303
           IATPGRF+ H++   + ++ S+E +V DEADR+ E GFQ++L E++  LP+ RQ LLFSA
Sbjct: 366 IATPGRFIDHIRNSASFNVDSVEILVLDEADRMLEEGFQDELKEIMTMLPSKRQNLLFSA 425

Query: 304 TLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSV-KNDEREANLLYLLQEVIKIP 362
           T+ S +       L  PV + +D   + +  L   F+ + K D  +  LL+ L   +   
Sbjct: 426 TMNSKIKSLVSLSLRRPVRIMIDPPKQAASKLTQEFVRIRKRDNLKPALLFNLIRKL--- 482

Query: 363 VATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHH 422
                                                      D  +    ++FV+ +  
Sbjct: 483 -------------------------------------------DSNAQKRIVVFVARKET 499

Query: 423 VEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANV 482
              +  +L   G  V+ L+G+L Q  R + +  F+     +L+ TD+A+RG+DIP +  V
Sbjct: 500 AHRLRIILGLLGMAVAELHGSLTQEQRLESVTRFKSLDVPVLICTDLASRGLDIPKIEVV 559

Query: 483 VNMSLPASSKIFVHRVGRTARAGNKGWAYTI 513
           +N  +P S +I++HRVGRTARAG +G + T+
Sbjct: 560 INYDMPKSHEIYLHRVGRTARAGREGRSVTL 590

>NDAI0C02490 Chr3 complement(570276..572591) [2316 bp, 771 aa] {ON}
           Anc_5.208
          Length = 771

 Score =  227 bits (578), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 133/391 (34%), Positives = 212/391 (54%), Gaps = 50/391 (12%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHS 186
           LS+ +L  ++  G+ +P+PIQ  TIP+ L  +DI+  A TGSGKTAAF++P+IE+L    
Sbjct: 256 LSRPVLKGLANLGYNKPSPIQSATIPIALLGKDIIAGAVTGSGKTAAFMIPIIERLLFKP 315

Query: 187 AKIGA-RAMILSPSRELAMQTHKVFKEFAKGSN-LRSVLLTGGDGLEDQFSMMMSNPDVI 244
           AK+ + R ++L+P+RELA+Q   V K+  K  N L   L  GG  L  Q  ++   PD++
Sbjct: 316 AKVSSTRVIVLTPTRELAIQIADVAKKIGKFVNGLTFGLAVGGLNLRQQEQILKQRPDIV 375

Query: 245 IATPGRFL-HLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSA 303
           IATPGRF+ H++   + ++ S+E +V DEADR+ E GFQE+LNE++  LPT RQT+LFSA
Sbjct: 376 IATPGRFIDHVRNSASFNVDSVEILVMDEADRMLEEGFQEELNEIMQLLPTKRQTMLFSA 435

Query: 304 TLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKN-DEREANLLYLLQEVIKIP 362
           T+ S +       L  PV + ++   + +  L   F+ ++  D  +  LL+ L + +   
Sbjct: 436 TMNSKIKQLINLSLKKPVRIMINPPKQAASKLTQEFVRIRTRDHLKPALLFNLIKKL--- 492

Query: 363 VATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHH 422
                                                      D  S    ++FV+ +  
Sbjct: 493 -------------------------------------------DEYSQKRMVVFVARKET 509

Query: 423 VEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANV 482
              +  +L   G  V+ L+G+L Q  R + +  F+     +L+ TD+A+RG+DIP +  V
Sbjct: 510 AHKLRIILGLLGMNVAELHGSLTQEQRLESVTKFKSLEIPVLICTDLASRGLDIPKIEVV 569

Query: 483 VNMSLPASSKIFVHRVGRTARAGNKGWAYTI 513
           +N  +P S  I++HRVGRTARAG +G + ++
Sbjct: 570 INYDMPKSYDIYLHRVGRTARAGREGRSVSL 600

>AAL164C Chr1 complement(55223..57427) [2205 bp, 734 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL008W
           (DRS1)
          Length = 734

 Score =  226 bits (576), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 133/392 (33%), Positives = 211/392 (53%), Gaps = 52/392 (13%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHS 186
           LS+ +L  ++  G+ +P+PIQ  TIP+ L  +D++  A TGSGKTAAF++P+IE+L    
Sbjct: 226 LSRPVLKGLAALGYTKPSPIQGATIPIALLGKDVIAGAVTGSGKTAAFMIPIIERLLYKP 285

Query: 187 AKIGA-RAMILSPSRELAMQTHKVFKEFAK-GSNLRSVLLTGGDGLEDQFSMMMSNPDVI 244
           AKI + R ++L+P+RELA+Q   V K+  K  S L   L  GG  L  Q   +   PD++
Sbjct: 286 AKIASTRVLVLTPTRELAIQVADVGKKLGKFVSGLTFGLAVGGLNLRQQEQALKLRPDIV 345

Query: 245 IATPGRFL-HLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSA 303
           IATPGR + H++   +  + S+E +V DEADR+ E GFQ++LNE++  +P+ RQTLLFSA
Sbjct: 346 IATPGRIIDHIRNSASFSVDSVEVLVIDEADRMLEDGFQDELNEIMSLIPSKRQTLLFSA 405

Query: 304 TLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDE--REANLLYLLQEVIKI 361
           T+ S +       L  PV + +D   + +  L   F+ ++  E  + A L +LL+++   
Sbjct: 406 TMNSRIKQLISLSLKKPVRIMIDPPKQAANKLTQEFVRLRKREHLKPALLYHLLRKL--- 462

Query: 362 PVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRH 421
                                                       D       ++FV+ + 
Sbjct: 463 --------------------------------------------DSTGQKRIVVFVARKE 478

Query: 422 HVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLAN 481
               +  +L   G     L+G+L Q  R Q ++NF+     +LV TD+A+RG+DIP +  
Sbjct: 479 VAHRLRVILGLLGMKAGELHGSLTQEQRLQSVNNFKSLDVPVLVCTDLASRGLDIPKIEV 538

Query: 482 VVNMSLPASSKIFVHRVGRTARAGNKGWAYTI 513
           V+N  +P + +I++HRVGRTARAG +G + T+
Sbjct: 539 VINYDMPKTYEIYLHRVGRTARAGREGKSVTL 570

>TDEL0E02890 Chr5 (550708..552213) [1506 bp, 501 aa] {ON} Anc_5.337
           YHR065C
          Length = 501

 Score =  220 bits (560), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 133/376 (35%), Positives = 191/376 (50%), Gaps = 54/376 (14%)

Query: 140 FRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHSAKIGARAMILSPS 199
           F +PTPIQ K IP  L+ +DI+G+A+TGSGKTAAF LP++ +L    +     A ILSP+
Sbjct: 101 FTKPTPIQAKAIPPALEGKDIIGLAQTGSGKTAAFALPILNRLWHDQSPY--YACILSPT 158

Query: 200 RELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIATPGRFL-HLKVEM 258
           RELA Q  + F         R+  + GG  + DQ   +M  P +IIATPGR + HL+   
Sbjct: 159 RELAQQIKETFDSLGTIMGARTTCIVGGMNMMDQARDLMRKPHIIIATPGRLMDHLENTK 218

Query: 259 NLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPT-ARQTLLFSATLPSSLVDFAKAGL 317
              L  ++++V DEADRL +M F   L+ +L  +PT  R T LFSAT+ S +    +A L
Sbjct: 219 GFSLRKLKFLVMDEADRLLDMEFGPVLDRILKIIPTQGRTTYLFSATMTSKIDKLQRASL 278

Query: 318 TNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVATEEQLQRFRXXXX 377
           T+PV   +  + +  + L    + V    +   L+YLL E I                  
Sbjct: 279 TDPVKCAVSNKYQTVDTLVQTLMVVPGGLKNTFLIYLLNEFIG----------------- 321

Query: 378 XXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYVSNLLKDCGYLV 437
                                             +TIIF  T+ + E +S L     +  
Sbjct: 322 ---------------------------------KTTIIFTRTKANAERISGLCNLLEFNA 348

Query: 438 SYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSLPASSKIFVHR 497
           + L+G L+Q+ R   L  F+ G  +ILV TDVAARG+DIP +  V+N  +P  SK ++HR
Sbjct: 349 TALHGDLNQNQRTGALDLFKAGRRSILVATDVAARGLDIPSVDIVINYDIPVDSKSYIHR 408

Query: 498 VGRTARAGNKGWAYTI 513
           VGRTARAG  G + ++
Sbjct: 409 VGRTARAGRSGKSISL 424

>ZYRO0C14234g Chr3 complement(1116350..1117834) [1485 bp, 494 aa]
           {ON} highly similar to uniprot|Q75EW9 Ashbya gossypii
           AAL041C RRP3 ATP-dependent rRNA helicase RRP3 and
           similar to YHR065C uniprot|P38712 Saccharomyces
           cerevisiae YHR065C RRP3 Required for maturation of the
           35S primary transcript of pre-rRNA and is required for
           cleavages leading to mature 18S RNA RRP3 is a DEAD box
           gene homologous to eIF- 4a which encodes an
           RNA-dependent ATPase possessing helicase activity which
           is not specific for RNA
          Length = 494

 Score =  219 bits (558), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 132/376 (35%), Positives = 192/376 (51%), Gaps = 54/376 (14%)

Query: 140 FRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHSAKIGARAMILSPS 199
           F +PTPIQ + IP  L+ RDI+G+A+TGSGKTAAF +P++ +L     K    A +L+P+
Sbjct: 92  FDKPTPIQARAIPPALEGRDIIGLAQTGSGKTAAFAIPILNRL--WEDKQPYYACVLAPT 149

Query: 200 RELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIATPGRFL-HLKVEM 258
           RELA QT + F        +RS  + GG  + DQ   +M  P +IIATPGR + HL+   
Sbjct: 150 RELAQQTKETFDSLGALMGVRSTCIVGGMNMMDQARELMRKPHIIIATPGRLMDHLENTK 209

Query: 259 NLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTA-RQTLLFSATLPSSLVDFAKAGL 317
              L  + ++V DEADRL +M F   L+++L  +PT  R T LFSAT+ S +    +A L
Sbjct: 210 GFSLRKLRFLVMDEADRLLDMEFGPVLDKILKVIPTQDRTTYLFSATMTSKIDKLQRASL 269

Query: 318 TNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVATEEQLQRFRXXXX 377
           T PV   +  + +  + L    + V +  +   L+YLL E I                  
Sbjct: 270 TEPVKCAVSNKYQTVDTLVQTLMVVPSGLKNTYLIYLLNENIG----------------- 312

Query: 378 XXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYVSNLLKDCGYLV 437
                                             + IIF  T+ + E +S L     +  
Sbjct: 313 ---------------------------------KTVIIFTRTKANAERLSALCNLLEFNA 339

Query: 438 SYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSLPASSKIFVHR 497
           + L+G L+Q+ R   L  F+ G  +ILV TDVAARG+DIP +  V+N  +P  SK ++HR
Sbjct: 340 TALHGDLNQNQRTGALDLFKAGRRSILVATDVAARGLDIPSVDIVINYDIPVDSKSYIHR 399

Query: 498 VGRTARAGNKGWAYTI 513
           VGRTARAG  G + ++
Sbjct: 400 VGRTARAGRSGKSISL 415

>Suva_10.67 Chr10 (136688..138922) [2235 bp, 744 aa] {ON} YLL008W
           (REAL)
          Length = 744

 Score =  225 bits (573), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 138/394 (35%), Positives = 216/394 (54%), Gaps = 56/394 (14%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHS 186
           LS+ +L  ++  G+ +P+PIQ  TIP+ L  +DI+  A TGSGKTAAF++P+IE+L    
Sbjct: 230 LSRPVLKGLASLGYVKPSPIQSATIPIALLGKDIIAGAVTGSGKTAAFMIPIIERLLYKP 289

Query: 187 AKIGA-RAMILSPSRELAMQTHKVFKEFAK-GSNLRSVLLTGGDGLEDQFSMMMSNPDVI 244
            KI + R ++L P+RELA+Q   V K+ A+  S +   L  GG  L  Q  ++ S PD++
Sbjct: 290 GKIASTRVIVLLPTRELALQVADVGKQIARFVSGITFGLAVGGLNLRQQEQLLKSRPDIV 349

Query: 245 IATPGRFL-HLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSA 303
           IATPGRF+ H++   + ++ S+E +V DEADR+ E GFQ++LNE++G LP+ RQ LLFSA
Sbjct: 350 IATPGRFIDHIRNSASFNVDSVEILVMDEADRMLEEGFQDELNEIMGLLPSNRQNLLFSA 409

Query: 304 TLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSV-KNDEREANLLYLLQEVIKIP 362
           T+ S +       L  PV + +D   + +  L   F+ + K D  +  LL+ L  + K+ 
Sbjct: 410 TMNSKIKSLVSLSLRRPVRIMIDPPKQAATKLTQEFVRIRKRDHLKPALLFNL--IRKLD 467

Query: 363 VATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVS---T 419
              ++++                                            ++FV+   T
Sbjct: 468 PMGQKRI--------------------------------------------VVFVARKET 483

Query: 420 RHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLL 479
            H +  +  LL   G  V  L+G+L Q  R   ++ F+     +LV TD+A+RG+DIP +
Sbjct: 484 AHRLRIIMGLL---GMSVGELHGSLTQEQRLDSVNKFKNLEVPVLVCTDLASRGLDIPKI 540

Query: 480 ANVVNMSLPASSKIFVHRVGRTARAGNKGWAYTI 513
             VVN  +P S +I++HRVGRTARA  +G + T+
Sbjct: 541 EVVVNYDMPKSYEIYLHRVGRTARADREGRSVTL 574

>SAKL0G09328g Chr7 (797795..799312) [1518 bp, 505 aa] {ON} highly
           similar to uniprot|P38712 Saccharomyces cerevisiae
           YHR065C RRP3 Required for maturation of the 35S primary
           transcript of pre-rRNA and is required for cleavages
           leading to mature 18S RNA RRP3 is a DEAD box gene
           homologous to eIF-4a which encodes an RNA-dependent
           ATPase possessing helicase activity which is not
           specific for RNA
          Length = 505

 Score =  219 bits (557), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 133/377 (35%), Positives = 191/377 (50%), Gaps = 54/377 (14%)

Query: 139 GFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHSAKIGARAMILSP 198
           GF +PTPIQ K IP  L+  DI+G+A+TGSGKTAAF +P++ +L  H  +    A IL+P
Sbjct: 104 GFSKPTPIQAKAIPPALEGSDIIGLAQTGSGKTAAFAIPILNRL-WHDQQ-PYYACILAP 161

Query: 199 SRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIATPGRFL-HLKVE 257
           +RELA Q  + F        +R+  + GG  + DQ   +M  P +IIATPGR + HL+  
Sbjct: 162 TRELAQQIKETFDSLGALMGVRATCIVGGMNMMDQARDLMRKPHIIIATPGRLMDHLENT 221

Query: 258 MNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPT-ARQTLLFSATLPSSLVDFAKAG 316
               L  + ++V DEADRL +M F   L+ +L  +PT  R T LFSAT+ S +    +A 
Sbjct: 222 RGFSLRKLRFLVMDEADRLLDMEFGPVLDRILKIIPTQGRTTYLFSATMTSKIDKLQRAS 281

Query: 317 LTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVATEEQLQRFRXXX 376
           LTNPV   +  + +  + L    + V    +   L+YLL E I                 
Sbjct: 282 LTNPVKCAVSNKYQTVDTLVQTLMVVPGGLKNTFLIYLLNEFIG---------------- 325

Query: 377 XXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYVSNLLKDCGYL 436
                                              + I+F  T+ + E +S L     + 
Sbjct: 326 ----------------------------------KTVIVFTRTKANAERISTLCNLLEFS 351

Query: 437 VSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSLPASSKIFVH 496
            + L+G L+Q+ R   L  F+ G  +ILV TDVAARG+DIP +  VVN  +P  SK ++H
Sbjct: 352 ATALHGDLNQNQRTGALDLFKAGKRSILVATDVAARGLDIPSVDIVVNYDIPVDSKSYIH 411

Query: 497 RVGRTARAGNKGWAYTI 513
           RVGRTARAG  G + ++
Sbjct: 412 RVGRTARAGRSGKSISL 428

>TPHA0D01990 Chr4 complement(411607..413103) [1497 bp, 498 aa] {ON}
           Anc_5.337 YHR065C
          Length = 498

 Score =  218 bits (555), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 134/376 (35%), Positives = 190/376 (50%), Gaps = 54/376 (14%)

Query: 140 FRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHSAKIGARAMILSPS 199
           F +PTPIQ K+IP  L+  DI+G+A+TGSGKTAAF +P++ KL     +    A IL+P+
Sbjct: 95  FSKPTPIQSKSIPPALEGHDIIGLAQTGSGKTAAFAIPILNKL--WEDQQPYYACILAPT 152

Query: 200 RELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIATPGRFL-HLKVEM 258
           RELA Q  + F        +RSV + GG  + DQ   +M  P +IIATPGR + HL+   
Sbjct: 153 RELAQQIKETFDSLGSLMGVRSVCIVGGMNMMDQSRELMRKPHIIIATPGRLMDHLENTK 212

Query: 259 NLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTA-RQTLLFSATLPSSLVDFAKAGL 317
              L  ++++V DEADRL +M F   L+ +L  +PT  R T LFSAT+ S +    +A L
Sbjct: 213 GFSLRKLKFLVMDEADRLLDMEFGPVLDRILKIIPTQDRTTYLFSATMTSKIEKLQRASL 272

Query: 318 TNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVATEEQLQRFRXXXX 377
           TNPV   +  + +  E L    + V    +   L+YLL E I                  
Sbjct: 273 TNPVKCAVSNKYQTVETLVQTLMVVPGGLKNTYLIYLLNEFIG----------------- 315

Query: 378 XXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYVSNLLKDCGYLV 437
                                             S I+F  T+ + E +S L     +  
Sbjct: 316 ---------------------------------KSIIVFTRTKANAERLSALSNLLEFSS 342

Query: 438 SYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSLPASSKIFVHR 497
           + L+G L+Q+ R   L  F+ G   ILV  DVAARG+DIP +  V+N  +P  SK ++HR
Sbjct: 343 TALHGDLNQNQRTGALDLFKAGKRQILVAIDVAARGLDIPSVDIVINYDIPVDSKSYIHR 402

Query: 498 VGRTARAGNKGWAYTI 513
           VGRTARAG  G + ++
Sbjct: 403 VGRTARAGRSGKSISL 418

>SAKL0G12760g Chr7 complement(1088344..1090557) [2214 bp, 737 aa]
           {ON} similar to uniprot|P32892 Saccharomyces cerevisiae
           YLL008W DRS1 Nucleolar DEAD-box protein required for
           ribosome assembly and function including synthesis of
           60S ribosomal subunits
          Length = 737

 Score =  224 bits (570), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 129/391 (32%), Positives = 212/391 (54%), Gaps = 52/391 (13%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHS 186
           LS+ +L  +   G+ +P+PIQ  TIP+ L  +DI+  A TGSGKTAA+++P+IE+L    
Sbjct: 230 LSRPVLKGLGALGYVKPSPIQGATIPIALLGKDIIAGAVTGSGKTAAYMIPIIERLLYKP 289

Query: 187 AKIGA-RAMILSPSRELAMQTHKVFKEFAKGSN-LRSVLLTGGDGLEDQFSMMMSNPDVI 244
           A++ + R ++L+P+RELA+Q   V K+  K  N L   L  GG  L  Q   +   PD++
Sbjct: 290 AQVASTRVVVLAPTRELAIQVADVGKKIGKFVNGLTFGLAVGGLNLRQQEQTLKLRPDIV 349

Query: 245 IATPGRFL-HLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSA 303
           IATPGRF+ H++   +  + S+E +V DEADR+ E GF ++LNE++  +P+ RQTLLFSA
Sbjct: 350 IATPGRFIDHIRNSASFSVDSVEVLVIDEADRMLEEGFHDELNEIMSLIPSKRQTLLFSA 409

Query: 304 TLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDE--REANLLYLLQEVIKI 361
           T+ S +       L  PV + +D   + +  L   F+ ++  +  + A L +L++++   
Sbjct: 410 TMNSKIKQLVSLSLKKPVRIMIDPPKQAAAKLTQEFVRIRKRDHLKPALLFHLIRKI--- 466

Query: 362 PVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRH 421
                                                       D  S    ++FVS + 
Sbjct: 467 --------------------------------------------DETSQKRIVVFVSRKE 482

Query: 422 HVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLAN 481
               +  +L   G  V+ L+G+L Q  R Q +++F+     +L+ TD+A+RG+DIP +  
Sbjct: 483 MAHRLRIILGLLGMKVAELHGSLTQEQRLQSVNSFKSLDVPVLICTDLASRGLDIPKIEV 542

Query: 482 VVNMSLPASSKIFVHRVGRTARAGNKGWAYT 512
           V+N  +P + +I++HRVGRTARAG +G + +
Sbjct: 543 VINFDMPKTYEIYLHRVGRTARAGREGRSVS 573

>Kpol_1005.11 s1005 complement(18157..19677) [1521 bp, 506 aa] {ON}
           complement(18157..19677) [1521 nt, 507 aa]
          Length = 506

 Score =  218 bits (554), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 130/376 (34%), Positives = 192/376 (51%), Gaps = 54/376 (14%)

Query: 140 FRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHSAKIGARAMILSPS 199
           F +PTPIQ ++IP  LQ  DI+G+A+TGSGKTAAF +P++ +L  H  +    A IL+P+
Sbjct: 106 FAKPTPIQARSIPPALQGHDIIGLAQTGSGKTAAFAIPILNRL-WHDQQ-PYYACILAPT 163

Query: 200 RELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIATPGRFL-HLKVEM 258
           RELA Q  + F        +RS  + GG  + DQ   +M  P +IIATPGR + HL+   
Sbjct: 164 RELAQQIKETFDSLGSLMGVRSACIVGGMNMMDQARDLMRKPHIIIATPGRLMDHLENTR 223

Query: 259 NLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPT-ARQTLLFSATLPSSLVDFAKAGL 317
              L  ++++V DEADRL +M F   L+ +L  +PT  R T LFSAT+ S +    +A L
Sbjct: 224 GFSLRKLKFLVMDEADRLLDMEFGPVLDRILKIIPTQGRTTYLFSATMTSKIDKLQRASL 283

Query: 318 TNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVATEEQLQRFRXXXX 377
           TNPV   +  + +  + L    + V    +   L+YL+ E I                  
Sbjct: 284 TNPVKCAVSNKYQTVDTLVQTLIVVPGGLKNTYLIYLMNEFIG----------------- 326

Query: 378 XXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYVSNLLKDCGYLV 437
                                             + I+F  T+ + E ++ L     +  
Sbjct: 327 ---------------------------------KTIIVFTRTKANAERITTLANLLEFSA 353

Query: 438 SYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSLPASSKIFVHR 497
           + L+G L+Q+ R   L  F+ G  +ILV TDVAARG+DIP +  V+N  +P  SK ++HR
Sbjct: 354 TALHGDLNQNQRTGSLDLFKAGRRSILVATDVAARGLDIPSVDIVINYDIPVDSKSYIHR 413

Query: 498 VGRTARAGNKGWAYTI 513
           VGRTARAG  G + ++
Sbjct: 414 VGRTARAGRSGKSISL 429

>Smik_8.136 Chr8 complement(202825..204330) [1506 bp, 501 aa] {ON}
           YHR065C (REAL)
          Length = 501

 Score =  218 bits (554), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 135/376 (35%), Positives = 193/376 (51%), Gaps = 54/376 (14%)

Query: 140 FRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHSAKIGARAMILSPS 199
           + +PTPIQ K+IP  L+  DI+G+A+TGSGKTAAF +P++ +L  H  +    A IL+P+
Sbjct: 101 YSKPTPIQSKSIPPALEGHDIIGLAQTGSGKTAAFAIPILNRL-WHDQE-PYYACILAPT 158

Query: 200 RELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIATPGRFL-HLKVEM 258
           RELA Q  + F        +RS  + GG  + DQ   +M  P +IIATPGR + HL+   
Sbjct: 159 RELAQQIKETFDSLGSLMGVRSTCIVGGMNMMDQARDLMRKPHIIIATPGRLMDHLENTK 218

Query: 259 NLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTA-RQTLLFSATLPSSLVDFAKAGL 317
              L  ++++V DEADRL +M F   L+ +L  +PT  R T LFSAT+ S +    +A L
Sbjct: 219 GFSLRKLKFLVMDEADRLLDMEFGPVLDRILKIIPTQERTTYLFSATMTSKIDKLQRASL 278

Query: 318 TNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVATEEQLQRFRXXXX 377
           TNPV   +  + +  + L    + V    +   L+YLL E I                  
Sbjct: 279 TNPVKCAVSNKYQTVDTLVQTLMVVPGGLKNTYLIYLLNEFI------------------ 320

Query: 378 XXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYVSNLLKDCGYLV 437
                                      K M      IIF  T+ + E +S L     +  
Sbjct: 321 --------------------------GKTM------IIFTRTKANAERLSGLCNLLEFSA 348

Query: 438 SYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSLPASSKIFVHR 497
           + L+G L+Q+ R   L  F+ G  +ILV TDVAARG+DIP +  VVN  +P  SK ++HR
Sbjct: 349 TALHGDLNQNQRMGALDLFKAGKRSILVATDVAARGLDIPSVDIVVNYDIPVDSKSYIHR 408

Query: 498 VGRTARAGNKGWAYTI 513
           VGRTARAG  G + ++
Sbjct: 409 VGRTARAGRSGKSISL 424

>Kwal_33.14325 s33 (619599..621101) [1503 bp, 500 aa] {ON} YHR065C
           (RRP3) - RRP3 is a DEAD box gene homologous to eIF-4a
           which encodes an RNA-dependent ATPase possessing
           helicase activity which is not specific for RNA [contig
           104] FULL
          Length = 500

 Score =  217 bits (553), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 129/376 (34%), Positives = 193/376 (51%), Gaps = 54/376 (14%)

Query: 140 FRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHSAKIGARAMILSPS 199
           + +PTPIQ + IP  L+ +DI+G+A+TGSGKTAAF +P++ +L  H  +    A +L+P+
Sbjct: 99  YSKPTPIQAEAIPPALEGKDIIGLAQTGSGKTAAFAIPILNQL-WHDQQ-PYYACVLAPT 156

Query: 200 RELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIATPGRFL-HLKVEM 258
           RELA Q  + F        +R+  + GG  + DQ   +M  P +IIATPGR + HL+   
Sbjct: 157 RELAQQIKETFDSLGGAMGVRTTCIVGGMNMIDQARDLMRKPHIIIATPGRLMDHLENTK 216

Query: 259 NLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPT-ARQTLLFSATLPSSLVDFAKAGL 317
              +  ++Y+V DEADRL +M F   L+ +L  +PT  R T LFSAT+ S +    +A L
Sbjct: 217 GFSMRKLKYLVMDEADRLLDMEFGPVLDRILKIIPTQGRTTYLFSATMTSKIDKLQRASL 276

Query: 318 TNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVATEEQLQRFRXXXX 377
           TNPV   + T+ +  + L    + V    +   L+YLL E +                  
Sbjct: 277 TNPVKCAVSTKYQTVDTLIQTLMVVPGGLKNTFLIYLLNEFLG----------------- 319

Query: 378 XXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYVSNLLKDCGYLV 437
                                             + IIF  T+ + E +S L     +  
Sbjct: 320 ---------------------------------KTVIIFTRTKANAERISTLCNLLEFSS 346

Query: 438 SYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSLPASSKIFVHR 497
           + L+G L+Q+ R   L  F+ G  +ILV TDVAARG+DIP +  V+N  +P  SK ++HR
Sbjct: 347 TALHGDLNQNQRTGALDLFKAGRRSILVATDVAARGLDIPSVDIVINYDIPVDSKSYIHR 406

Query: 498 VGRTARAGNKGWAYTI 513
           VGRTARAG  G + ++
Sbjct: 407 VGRTARAGRSGKSISL 422

>YHR065C Chr8 complement(227532..229037) [1506 bp, 501 aa] {ON}
           RRP3Protein involved in rRNA processing; required for
           maturation of the 35S primary transcript of pre-rRNA and
           for cleavage leading to mature 18S rRNA; homologous to
           eIF-4a, which is a DEAD box RNA-dependent ATPase with
           helicase activity
          Length = 501

 Score =  217 bits (553), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 135/376 (35%), Positives = 192/376 (51%), Gaps = 54/376 (14%)

Query: 140 FRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHSAKIGARAMILSPS 199
           + +PTPIQ K IP  L+  DI+G+A+TGSGKTAAF +P++ +L  H  +    A IL+P+
Sbjct: 101 YSKPTPIQSKAIPPALEGHDIIGLAQTGSGKTAAFAIPILNRL-WHDQE-PYYACILAPT 158

Query: 200 RELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIATPGRFL-HLKVEM 258
           RELA Q  + F        +RS  + GG  + DQ   +M  P +IIATPGR + HL+   
Sbjct: 159 RELAQQIKETFDSLGSLMGVRSTCIVGGMNMMDQARDLMRKPHIIIATPGRLMDHLENTK 218

Query: 259 NLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTA-RQTLLFSATLPSSLVDFAKAGL 317
              L  ++++V DEADRL +M F   L+ +L  +PT  R T LFSAT+ S +    +A L
Sbjct: 219 GFSLRKLKFLVMDEADRLLDMEFGPVLDRILKIIPTQERTTYLFSATMTSKIDKLQRASL 278

Query: 318 TNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVATEEQLQRFRXXXX 377
           TNPV   +  + +  + L    + V    +   L+YLL E I                  
Sbjct: 279 TNPVKCAVSNKYQTVDTLVQTLMVVPGGLKNTYLIYLLNEFI------------------ 320

Query: 378 XXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYVSNLLKDCGYLV 437
                                      K M      IIF  T+ + E +S L     +  
Sbjct: 321 --------------------------GKTM------IIFTRTKANAERLSGLCNLLEFSA 348

Query: 438 SYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSLPASSKIFVHR 497
           + L+G L+Q+ R   L  F+ G  +ILV TDVAARG+DIP +  VVN  +P  SK ++HR
Sbjct: 349 TALHGDLNQNQRMGSLDLFKAGKRSILVATDVAARGLDIPSVDIVVNYDIPVDSKSYIHR 408

Query: 498 VGRTARAGNKGWAYTI 513
           VGRTARAG  G + ++
Sbjct: 409 VGRTARAGRSGKSISL 424

>AAL041C Chr1 complement(270739..272202) [1464 bp, 487 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR065C
           (RRP3)
          Length = 487

 Score =  216 bits (551), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 133/377 (35%), Positives = 193/377 (51%), Gaps = 55/377 (14%)

Query: 140 FRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHSAKIGARAMILSPS 199
           F +PTPIQ K IP  LQ +DI+G+A+TGSGKTAAF +P++ +L  H  +    A IL+P+
Sbjct: 86  FTKPTPIQSKAIPPALQGKDIIGLAQTGSGKTAAFAIPILNRL-WHDQQ-PYYACILAPT 143

Query: 200 RELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIATPGRFL-HLKV-E 257
           RELA Q  + F        +R+  + GG  + DQ   +M  P +IIATPGR + HL+V +
Sbjct: 144 RELAQQIKETFDSLGSLMGVRTTCIVGGMNMMDQARDLMRKPHIIIATPGRLMDHLEVHK 203

Query: 258 MNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPT-ARQTLLFSATLPSSLVDFAKAG 316
               L   +++V DEADRL  M F   L+ +L ++PT  R T LFSAT+ S +    +A 
Sbjct: 204 RGFALRKQQFLVMDEADRLLNMKFGPVLDRILKNIPTKVRTTYLFSATMTSKIDKLQRAS 263

Query: 317 LTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVATEEQLQRFRXXX 376
           LTN V   +  + +  + L    + V    +   L+YLL E I                 
Sbjct: 264 LTNTVKCAVSNKYQTVDTLVQTLIVVPGGLKNTFLIYLLNEFIG---------------- 307

Query: 377 XXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYVSNLLKDCGYL 436
                                              +TI+F  T+ + E +S L     + 
Sbjct: 308 ----------------------------------KTTIVFTRTKANAERISGLCNLLEFS 333

Query: 437 VSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSLPASSKIFVH 496
            + L+G L+Q+ R   L  F+ G  +ILV TDVAARG+DIP +  V+N  +P  SK ++H
Sbjct: 334 ATALHGDLNQNQRTGALDLFKAGKKSILVATDVAARGLDIPSVDLVINYDIPVDSKSYIH 393

Query: 497 RVGRTARAGNKGWAYTI 513
           RVGRTARAG  G + ++
Sbjct: 394 RVGRTARAGRSGKSVSL 410

>KLTH0B03278g Chr2 complement(257395..259614) [2220 bp, 739 aa] {ON}
           similar to uniprot|P32892 Saccharomyces cerevisiae
           YLL008W DRS1 Nucleolar DEAD-box protein required for
           ribosome assembly and function including synthesis of
           60S ribosomal subunits
          Length = 739

 Score =  221 bits (564), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 133/390 (34%), Positives = 209/390 (53%), Gaps = 50/390 (12%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHS 186
           LS+ +L  +    + +P+PIQ  TIP+ L  +DI+  A TGSGKTAA+++P+IE+L    
Sbjct: 230 LSRPVLKGLGALNYVKPSPIQSATIPIALLGKDIIAGAVTGSGKTAAYMIPIIERLLYKP 289

Query: 187 AKIGA-RAMILSPSRELAMQTHKVFKEFAKGSNLRSV-LLTGGDGLEDQFSMMMSNPDVI 244
           A+I + R ++L+P+RELA+Q   V  + AK  N  S  L  GG  L  Q   + S PD++
Sbjct: 290 AQIASTRVIVLTPTRELAIQVSDVGAKLAKFVNGISFGLAVGGLNLRQQEQTLRSRPDIV 349

Query: 245 IATPGRFL-HLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSA 303
           IATPGR + H++   + ++ S+E +V DEADR+ E GFQ++LNE++  +P+ RQTLLFSA
Sbjct: 350 IATPGRLIDHIRNSASFNVDSVEILVIDEADRMLEEGFQDELNEIMSLIPSKRQTLLFSA 409

Query: 304 TLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSV-KNDEREANLLYLLQEVIKIP 362
           T+ S +       L  PV + +D   + +  L   F+ V K DE +  LL+ L   +   
Sbjct: 410 TMNSKINQLISLSLKKPVKIMIDPPRQAAAKLTQEFVRVRKRDELKPALLFHLIRKL--- 466

Query: 363 VATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHH 422
                                                      D  S    ++FV+ +  
Sbjct: 467 -------------------------------------------DDLSQKRVVVFVARKEV 483

Query: 423 VEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANV 482
              +  +L   G  V+ L+G+L Q  R Q ++ F+     +L+ TD+A+RG+DIP +  V
Sbjct: 484 AHKLRIILGLLGMKVAELHGSLSQEQRLQAVNGFKSLQVPVLICTDLASRGLDIPKIEFV 543

Query: 483 VNMSLPASSKIFVHRVGRTARAGNKGWAYT 512
           +N  +P +  I++HRVGRTARAG +G + +
Sbjct: 544 INYDMPKTYDIYLHRVGRTARAGREGRSIS 573

>Skud_8.122 Chr8 complement(200848..202359) [1512 bp, 503 aa] {ON}
           YHR065C (REAL)
          Length = 503

 Score =  216 bits (550), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 135/376 (35%), Positives = 193/376 (51%), Gaps = 54/376 (14%)

Query: 140 FRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHSAKIGARAMILSPS 199
           + +PTPIQ K+IP  L+  DI+G+A+TGSGKTAAF +P++ +L  H  +    A IL+P+
Sbjct: 103 YSKPTPIQSKSIPPALKGHDIIGLAQTGSGKTAAFAIPILNRL-WHDQE-PYYACILAPT 160

Query: 200 RELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIATPGRFL-HLKVEM 258
           RELA Q  + F        +RS  + GG  + DQ   +M  P +IIATPGR + HL+   
Sbjct: 161 RELAQQIKEAFDSLGSLMGVRSTCIVGGMNMMDQARDLMRKPHIIIATPGRLMDHLENTK 220

Query: 259 NLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTA-RQTLLFSATLPSSLVDFAKAGL 317
              L  ++++V DEADRL +M F   L+ +L  +PT  R T LFSAT+ S +    +A L
Sbjct: 221 GFSLRKLKFLVMDEADRLLDMEFGPVLDRILKIIPTQERTTYLFSATMTSKIDKLQRASL 280

Query: 318 TNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVATEEQLQRFRXXXX 377
           TNPV   +  + +  + L    + V    +   L+YLL E I                  
Sbjct: 281 TNPVKCAVSNKYQTVDTLVQALMVVPGGLKNTYLIYLLNESI------------------ 322

Query: 378 XXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYVSNLLKDCGYLV 437
                                      K M      IIF  T+ + E +S L     +  
Sbjct: 323 --------------------------GKTM------IIFTRTKANAERLSGLCNLLEFSA 350

Query: 438 SYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSLPASSKIFVHR 497
           + L+G L+Q+ R   L  F+ G  +ILV TDVAARG+DIP +  VVN  +P  SK ++HR
Sbjct: 351 TALHGDLNQNQRMGALDLFKAGKRSILVATDVAARGLDIPSVDIVVNYDIPVDSKSYIHR 410

Query: 498 VGRTARAGNKGWAYTI 513
           VGRTARAG  G + ++
Sbjct: 411 VGRTARAGRSGKSISL 426

>Kwal_33.15165 s33 (987878..990073) [2196 bp, 731 aa] {ON} YLL008W
           (DRS1) - putative ATP dependent RNA helicase [contig 94]
           FULL
          Length = 731

 Score =  221 bits (563), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 129/391 (32%), Positives = 212/391 (54%), Gaps = 52/391 (13%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHS 186
           LS+ +L  +    + +P+PIQ  TIP+ L  +DI+  A TGSGKTAA+++P+IE+L    
Sbjct: 222 LSRPVLKGLGALNYVKPSPIQSATIPIALTGKDIIAGAVTGSGKTAAYMIPIIERLLYKP 281

Query: 187 AKIGA-RAMILSPSRELAMQTHKVFKEFAKGSN-LRSVLLTGGDGLEDQFSMMMSNPDVI 244
           A++ + R ++L+P+RELA+Q   V  + AK  N +   L  GG  L  Q   + + PDV+
Sbjct: 282 AQVSSTRVIVLAPTRELAIQVSDVGTKLAKYVNGINFGLAVGGLNLRQQEQALRARPDVV 341

Query: 245 IATPGRFL-HLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSA 303
           IATPGR + H++   + ++ S+E +V DEADR+ E GFQ++LNE++  +P+ RQTLLFSA
Sbjct: 342 IATPGRLIDHIRNSASFNVDSVEILVIDEADRMLEDGFQDELNEIMSLIPSKRQTLLFSA 401

Query: 304 TLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSV--KNDEREANLLYLLQEVIKI 361
           T+ S +       L  PV + +D   + +  L   F+ V  ++D + A L +L++++   
Sbjct: 402 TMNSKINQLISLSLKKPVRIMIDPPKQAAAKLVQEFVRVRKRDDLKPALLFHLIRKL--- 458

Query: 362 PVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRH 421
                                                       D  S    ++FV+ + 
Sbjct: 459 --------------------------------------------DDASQKRVVVFVARKE 474

Query: 422 HVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLAN 481
               +  +L   G  V+ L+G+L Q  R Q ++ F+     +L+ TD+A+RG+DIP +  
Sbjct: 475 MAHKLRIILGLLGMKVAELHGSLSQEQRLQAVNGFKSLQIPVLICTDLASRGLDIPKIEF 534

Query: 482 VVNMSLPASSKIFVHRVGRTARAGNKGWAYT 512
           V+N  +P +  I++HRVGRTARAG +G + +
Sbjct: 535 VINFDMPKTYDIYLHRVGRTARAGREGRSIS 565

>KLTH0F07106g Chr6 (618637..620214) [1578 bp, 525 aa] {ON} highly
           similar to uniprot|P38712 Saccharomyces cerevisiae
           YHR065C RRP3 Required for maturation of the 35S primary
           transcript of pre-rRNA and is required for cleavages
           leading to mature 18S RNA RRP3 is a DEAD box gene
           homologous to eIF-4a which encodes an RNA-dependent
           ATPase possessing helicase activity which is not
           specific for RNA
          Length = 525

 Score =  215 bits (548), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 126/376 (33%), Positives = 193/376 (51%), Gaps = 54/376 (14%)

Query: 140 FRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHSAKIGARAMILSPS 199
           + +PTPIQ + IP  L+ +DI+G+A+TGSGKTAAF +P++ +L  H  +    A +L+P+
Sbjct: 125 YSKPTPIQAEAIPPALEGKDIIGLAQTGSGKTAAFAIPILNQL-WHDQQ-PYYACVLAPT 182

Query: 200 RELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIATPGRFL-HLKVEM 258
           RELA Q  + F        +R+  + GG  + DQ   +M  P +IIATPGR + HL+   
Sbjct: 183 RELAQQIKETFDSLGGAMGVRTTCIVGGMNMIDQARDLMRKPHIIIATPGRLMDHLENTK 242

Query: 259 NLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPT-ARQTLLFSATLPSSLVDFAKAGL 317
              +  ++++V DEADRL +M F   L+ +L  +PT  R T LFSAT+ S +    +A L
Sbjct: 243 GFSMRKLKFLVMDEADRLLDMEFGPVLDRILKIIPTQGRTTYLFSATMTSKIDKLQRASL 302

Query: 318 TNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVATEEQLQRFRXXXX 377
           TNPV   + T+ +  + L    + V    +   L+YLL E +                  
Sbjct: 303 TNPVKCAVSTKYQTVDTLIQTLMVVPGGLKNTFLIYLLNEFLG----------------- 345

Query: 378 XXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYVSNLLKDCGYLV 437
                                             + I+F  T+ + E ++ L     +  
Sbjct: 346 ---------------------------------KTAIVFTRTKANAERIATLCNLLEFSA 372

Query: 438 SYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSLPASSKIFVHR 497
           + L+G L+Q+ R   L  F+ G  +ILV TDVAARG+DIP +  V+N  +P  SK ++HR
Sbjct: 373 TALHGDLNQNQRTGALDLFKAGRRSILVATDVAARGLDIPSVDIVINYDIPVDSKSYIHR 432

Query: 498 VGRTARAGNKGWAYTI 513
           VGRTARAG  G + ++
Sbjct: 433 VGRTARAGRSGKSISL 448

>CAGL0J10912g Chr10 (1063600..1065081) [1482 bp, 493 aa] {ON} highly
           similar to uniprot|P38712 Saccharomyces cerevisiae
           YHR065c RRP3
          Length = 493

 Score =  214 bits (545), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 129/376 (34%), Positives = 190/376 (50%), Gaps = 54/376 (14%)

Query: 140 FRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHSAKIGARAMILSPS 199
           F +PTPIQ + IP  L   D++G+A+TGSGKTAAF +P++ KL     +    A +L+P+
Sbjct: 93  FTKPTPIQARAIPPALAGSDVIGLAQTGSGKTAAFAIPILNKL--WEDQQPYYACVLAPT 150

Query: 200 RELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIATPGRFL-HLKVEM 258
           RELA Q  + F        +R+  + GG  + DQ   +M  P +IIATPGR + HL+   
Sbjct: 151 RELAQQIKETFDSLGSLMGVRTTCIVGGMNMMDQARDLMRKPHIIIATPGRLMDHLENTK 210

Query: 259 NLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPT-ARQTLLFSATLPSSLVDFAKAGL 317
              L +++++V DEADRL +M F   L+ +L  +PT  R T LFSAT+ S +    +A L
Sbjct: 211 GFSLKNLKFLVMDEADRLLDMEFGPVLDRILKIIPTKGRTTYLFSATMTSKIDKLQRASL 270

Query: 318 TNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVATEEQLQRFRXXXX 377
           TNPV   +  + +  + L    + V    +   L+YLL E I                  
Sbjct: 271 TNPVKCAVSNKYQTVDTLVQTLMVVPGGLKNTFLIYLLNEFIG----------------- 313

Query: 378 XXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYVSNLLKDCGYLV 437
                                             + IIF  T+ + E +S L     +  
Sbjct: 314 ---------------------------------KTVIIFTRTKANAERLSGLCNLLEFSA 340

Query: 438 SYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSLPASSKIFVHR 497
           + L+G L+Q+ R   L  F+ G  +ILV TDVAARG+DIP +  V+N  +P  SK ++HR
Sbjct: 341 TALHGDLNQNQRTGALDLFKAGKRSILVATDVAARGLDIPSVDIVINYDIPVDSKSYIHR 400

Query: 498 VGRTARAGNKGWAYTI 513
           VGRTARAG  G + ++
Sbjct: 401 VGRTARAGRSGKSISL 416

>Suva_15.254 Chr15 complement(429201..430712) [1512 bp, 503 aa] {ON}
           YHR065C (REAL)
          Length = 503

 Score =  214 bits (545), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 135/376 (35%), Positives = 191/376 (50%), Gaps = 54/376 (14%)

Query: 140 FRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHSAKIGARAMILSPS 199
           + +PTPIQ K+IP  L   DI+G+A+TGSGKTAAF +P++ +L  H  +    A IL+P+
Sbjct: 103 YSKPTPIQSKSIPPALAGHDIIGLAQTGSGKTAAFAIPILNRL-WHDQE-PYYACILAPT 160

Query: 200 RELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIATPGRFL-HLKVEM 258
           RELA Q  + F        +RS  + GG  + DQ   +M  P +IIATPGR + HL+   
Sbjct: 161 RELAQQIKEAFDSLGSLMGVRSTCIVGGMNMMDQARDLMRKPHIIIATPGRLMDHLENTK 220

Query: 259 NLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTA-RQTLLFSATLPSSLVDFAKAGL 317
              L  ++++V DEADRL +M F   L+ +L  +PT  R T LFSAT+ S +    +A L
Sbjct: 221 GFSLRKLKFLVMDEADRLLDMEFGPVLDRILKIIPTQERTTYLFSATMTSKIDKLQRASL 280

Query: 318 TNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVATEEQLQRFRXXXX 377
           TNPV   +  + +  + L    + V    +   L+YLL E I                  
Sbjct: 281 TNPVKCAVSNKYQTVDTLVQTLMVVPGGLKNTYLIYLLNEFI------------------ 322

Query: 378 XXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYVSNLLKDCGYLV 437
                                      K M      IIF  T+ + E +S L     +  
Sbjct: 323 --------------------------GKTM------IIFTRTKANAERLSGLCNLLEFSA 350

Query: 438 SYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSLPASSKIFVHR 497
           + L+G L+Q+ R   L  F+ G   ILV TDVAARG+DIP +  VVN  +P  SK ++HR
Sbjct: 351 TALHGDLNQNQRMGALDLFKAGKRAILVATDVAARGLDIPSVDIVVNYDIPVDSKSYIHR 410

Query: 498 VGRTARAGNKGWAYTI 513
           VGRTARAG  G + ++
Sbjct: 411 VGRTARAGRSGKSVSL 426

>TBLA0C03500 Chr3 complement(835236..836756) [1521 bp, 506 aa] {ON}
           Anc_5.337 YHR065C
          Length = 506

 Score =  213 bits (542), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 129/376 (34%), Positives = 191/376 (50%), Gaps = 54/376 (14%)

Query: 140 FRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHSAKIGARAMILSPS 199
           + +PTPIQ + IP  L+ +DI+G+A+TGSGKTAAF +P++ KL     +    A I++P+
Sbjct: 106 YEKPTPIQSRAIPPALEGKDIIGLAQTGSGKTAAFAIPILNKL--WEDQQPYYACIMAPT 163

Query: 200 RELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIATPGRFL-HLKVEM 258
           RELA Q  + F        +RSV + GG  + DQ   +M  P +IIATPGR + HL+   
Sbjct: 164 RELAQQIKEQFDSLGALMGVRSVCIVGGMNMMDQARDLMRKPHIIIATPGRLMDHLENTR 223

Query: 259 NLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPT-ARQTLLFSATLPSSLVDFAKAGL 317
              L  ++++V DEADRL ++ F   L+ +L  LPT  R T LFSAT+ S +    +A L
Sbjct: 224 GFSLRKLKFLVMDEADRLLDLEFGPVLDRILKILPTQGRTTYLFSATMTSKIDKLQRASL 283

Query: 318 TNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVATEEQLQRFRXXXX 377
           TNPV   +  + +  + L    + V    +   L+YL+ E +                  
Sbjct: 284 TNPVKCAVSNKYQTVDTLIQTLMVVPGGLKNTYLIYLINEFVG----------------- 326

Query: 378 XXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYVSNLLKDCGYLV 437
                                             S IIF  T+ + E +S L     +  
Sbjct: 327 ---------------------------------KSIIIFTRTKANAERLSLLSNTLEFDA 353

Query: 438 SYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSLPASSKIFVHR 497
             L+G L+Q+ R   L  F+ G  +IL+ TDVAARG+DIP +  V+N  +P  SK ++HR
Sbjct: 354 IALHGDLNQNQRTGALDLFKAGKKSILIATDVAARGLDIPSVDIVINYDIPVDSKSYIHR 413

Query: 498 VGRTARAGNKGWAYTI 513
           VGRTARAG  G + ++
Sbjct: 414 VGRTARAGRSGKSISL 429

>TDEL0G01420 Chr7 (287165..288703) [1539 bp, 512 aa] {ON} Anc_6.204
           YGL078C
          Length = 512

 Score =  205 bits (521), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 125/378 (33%), Positives = 196/378 (51%), Gaps = 50/378 (13%)

Query: 140 FRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHSAKI-GARAMILSP 198
           F +PTPIQ  + P +L  +D++G+A TGSGKT AF +P I KL     K  G + +++SP
Sbjct: 120 FPKPTPIQSVSWPYLLAGKDVIGVAETGSGKTFAFGVPAINKLVTEDGKKKGVQVLVISP 179

Query: 199 SRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIATPGRFLHLKVEM 258
           +RELA Q +       + ++L    + GG    +Q    +    V++ATPGR L L  E 
Sbjct: 180 TRELASQIYDNMILLIEKADLECCCVYGGVPKYEQ-REKLKKAQVVVATPGRLLDLMQEG 238

Query: 259 NLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPT-ARQTLLFSATLPSSLVDFAKAGL 317
           ++DL ++ Y+V DEADR+ E GF+E +  ++ S  T +RQTL+F+AT P  + + A   +
Sbjct: 239 SVDLSNVSYLVLDEADRMLEKGFEEDIKNIIRSTNTSSRQTLMFTATWPKEVRELASTFM 298

Query: 318 TNPVLVRLDTETKVSEN--LEMLFLSVKNDEREANLLYLLQEVIKIPVATEEQLQRFRXX 375
           ++PV V +    ++S N  +  +   +   ++E  LL LL++    P   E+ L      
Sbjct: 299 SDPVKVSIGNRDELSANKRITQVVEVIDQFQKERKLLELLKKYQSGPKKDEKVL------ 352

Query: 376 XXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYVSNLLKDCGY 435
                                                  IF   +     V   LK  GY
Sbjct: 353 ---------------------------------------IFALYKKEATRVERNLKYNGY 373

Query: 436 LVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSLPASSKIFV 495
            V+ ++G L Q  R Q L+ F+ G +N+L+ TDVAARG+DIP +  V+N++ P + + +V
Sbjct: 374 NVAAIHGDLSQQQRSQALNEFKTGASNLLLATDVAARGLDIPNVKTVINLTFPLTVEDYV 433

Query: 496 HRVGRTARAGNKGWAYTI 513
           HR+GRT RAG  G A+T+
Sbjct: 434 HRIGRTGRAGQTGTAHTL 451

>CAGL0H03377g Chr8 complement(313755..315377) [1623 bp, 540 aa] {ON}
           highly similar to uniprot|P20447 Saccharomyces
           cerevisiae YGL078c DBP3
          Length = 540

 Score =  204 bits (518), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 124/378 (32%), Positives = 194/378 (51%), Gaps = 50/378 (13%)

Query: 140 FRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHSAKI-GARAMILSP 198
           F +PTPIQ  + P +L  +D++G+A TGSGKT AF +P I  L   S+K  G + +++SP
Sbjct: 148 FPKPTPIQAVSWPYLLSGKDVIGVAETGSGKTFAFGVPAINNLLTSSSKPKGIKVLVISP 207

Query: 199 SRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIATPGRFLHLKVEM 258
           +RELA Q +       +   +   ++ GG   +DQ    ++  +V++ATPGR L L  E 
Sbjct: 208 TRELASQIYDNLVLLTQKVGIDCCVVYGGVPKDDQ-RRQIAKSNVVVATPGRLLDLIEEG 266

Query: 259 NLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTA-RQTLLFSATLPSSLVDFAKAGL 317
           ++DL  ++Y+V DEADR+ E GF+E +  ++G   +  RQTL+F+AT P  + + A   +
Sbjct: 267 SVDLSPVDYMVLDEADRMLEKGFEEDIKRIIGQTKSKDRQTLMFTATWPKEVRELASTFM 326

Query: 318 TNPVLVRLDTETKVSEN--LEMLFLSVKNDEREANLLYLLQEVIKIPVATEEQLQRFRXX 375
             PV V +    ++S N  +  +   V    +E  LL LL++                  
Sbjct: 327 KEPVKVSIGNRDELSANKRITQIVEVVDPRSKERKLLDLLKKY----------------- 369

Query: 376 XXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYVSNLLKDCGY 435
                                  Q  P   D       +IF   +     V   L   GY
Sbjct: 370 -----------------------QSGPKKND-----KVLIFALYKKEASRVERNLNYNGY 401

Query: 436 LVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSLPASSKIFV 495
            V+ ++G L Q  R Q L+ F+ G +N+L+ TDVAARG+DIP +  V+N++ P + + +V
Sbjct: 402 KVAAIHGDLSQQQRTQALNEFKSGKSNLLLATDVAARGLDIPNVKTVINLTFPLTVEDYV 461

Query: 496 HRVGRTARAGNKGWAYTI 513
           HR+GRT RAG  G A+T+
Sbjct: 462 HRIGRTGRAGQTGTAHTL 479

>ZYRO0G08580g Chr7 complement(695127..696746) [1620 bp, 539 aa] {ON}
           similar to uniprot|P20447 Saccharomyces cerevisiae
           YGL078C DBP3 Putative ATP-dependent RNA helicase of the
           DEAD-box family involved in ribosomal biogenesis
          Length = 539

 Score =  202 bits (513), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 121/379 (31%), Positives = 201/379 (53%), Gaps = 51/379 (13%)

Query: 140 FRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMH--SAKIGARAMILS 197
           F +PTPIQ  + P +L  RD++G+A TGSGKT AF +P I++L  +  + +   + +++S
Sbjct: 146 FPKPTPIQSVSWPYLLSGRDVIGVAETGSGKTFAFGVPAIDQLVSNGDAKRKSVKVLVIS 205

Query: 198 PSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIATPGRFLHLKVE 257
           P+RELA QT+           L    + GG   ++Q + +  N  V++ATPGR L L  E
Sbjct: 206 PTRELASQTYDNLIILTNKVGLECCCVYGGVPKQEQRNQL-RNSQVVVATPGRLLDLINE 264

Query: 258 MNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTA-RQTLLFSATLPSSLVDFAKAG 316
            ++DL  ++Y+V DEADR+ E GF+E +  ++    +  RQTL+F+AT P  + + A   
Sbjct: 265 QSVDLSQVQYLVLDEADRMLEKGFEEDIKNIINQTNSRDRQTLMFTATWPKEVRELASTF 324

Query: 317 LTNPVLVRLDTETKVSEN--LEMLFLSVKNDEREANLLYLLQEVIKIPVATEEQLQRFRX 374
           + +PV V +    ++S N  +  +   ++  +++  LL              E L++++ 
Sbjct: 325 MRDPVKVSIGNRDELSANKRITQIVEVIEPRQKDRKLL--------------ELLRKYQS 370

Query: 375 XXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYVSNLLKDCG 434
                                       + KD    +  +IF   +     V N LK  G
Sbjct: 371 G---------------------------AKKD----DKVLIFALYKKEASRVENNLKYNG 399

Query: 435 YLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSLPASSKIF 494
           Y V+ ++G L Q  R   L++F+ G +N+L+ TDVAARG+DIP +  V+N++ P + + +
Sbjct: 400 YDVAAIHGDLSQQQRTSALNDFKAGKSNLLLATDVAARGLDIPNVKTVINLTFPLTVEDY 459

Query: 495 VHRVGRTARAGNKGWAYTI 513
           VHR+GRT RAG  G A+T+
Sbjct: 460 VHRIGRTGRAGQTGTAHTL 478

>KAFR0B04560 Chr2 complement(947248..947615,948264..949527) [1632
           bp, 543 aa] {ON} Anc_2.164 YNL112W
          Length = 543

 Score =  201 bits (511), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 118/388 (30%), Positives = 197/388 (50%), Gaps = 51/388 (13%)

Query: 130 FILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMH---S 186
           ++L  +  +GF +PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP I  +      S
Sbjct: 120 YVLKEVKAEGFDKPTSIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIVHINAQPLLS 179

Query: 187 AKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIA 246
              G   ++LSP+RELA+Q  K   +F   S +R+  + GG     Q   ++   +++IA
Sbjct: 180 PGDGPIVLVLSPTRELAVQIQKECSKFGHSSRIRNTCVYGGVPKGQQIRDLVRGAEIVIA 239

Query: 247 TPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSATLP 306
           TPGR + +      +L  + Y+V DEADR+ +MGF+ Q+ +++  +   RQTL++SAT P
Sbjct: 240 TPGRLIDMMEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWP 299

Query: 307 SSLVDFAKAGLTNPVLVRLDT-ETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVAT 365
             +   A   L +P+ V++ + E   S N+  L   + + E+   L   L+      +A+
Sbjct: 300 KEVRQLAADYLNDPIQVQVGSLELSASHNITQLVEVLSDFEKRDRLSKHLE------IAS 353

Query: 366 EEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEY 425
           E++  +                                          ++F ST+   + 
Sbjct: 354 EDKDSKI-----------------------------------------LVFASTKRTCDD 372

Query: 426 VSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNM 485
           ++  L+  G+    ++G  DQ  R   L+ FRCG + I+V TDVAARG+D+  +  V+N 
Sbjct: 373 ITKYLRADGWPALAIHGDKDQKERDWVLNEFRCGRSPIMVATDVAARGIDVKGINFVINY 432

Query: 486 SLPASSKIFVHRVGRTARAGNKGWAYTI 513
            +P + + +VHR+GRT RAG KG A + 
Sbjct: 433 DMPGNIEDYVHRIGRTGRAGAKGTAISF 460

>Smik_7.205 Chr7 complement(354693..356261) [1569 bp, 522 aa] {ON}
           YGL078C (REAL)
          Length = 522

 Score =  200 bits (509), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 123/377 (32%), Positives = 191/377 (50%), Gaps = 49/377 (12%)

Query: 140 FRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHSAKIGARAMILSPS 199
           F +PTPIQ    P +L  +D+VG+A TGSGKT AF +P I  L     K G + +++SP+
Sbjct: 131 FPKPTPIQAVAWPYLLSGKDVVGVAETGSGKTFAFGVPAISHLMNDQKKRGIQVLVISPT 190

Query: 200 RELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIATPGRFLHLKVEMN 259
           RELA Q +           ++   + GG   ++Q + +  +  V++ATPGR L L  E +
Sbjct: 191 RELASQIYDNLIILTDKVGMQCCCVYGGVPKDEQRNQLKKS-QVVVATPGRLLDLLQEGS 249

Query: 260 LDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTA-RQTLLFSATLPSSLVDFAKAGLT 318
           +DL  + Y+V DEADR+ E GF+E +  ++     + RQTL+F+AT P  + + A   + 
Sbjct: 250 VDLSQVNYLVLDEADRMLEKGFEEDIKNIIRETNVSKRQTLMFTATWPKEVRELASTFMK 309

Query: 319 NPVLVRLDTETKVSENLEMLFLSVKNDER--EANLLYLLQEVIKIPVATEEQLQRFRXXX 376
           NP+ V +    +++ N ++  +    D R  E  LL LL++    P   E+ L       
Sbjct: 310 NPIKVSIGNTDQLTANKKITQIVEVVDPRAKERKLLELLKKYHSGPKKNEKVL------- 362

Query: 377 XXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYVSNLLKDCGYL 436
                                                 IF   +     V   LK  GY 
Sbjct: 363 --------------------------------------IFALYKKEAARVERNLKYNGYS 384

Query: 437 VSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSLPASSKIFVH 496
           V+ ++G L Q  R Q L+ F+ G +N+L+ TDVAARG+DIP +  V+N++ P + + +VH
Sbjct: 385 VAAIHGDLSQQQRTQALNEFKSGKSNLLLATDVAARGLDIPNVKTVINLTFPLTVEDYVH 444

Query: 497 RVGRTARAGNKGWAYTI 513
           R+GRT RAG  G A+T+
Sbjct: 445 RIGRTGRAGQTGTAHTL 461

>YGL078C Chr7 complement(360288..361859) [1572 bp, 523 aa] {ON}
           DBP3RNA-Dependent ATPase, member of DExD/H-box family;
           involved in cleavage of site A3 within the ITS1 spacer
           during rRNA processing; not essential for growth, but
           deletion causes severe slow-growth phenotype
          Length = 523

 Score =  200 bits (508), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 127/390 (32%), Positives = 194/390 (49%), Gaps = 51/390 (13%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHS 186
           L   I   IS+  F +PTPIQ    P +L  +D+VG+A TGSGKT AF +P I  L    
Sbjct: 121 LDSSIQAEISK--FPKPTPIQAVAWPYLLSGKDVVGVAETGSGKTFAFGVPAISHLMNDQ 178

Query: 187 AKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIA 246
            K G + +++SP+RELA Q +           ++   + GG   ++Q  + +    V++A
Sbjct: 179 KKRGIQVLVISPTRELASQIYDNLIVLTDKVGMQCCCVYGGVPKDEQ-RIQLKKSQVVVA 237

Query: 247 TPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTA-RQTLLFSATL 305
           TPGR L L  E ++DL  + Y+V DEADR+ E GF+E +  ++     + RQTL+F+AT 
Sbjct: 238 TPGRLLDLLQEGSVDLSQVNYLVLDEADRMLEKGFEEDIKNIIRETDASKRQTLMFTATW 297

Query: 306 PSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDER--EANLLYLLQEVIKIPV 363
           P  + + A   + NP+ V +    +++ N  +  +    D R  E  LL LL++    P 
Sbjct: 298 PKEVRELASTFMNNPIKVSIGNTDQLTANKRITQIVEVVDPRGKERKLLELLKKYHSGPK 357

Query: 364 ATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHV 423
             E+ L                                             IF   +   
Sbjct: 358 KNEKVL---------------------------------------------IFALYKKEA 372

Query: 424 EYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVV 483
             V   LK  GY V+ ++G L Q  R Q L+ F+ G +N+L+ TDVAARG+DIP +  V+
Sbjct: 373 ARVERNLKYNGYNVAAIHGDLSQQQRTQALNEFKSGKSNLLLATDVAARGLDIPNVKTVI 432

Query: 484 NMSLPASSKIFVHRVGRTARAGNKGWAYTI 513
           N++ P + + +VHR+GRT RAG  G A+T+
Sbjct: 433 NLTFPLTVEDYVHRIGRTGRAGQTGTAHTL 462

>Kwal_14.1653 s14 complement(406891..408957) [2067 bp, 688 aa] {ON}
           YBR237W (PRP5) - 1:1 [contig 238] PARTIAL
          Length = 688

 Score =  203 bits (517), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 125/383 (32%), Positives = 205/383 (53%), Gaps = 49/383 (12%)

Query: 140 FRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLK----MHSAKIGARAMI 195
           F  PTPIQ + IP I+  RD++G+++TGSGKT +F+LP++ ++K    +   + G   +I
Sbjct: 128 FESPTPIQAQAIPAIMTGRDVIGISKTGSGKTVSFLLPMLRQIKALRPLAREESGPLGLI 187

Query: 196 LSPSRELAMQTHKVFKEFAKG-SNLRSVLLTGGDGLEDQFSMMMSNPDVIIATPGRFLHL 254
           L+P+RELA+Q H+   +F KG + LRS+  TGG  L+ Q + +    ++++ATPGRF+ L
Sbjct: 188 LAPTRELAVQIHEESMKFLKGNTRLRSICCTGGSELKQQINDLKKGVEIVVATPGRFIDL 247

Query: 255 KVEMN----LDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSATLPSSLV 310
            + +N    ++   I +VV DEADRLF++GF+ Q+ E++ ++   +Q +LFSAT PS L 
Sbjct: 248 -LTLNSGKLINTERITFVVMDEADRLFDLGFEPQITEIMKTVRPDKQCVLFSATFPSKLK 306

Query: 311 DFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVATEEQLQ 370
            FA   L  PV + +++++ ++EN+E      +NDE + N L    EV+K  +  E +  
Sbjct: 307 SFASRILHTPVSITINSKSLINENIEQKLQIHENDEEKFNSLL---EVLKAQINREAESH 363

Query: 371 RFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYVSNLL 430
                                             KD      TIIFVS++   + +   L
Sbjct: 364 --------------------------------DDKD----EKTIIFVSSQQICDLIYLKL 387

Query: 431 KDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSLPAS 490
            D  Y    ++     H R   L  F+     IL+ T+V +RG+++P ++ VV  +   +
Sbjct: 388 LDHNYTTYAIHAGKPYHERASNLEKFKNTRNGILLCTEVLSRGLNVPEVSLVVIYNAVKT 447

Query: 491 SKIFVHRVGRTARAGNKGWAYTI 513
              +VH  GRTAR   KG A ++
Sbjct: 448 FAQYVHTTGRTARGDKKGTAISL 470

>Suva_7.192 Chr7 complement(353138..354694) [1557 bp, 518 aa] {ON}
           YGL078C (REAL)
          Length = 518

 Score =  199 bits (506), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 127/390 (32%), Positives = 195/390 (50%), Gaps = 51/390 (13%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHS 186
           L   I   IS+  F +PTPIQ    P +L  +D+VG+A TGSGKT AF +P I  L    
Sbjct: 116 LDSSIQAEISK--FPKPTPIQAVAWPYLLSGKDVVGVAETGSGKTFAFGVPAISHLMNDQ 173

Query: 187 AKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIA 246
            K G + +++SP+RELA Q +           L+   + GG   ++Q + +  +  V++A
Sbjct: 174 KKRGIQVLVISPTRELASQIYDNLIILTDKVGLQCCCVYGGVPKDEQRNQLKKS-QVVVA 232

Query: 247 TPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSL-PTARQTLLFSATL 305
           TPGR L L  E ++DL  + Y+V DE DR+ E GF+E +  ++     + RQTL+F+AT 
Sbjct: 233 TPGRLLDLLQEGSVDLSQVNYLVLDEGDRMLEKGFEEDIKNIIRETDASKRQTLMFTATW 292

Query: 306 PSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDER--EANLLYLLQEVIKIPV 363
           P  + + A + + NP+ V +    +++ N ++  +    D R  E  LL LL++    P 
Sbjct: 293 PKEVRELASSFMKNPIRVSIGNTDQLTANKKITQIVEVVDPRGKERKLLELLKKYHSGPK 352

Query: 364 ATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHV 423
             E+ L                                             IF   +   
Sbjct: 353 KNEKVL---------------------------------------------IFALYKKEA 367

Query: 424 EYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVV 483
             V   LK  GY V+ ++G L Q  R Q L  F+ G +N+L+ TDVAARG+DIP +  V+
Sbjct: 368 TRVERNLKYNGYNVAAIHGDLSQQQRTQALSEFKSGKSNLLLATDVAARGLDIPNVKTVI 427

Query: 484 NMSLPASSKIFVHRVGRTARAGNKGWAYTI 513
           N++ P + + +VHR+GRT RAG  G A+T+
Sbjct: 428 NLTFPLTVEDYVHRIGRTGRAGQTGTAHTL 457

>Skud_7.204 Chr7 complement(363553..365103) [1551 bp, 516 aa] {ON}
           YGL078C (REAL)
          Length = 516

 Score =  199 bits (505), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 127/390 (32%), Positives = 196/390 (50%), Gaps = 51/390 (13%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHS 186
           L+  I   IS+  F  PTPIQ    P +L  +D+VG+A TGSGKT AF +P I  L    
Sbjct: 114 LNPSIQAEISK--FPTPTPIQAVAWPYLLSGKDVVGVAETGSGKTFAFGVPAISHLMNDQ 171

Query: 187 AKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIA 246
            K G + +++SP+RELA Q +           ++   + GG   ++Q + +  +  V++A
Sbjct: 172 GKRGIQVLVISPTRELASQIYDNLIILTDKVGMQCCCVYGGVPKDEQRNQLKRS-QVVVA 230

Query: 247 TPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTA-RQTLLFSATL 305
           TPGR L L  E ++DL  + Y+V DEADR+ E GF+E +  ++     + RQTL+F+AT 
Sbjct: 231 TPGRLLDLLQEGSVDLSQVNYLVLDEADRMLEKGFEEDIRNIIRETDASKRQTLMFTATW 290

Query: 306 PSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDER--EANLLYLLQEVIKIPV 363
           P  + + A   + NP+ V +    +++ N ++  +    D R  E  LL LL++    P 
Sbjct: 291 PKEVRELASTFMKNPIKVSIGNTDQLTANKKITQIVEVVDPRGKERKLLELLKKYHSGPK 350

Query: 364 ATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHV 423
             E+ L                                             IF   +   
Sbjct: 351 KNEKVL---------------------------------------------IFALYKKEA 365

Query: 424 EYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVV 483
             V   LK  GY V+ ++G L Q  R Q L+ F+ G +N+L+ TDVAARG+DIP +  V+
Sbjct: 366 TRVERNLKYNGYDVAAIHGDLSQQQRTQALNEFKSGKSNLLLATDVAARGLDIPNVKTVI 425

Query: 484 NMSLPASSKIFVHRVGRTARAGNKGWAYTI 513
           N++ P + + +VHR+GRT RAG  G A+T+
Sbjct: 426 NLTFPLTVEDYVHRIGRTGRAGQTGTAHTL 455

>CAGL0L03846g Chr12 complement(443677..444047,445148..446411) [1635
           bp, 544 aa] {ON} highly similar to uniprot|P24783
           Saccharomyces cerevisiae YNL112w DBP2 ATP-dependent RNA
           helicase of DEAD box family
          Length = 544

 Score =  198 bits (503), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 118/387 (30%), Positives = 196/387 (50%), Gaps = 51/387 (13%)

Query: 130 FILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMH---S 186
           ++L  +  +GF +PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP I  +      S
Sbjct: 120 YVLKEVKAEGFDKPTSIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIVHINAQPLLS 179

Query: 187 AKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIA 246
              G   ++L+P+RELA+Q  K   +F K S +R+  + GG     Q   ++   +++IA
Sbjct: 180 PGDGPIVLVLAPTRELAVQIQKECSKFGKSSRIRNTCVYGGVPRGQQIRELIRGAEIVIA 239

Query: 247 TPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSATLP 306
           TPGR + +      +L  + Y+V DEADR+ +MGF+ Q+ +++  +   RQTL++SAT P
Sbjct: 240 TPGRLIDMLEAGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWP 299

Query: 307 SSLVDFAKAGLTNPVLVRLDT-ETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVAT 365
             +   A+  L +P+ V++ + E   S N+  L   V   E+   L+  L        A+
Sbjct: 300 KEVQQLARDYLNDPIQVQIGSLELAASHNITQLVEVVSEFEKRDRLVKHLD------TAS 353

Query: 366 EEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEY 425
           +++  +                                          +IF ST+   + 
Sbjct: 354 QDKESKI-----------------------------------------LIFASTKRTCDE 372

Query: 426 VSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNM 485
           +++ L+  G+    ++G  DQ  R   L+ FR G + I+V TDVAARG+D+  +  VVN 
Sbjct: 373 ITSYLRQDGWPALAIHGDKDQRERDWVLNEFRTGNSPIMVATDVAARGIDVKGINFVVNY 432

Query: 486 SLPASSKIFVHRVGRTARAGNKGWAYT 512
            +P + + +VHR+GRT RAG  G A +
Sbjct: 433 DMPGNIEDYVHRIGRTGRAGATGTAIS 459

>TDEL0B04060 Chr2 complement(724075..726618) [2544 bp, 847 aa] {ON}
           Anc_6.148 YBR237W
          Length = 847

 Score =  201 bits (512), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 124/394 (31%), Positives = 212/394 (53%), Gaps = 47/394 (11%)

Query: 130 FILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLK----MH 185
           FI+ N+    +  PTPIQ + IP I+  RD++G++RTGSGKT +++LPL+ ++K    + 
Sbjct: 271 FIMHNLK---YDSPTPIQSQAIPAIMSGRDVIGISRTGSGKTISYLLPLLRQIKAQRPLA 327

Query: 186 SAKIGARAMILSPSRELAMQTHKVFKEFAKGS-NLRSVLLTGGDGLEDQFSMMMSNPDVI 244
           + + G   +IL+P+RELA+Q H+  + F K    + S+  TGG  L+ Q +M+    +++
Sbjct: 328 TNETGPLGLILAPTRELALQIHEEVELFTKNDLAVNSLCCTGGSELKQQINMLKRGTEIV 387

Query: 245 IATPGRFLHLKVEMN----LDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLL 300
           +ATPGRF+ L + +N    L    I +VV DEADRLF++GF+ Q+ +++ ++   +Q +L
Sbjct: 388 VATPGRFIDL-LTLNTGKLLTTKRITFVVLDEADRLFDLGFEPQITQIMKTIRPDKQCVL 446

Query: 301 FSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREAN-LLYLLQEVI 359
           FSAT P+ L  FA   L  P+ + ++++  V+EN++  F     DE +   LL +L + +
Sbjct: 447 FSATFPNKLRSFAMRVLRLPLSITINSKNLVNENVKQRFEIFPTDENKYRALLSILDKRM 506

Query: 360 KIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVST 419
           K     EE                                    A D  + +  IIFVS+
Sbjct: 507 KEEDENEESE---------------------------------LADDEVNDDKAIIFVSS 533

Query: 420 RHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLL 479
           +   +++   L++ GY +  ++       R   L NFR    +IL+ T+V +RG+++P +
Sbjct: 534 QQICDFLGTRLENEGYSIHTIHAGKPYQERVNNLQNFRHTRNSILLCTEVLSRGLNVPEV 593

Query: 480 ANVVNMSLPASSKIFVHRVGRTARAGNKGWAYTI 513
           + V+  +   +   +VH  GRTAR  N G A T+
Sbjct: 594 SLVIIYNAVKTFAQYVHTAGRTARGTNSGEAITL 627

>KLLA0F01034g Chr6 (93422..95305) [1884 bp, 627 aa] {ON} similar to
           uniprot|P06634 Saccharomyces cerevisiae YOR204W DED1
           ATP-dependent DEAD (Asp-Glu-Ala-Asp)-box RNA helicase
           required for translation initiation of all yeast mRNAs
          Length = 627

 Score =  197 bits (502), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 128/404 (31%), Positives = 202/404 (50%), Gaps = 67/404 (16%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLI-EKLKMH 185
           L   +L NI    F +PTP+Q+ ++P++   RD++  A+TGSGKT  F+ P++ E     
Sbjct: 166 LDPLLLDNIKLARFTKPTPVQKYSVPIVAAGRDLMACAQTGSGKTGGFLFPVLSESFSSG 225

Query: 186 SA------------KIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQ 233
            A            K+   A+IL+P+RELA Q +   K+F   S ++ +++ GG  +++Q
Sbjct: 226 PASTPEAAGNSYIKKVYPTAVILAPTRELATQIYDEAKKFTYRSWVKPMVVYGGASIDNQ 285

Query: 234 FSMMMSNPDVIIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELL-GS- 291
              M    ++++ATPGR   L     + L +++Y+V DEADR+ +MGF+ Q+  ++ GS 
Sbjct: 286 IKQMRYGCNLLVATPGRLTDLLERRYISLANVKYLVLDEADRMLDMGFEPQIRRIVEGSD 345

Query: 292 LPTA--RQTLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREA 349
           +P+   RQTL+FSAT PS +   A   L + V + +      SEN+    L V++ ++  
Sbjct: 346 MPSVDNRQTLMFSATFPSEIQHLASDFLKDYVFLSVGRVGSTSENITQKILYVEDFDKND 405

Query: 350 NLLYLLQEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPS 409
            LL LL        A+ E L                                        
Sbjct: 406 TLLDLL-------AASNEGL---------------------------------------- 418

Query: 410 PNSTIIFVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDV 469
              T+IFV T+   + +++ L   G+  + ++G   Q  R + L  F+ G   ILV T V
Sbjct: 419 ---TLIFVETKRAADSLTDFLIMEGFKATAIHGDRTQGERERALSAFKTGRATILVATAV 475

Query: 470 AARGVDIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWAYTI 513
           AARG+DIP + +V+N  LP     +VHR+GRT RAGN G A T 
Sbjct: 476 AARGLDIPNVTHVINFDLPNDIDDYVHRIGRTGRAGNTGVATTF 519

>NCAS0G02560 Chr7 (457574..458852,459621..460012) [1671 bp, 556 aa]
           {ON} Anc_2.164
          Length = 556

 Score =  195 bits (496), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 117/388 (30%), Positives = 193/388 (49%), Gaps = 51/388 (13%)

Query: 130 FILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMH---S 186
           ++L  +  +GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I  +      +
Sbjct: 125 YVLNEVKAEGFDKPTGIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIVHINAQPLLA 184

Query: 187 AKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIA 246
              G   ++L+P+RELA+Q  K   +F   S +R+  + GG     Q   +    +++IA
Sbjct: 185 PGDGPIVLVLAPTRELAVQIQKECSKFGHSSRIRNTCVYGGVPRGQQIRDLSRGSEIVIA 244

Query: 247 TPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSATLP 306
           TPGR + +      +L  + Y+V DEADR+ +MGF+ Q+ +++  +   RQTL++SAT P
Sbjct: 245 TPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWP 304

Query: 307 SSLVDFAKAGLTNPVLVRLDT-ETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVAT 365
             +   A   L +P+ V++ + E   S N+  L   V   E+   LL  L+       A+
Sbjct: 305 KEVKQLASDYLNDPIQVQIGSLELSASHNITQLVEVVSEFEKRDRLLKHLE------TAS 358

Query: 366 EEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEY 425
           ++Q  +                                          +IF ST+   + 
Sbjct: 359 QDQESKI-----------------------------------------LIFASTKRTCDE 377

Query: 426 VSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNM 485
           V+  L++ G+    ++G  DQ  R   L  FR G + I+V TDVAARG+D+  +  V+N 
Sbjct: 378 VTKYLREDGWPALAIHGDKDQRERDWVLEEFRSGRSPIMVATDVAARGIDVKGINYVINY 437

Query: 486 SLPASSKIFVHRVGRTARAGNKGWAYTI 513
            +P + + +VHR+GRT RAG  G A + 
Sbjct: 438 DMPGNIEDYVHRIGRTGRAGATGTAISF 465

>ZYRO0B09856g Chr2 complement(769104..769462,770138..771401) [1623
           bp, 540 aa] {ON} similar to uniprot|P24783 Saccharomyces
           cerevisiae YNL112W DBP2 Essential ATP-dependent RNA
           helicase of the DEAD-box protein family involved in
           nonsense-mediated mRNA decay and rRNA processing
          Length = 540

 Score =  195 bits (495), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 116/388 (29%), Positives = 199/388 (51%), Gaps = 53/388 (13%)

Query: 130 FILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMH---S 186
           ++L  +  +GF  PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP I  +      +
Sbjct: 120 YVLKEVKAEGFAAPTGIQCQGWPMALSGRDMVGVAATGSGKTLSYCLPAIVHINAQPLLA 179

Query: 187 AKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIA 246
              G   ++L+P+RELA+Q  K   +F + S +R+  + GG     Q   +    +++IA
Sbjct: 180 PGDGPVVLVLAPTRELAVQIQKECSKFGRSSRIRNTCVYGGVPRGQQIRDLARGAEIVIA 239

Query: 247 TPGRFLHLKVEMN-LDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSATL 305
           TPGR + + +E+N  +L  + Y+V DEADR+ +MGF+ Q+ +++  +   RQTL++SAT 
Sbjct: 240 TPGRLIDM-LEINKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATW 298

Query: 306 PSSLVDFAKAGLTNPVLVRLDT-ETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVA 364
           P  +   A+  LT+P+ V++ + E   S  ++ +   +   E+   L   L+      +A
Sbjct: 299 PKEVKQLARDYLTDPIQVQIGSLELSASHTIKQVVEVISEFEKRDRLSKHLE------IA 352

Query: 365 TEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVE 424
           +E+Q                                          +  ++F ST+   +
Sbjct: 353 SEDQ-----------------------------------------DSKVLVFASTKRTCD 371

Query: 425 YVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVN 484
            ++  L+  G+    ++G  DQ  R   L  F+ G + I+V TDVAARG+D+  +  V+N
Sbjct: 372 DITQYLRQDGWSALAIHGDKDQRERDWVLEEFKNGRSPIMVATDVAARGIDVKGINYVIN 431

Query: 485 MSLPASSKIFVHRVGRTARAGNKGWAYT 512
             +P + + +VHR+GRT RAG KG A +
Sbjct: 432 YDMPGNIEDYVHRIGRTGRAGAKGTAIS 459

>NCAS0D03740 Chr4 complement(694809..696368) [1560 bp, 519 aa] {ON}
           Anc_6.204
          Length = 519

 Score =  194 bits (493), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 118/378 (31%), Positives = 191/378 (50%), Gaps = 53/378 (14%)

Query: 140 FRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHSAKI-GARAMILSP 198
           F +PTPIQ  + P +L  +D++G+A TGSGKT AF +P I  L +++ K  G + +++SP
Sbjct: 130 FPKPTPIQAVSWPYLLSGKDVIGVAETGSGKTFAFGVPAINYLVLNNGKSKGVQVLVISP 189

Query: 199 SRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIATPGRFLHLKVEM 258
           +RELA Q +           L    + GG   + Q + +  +  V++ATPGR L L  E 
Sbjct: 190 TRELASQIYDNLIVLTDKVGLECCCVYGGVPKDAQRAQLRRS-QVVVATPGRLLDLIQEG 248

Query: 259 NLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTA-RQTLLFSATLPSSLVDFAKAGL 317
           ++DL +++Y+V DEADR+ E GF+E +  ++    T  RQTL+F+AT P  + + A + +
Sbjct: 249 SVDLSAVKYLVLDEADRMLEKGFEEDIKNIIRETATKDRQTLMFTATWPKEVRELASSFM 308

Query: 318 TNPVLVRLDTETKVSEN--LEMLFLSVKNDEREANLLYLLQEVIKIPVATEEQLQRFRXX 375
             PV V +    ++S N  +  +   ++   ++  LL LL+                   
Sbjct: 309 NKPVKVSIGNRDELSANKRITQIVEVIEPQRKDRKLLELLK------------------- 349

Query: 376 XXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYVSNLLKDCGY 435
                                        K        +IF   +     V   L+  GY
Sbjct: 350 -----------------------------KYHSKKEKVLIFALYKKEAARVERTLRYNGY 380

Query: 436 LVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSLPASSKIFV 495
            V+ ++G L Q  R + L  F+ G +N+L+ TDVAARG+DIP +  V+N++ P + + +V
Sbjct: 381 DVAAIHGDLSQEQRTKALGEFKSGKSNLLLATDVAARGLDIPNVKTVINLTFPLTVEDYV 440

Query: 496 HRVGRTARAGNKGWAYTI 513
           HR+GRT RAG  G A+T+
Sbjct: 441 HRIGRTGRAGQTGTAHTL 458

>NDAI0I01150 Chr9 (278832..280403) [1572 bp, 523 aa] {ON} Anc_6.204
          Length = 523

 Score =  194 bits (493), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 121/385 (31%), Positives = 195/385 (50%), Gaps = 59/385 (15%)

Query: 140 FRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKL--------KMHSAKIGA 191
           F +PTPIQ  + P +L  +D++G+A TGSGKT AF +P I+ L        K +S   G 
Sbjct: 126 FPKPTPIQAVSWPYLLSGKDVIGVAETGSGKTFAFGVPAIDYLVKTNQSNNKKNSG--GI 183

Query: 192 RAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIATPGRF 251
           + +++SP+RELA Q +       +   L+   + GG   E Q  + +    V++ATPGR 
Sbjct: 184 QVLVISPTRELASQIYDNLIILTEKVGLQCCCVYGGVPKEAQ-RIQLKKSQVVVATPGRL 242

Query: 252 LHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELL-GSLPTARQTLLFSATLPSSLV 310
           L L  E +++L +++Y+V DEADR+ E GF+E +  ++  + P  RQTL+F+AT P  + 
Sbjct: 243 LDLIQEGSVNLSAVKYLVLDEADRMLEKGFEEDIKNIIRETSPKGRQTLMFTATWPKEVR 302

Query: 311 DFAKAGLTNPVLVRLDTETKVSEN--LEMLFLSVKNDEREANLLYLLQEVIKIPVATEEQ 368
           + A + +  PV V +    +++ N  +  +   +    ++  LL LL++    P   ++ 
Sbjct: 303 ELASSFMNEPVKVSIGNRDELTANKRITQIVEVIDPQRKDRKLLDLLKKYHSGPTKNDKV 362

Query: 369 LQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYVSN 428
           L                                             IF   +     V  
Sbjct: 363 L---------------------------------------------IFALYKKEAARVER 377

Query: 429 LLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSLP 488
            LK  GY V+ ++G L Q  R + L  F+ G TN+L+ TDVAARG+DIP +  V+N++ P
Sbjct: 378 NLKYNGYEVAAIHGDLSQEQRTRALGEFKAGKTNLLLATDVAARGLDIPNVKTVINLTFP 437

Query: 489 ASSKIFVHRVGRTARAGNKGWAYTI 513
            + + +VHR+GRT RAG  G A+T+
Sbjct: 438 LTVEDYVHRIGRTGRAGQTGTAHTL 462

>NCAS0C01720 Chr3 complement(317951..319873) [1923 bp, 640 aa] {ON}
           Anc_2.164 YNL112W
          Length = 640

 Score =  197 bits (500), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 128/401 (31%), Positives = 200/401 (49%), Gaps = 67/401 (16%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLI-EKLK-- 183
           L + +L NI    F +PTP+Q+ ++P++   RD++  A+TGSGKT  F+ P++ E  K  
Sbjct: 176 LDELLLENIKLARFTKPTPVQKYSVPIVENGRDLMACAQTGSGKTGGFLFPVLSESFKTG 235

Query: 184 ----------MHSAKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQ 233
                      +S K    A+IL+P+RELA Q     K+F   S +R  ++ GG  + +Q
Sbjct: 236 PSKTPEQGRNFYSKKGYPTALILAPTRELATQIFDEAKKFTYRSWVRPCVVYGGAPIGNQ 295

Query: 234 FSMMMSNPDVIIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELL-GS- 291
              +    D+++ATPGR   L     + L +I Y+V DEADR+ +MGF+ Q+ +++ GS 
Sbjct: 296 MREVDHGCDLLVATPGRLTDLIDRGKISLANIRYLVLDEADRMLDMGFEPQIRQIVEGSD 355

Query: 292 LPTA--RQTLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREA 349
           +P    RQTL+FSAT P  +   A+  L + + + +      SEN+  + L V++ ++ +
Sbjct: 356 MPQVGDRQTLMFSATFPVDIQQLARDFLNDYIFLSVGRVGSTSENITQVILYVEDQDKYS 415

Query: 350 NLLYLLQEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPS 409
            LL LL        AT + L                                        
Sbjct: 416 ALLDLL-------AATTDGL---------------------------------------- 428

Query: 410 PNSTIIFVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDV 469
              T+IFV T+   + +++ L    +  + ++G   Q  R + L  FR G   ILV T V
Sbjct: 429 ---TLIFVETKRMADQLTDFLIMQNFKATAIHGDRTQQERERALSAFRAGTATILVATAV 485

Query: 470 AARGVDIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWA 510
           AARG+DIP + +V+N  LP     +VHR+GRT RAGN G A
Sbjct: 486 AARGLDIPNVTHVINFDLPGDIDDYVHRIGRTGRAGNTGVA 526

>NDAI0F02740 Chr6 complement(670654..671051,672039..673326) [1686
           bp, 561 aa] {ON} 
          Length = 561

 Score =  195 bits (495), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 117/388 (30%), Positives = 194/388 (50%), Gaps = 51/388 (13%)

Query: 130 FILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMH---S 186
           ++L  +  +GF  PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I  +      S
Sbjct: 128 YVLKEVKAEGFDAPTGIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIVHINAQPLLS 187

Query: 187 AKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIA 246
              G   ++L+P+RELA+Q  K   +F   S +R+  + GG     Q   +    +++IA
Sbjct: 188 PGDGPIVLVLAPTRELAVQIQKECSKFGHSSRIRNTCVYGGVPRGQQIRDLSRGSEIVIA 247

Query: 247 TPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSATLP 306
           TPGR + +      +L  + Y+V DEADR+ +MGF+ Q+ +++  +   RQTL++SAT P
Sbjct: 248 TPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWP 307

Query: 307 SSLVDFAKAGLTNPVLVRLDT-ETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVAT 365
             +   A   L +P+ V++ + E   S N+  L   +   E+   LL  L+       A+
Sbjct: 308 KEVQQLASDYLNDPIQVQVGSLELSASHNIAQLVEVLSEFEKRDRLLKHLE------TAS 361

Query: 366 EEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEY 425
           E++  +                                          +IF ST+   + 
Sbjct: 362 EDKESKI-----------------------------------------LIFASTKRMCDE 380

Query: 426 VSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNM 485
           ++ +L++ G+    ++G  DQ  R   L  FR G + I+V TDVAARG+D+  +  V+N 
Sbjct: 381 ITKMLREDGWPALAIHGDKDQRERDWVLGEFRAGNSPIMVATDVAARGIDVKGINFVINY 440

Query: 486 SLPASSKIFVHRVGRTARAGNKGWAYTI 513
            +P + + +VHR+GRT RAG KG A + 
Sbjct: 441 DMPGNIEDYVHRIGRTGRAGAKGTAISF 468

>TBLA0C05580 Chr3 (1351338..1352610,1353450..1353799) [1623 bp, 540
           aa] {ON} Anc_2.164 YNL112W
          Length = 540

 Score =  194 bits (493), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 114/387 (29%), Positives = 196/387 (50%), Gaps = 51/387 (13%)

Query: 130 FILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMH---S 186
           ++L  +  +GF  PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP I  +      +
Sbjct: 123 YVLNEVKAEGFANPTAIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIVHINAQPLLA 182

Query: 187 AKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIA 246
              G   ++LSP+RELA+Q  K   +F K S +R+  + GG     Q   +    +++IA
Sbjct: 183 PGDGPIVLVLSPTRELAVQIQKECSKFGKSSRIRNTCVYGGVPKGQQIRDLSRGSEIVIA 242

Query: 247 TPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSATLP 306
           TPGR + +      +L  + Y+V DEADR+ +MGF+ Q+ +++  +   RQTL++SAT P
Sbjct: 243 TPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWP 302

Query: 307 SSLVDFAKAGLTNPVLVRLDT-ETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVAT 365
             + + A+  L +P+ V++ + E   S  +  L   + + E+   ++  L+      VA+
Sbjct: 303 KEVQNLARDYLNDPIQVQIGSLELAASHTITQLVEVITDFEKRDRMVKHLE------VAS 356

Query: 366 EEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEY 425
           +++  +                                          ++F ST+   + 
Sbjct: 357 QDKESKI-----------------------------------------LVFASTKRTCDE 375

Query: 426 VSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNM 485
           ++  L++ G+    ++G  DQ  R   L  FR G + I+V TDVAARG+D+  +  V+N 
Sbjct: 376 ITKYLREDGWPALAIHGDKDQRERDWVLAEFREGRSPIMVATDVAARGIDVKGINYVINY 435

Query: 486 SLPASSKIFVHRVGRTARAGNKGWAYT 512
            +P + + +VHR+GRT RAG  G A +
Sbjct: 436 DMPGNIEDYVHRIGRTGRAGATGTAIS 462

>KNAG0F02050 Chr6 (392126..393727) [1602 bp, 533 aa] {ON} Anc_6.204
           YGL078C
          Length = 533

 Score =  194 bits (492), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 120/378 (31%), Positives = 193/378 (51%), Gaps = 50/378 (13%)

Query: 140 FRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHSAKI-GARAMILSP 198
           F +PTPIQ  + P +L  +D++G+A TGSGKT AF +P +  +   S  + G +A+I+SP
Sbjct: 141 FPKPTPIQSVSWPYLLSGKDVIGVAETGSGKTLAFGVPAVNHIIETSKTVSGIQALIISP 200

Query: 199 SRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIATPGRFLHLKVEM 258
           +RELA Q +           L    + GG   ++Q  M +    +++ATPGR L L  E 
Sbjct: 201 TRELASQIYDNLIPLTDKVGLECCCVYGGVPKDEQ-RMKLRKCHIVVATPGRLLDLLQEG 259

Query: 259 NLDLHSIEYVVFDEADRLFEMGFQEQLNELL-GSLPTARQTLLFSATLPSSLVDFAKAGL 317
           +++L  + Y+V DEADR+ E GF+E +  ++  + P  RQTL+F+AT P  + + A   +
Sbjct: 260 SVNLSKVNYLVLDEADRMLEKGFEEDIKNIIRETAPHGRQTLMFTATWPKEVRELAATFM 319

Query: 318 TNPVLVRLDTETKVSEN--LEMLFLSVKNDEREANLLYLLQEVIKIPVATEEQLQRFRXX 375
             PV V +    ++S N  ++ +   V+   ++  LL L              L++++  
Sbjct: 320 NQPVKVSIGNRDELSANKRIKQIVEVVEQRSKDRKLLDL--------------LKKYQSG 365

Query: 376 XXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYVSNLLKDCGY 435
                                      + KD       +IF   +     V   LK  GY
Sbjct: 366 ---------------------------AKKD----EKVLIFALYKKEAARVERNLKYNGY 394

Query: 436 LVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSLPASSKIFV 495
            V  ++G L Q  R   L+ F+ G +N+L+ TDVAARG+DIP +  V+N++ P + + +V
Sbjct: 395 NVVAIHGDLTQQQRTHALNEFKTGSSNLLLATDVAARGLDIPNVKTVINLTFPLTVEDYV 454

Query: 496 HRVGRTARAGNKGWAYTI 513
           HR+GRT RAG  G A+T+
Sbjct: 455 HRIGRTGRAGQTGVAHTL 472

>TPHA0B02850 Chr2 complement(650888..652774) [1887 bp, 628 aa] {ON}
           Anc_8.614 YOR204W
          Length = 628

 Score =  196 bits (497), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 125/404 (30%), Positives = 202/404 (50%), Gaps = 67/404 (16%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLI------- 179
           L   +L NI    F +PTP+Q+ ++P++ Q RD++  A+TGSGKT  F+ P++       
Sbjct: 162 LDSLLLENIHLARFTKPTPVQKYSVPIVAQGRDLMACAQTGSGKTGGFLFPVLSQSFKNG 221

Query: 180 -----EKLKMHSAKIG-ARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQ 233
                E LK    + G   A++L+P+RELA Q +   K+F   S +R V++ GG  +  Q
Sbjct: 222 PAPVPEDLKRSFLRKGNPTALVLAPTRELATQIYDEAKKFTYRSWVRPVVIYGGSDVGTQ 281

Query: 234 FSMMMSNPDVIIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGS-- 291
              +    D+++ATPGR   L     + L +++Y+V DEADR+ +MGF+ Q+  ++    
Sbjct: 282 IRELERGCDLLVATPGRLNDLLERGRVSLANVKYLVLDEADRMLDMGFEPQIRHIVDGCD 341

Query: 292 LPTA--RQTLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREA 349
           +P A  RQTL+FSAT P  +   A+  L + + + +      SEN+    L V++ ++++
Sbjct: 342 MPDANNRQTLMFSATFPDDIQHLARDFLNDYIFLSVGRVGSTSENITQRILYVEDMDKKS 401

Query: 350 NLLYLLQEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPS 409
            LL LL        A  + L                                        
Sbjct: 402 ALLDLL-------AAENDGL---------------------------------------- 414

Query: 410 PNSTIIFVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDV 469
              T+IFV T+   + +++ L    ++ + ++G   Q  R + L  F+ G  N+LV T V
Sbjct: 415 ---TLIFVETKRMADELTDFLIMQDFMATAIHGDRTQIERERALAAFKGGRANVLVATAV 471

Query: 470 AARGVDIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWAYTI 513
           AARG+DIP + +V+N  LP     +VHR+GRT RAGN G A + 
Sbjct: 472 AARGLDIPNVTHVINYDLPTDIDDYVHRIGRTGRAGNTGVATSF 515

>Suva_16.191 Chr16 complement(333913..335769) [1857 bp, 618 aa] {ON}
           YPL119C (REAL)
          Length = 618

 Score =  195 bits (496), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 123/404 (30%), Positives = 200/404 (49%), Gaps = 67/404 (16%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKL---- 182
           L   +L NI   GF +PTP+Q+ ++P++   RD++  A+TGSGKT  F+ P+  +L    
Sbjct: 159 LDALLLENIKLAGFNKPTPVQKYSVPIVTNNRDLMACAQTGSGKTGGFLFPVFTELFHSG 218

Query: 183 ---------KMHSAKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQ 233
                      +S K    A++L+P+RELA Q  +  ++F   S +R  ++ GG  + +Q
Sbjct: 219 PSPAPEKAQSFYSRKGYPSALVLAPTRELATQIFEEARKFTYRSWVRPCVVYGGAPIGNQ 278

Query: 234 FSMMMSNPDVIIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELL--GS 291
              +    D+++ATPGR   L     + L +I+Y+V DEADR+ +MGF+ Q+  ++    
Sbjct: 279 MREVDRGCDLLVATPGRLNDLLERGKISLANIKYLVLDEADRMLDMGFEPQIRHIVEECD 338

Query: 292 LPTA--RQTLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREA 349
           +P+   RQTL+FSAT P  +   A+  L N + + +      SEN+    L V + ++++
Sbjct: 339 MPSVGNRQTLMFSATFPVDIQHLARDFLDNYIFLSVGRVGSTSENITQRILYVDDMDKKS 398

Query: 350 NLLYLLQEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPS 409
            LL LL        A  E L                                        
Sbjct: 399 ALLDLLS-------AEHEGL---------------------------------------- 411

Query: 410 PNSTIIFVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDV 469
              T+IFV T+   + +++ L    +  + ++G   Q  R + L  F+  + +ILV T V
Sbjct: 412 ---TLIFVETKRMADQLTDFLIMQNFRATAIHGDRTQAERERALSAFKSNVADILVATAV 468

Query: 470 AARGVDIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWAYTI 513
           AARG+DIP + +V+N  LP+    +VHR+GRT RAGN G A + 
Sbjct: 469 AARGLDIPNVTHVINYDLPSDIDDYVHRIGRTGRAGNTGVATSF 512

>NDAI0F02010 Chr6 (492540..495206) [2667 bp, 888 aa] {ON} Anc_6.148
          Length = 888

 Score =  199 bits (506), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 116/384 (30%), Positives = 207/384 (53%), Gaps = 39/384 (10%)

Query: 139 GFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHSA----KIGARAM 194
           GFR  TPIQ + IP I+   D++G+++TGSGKT +++LPLI  +K  +     + G   +
Sbjct: 306 GFRSLTPIQSQAIPAIMDGHDVIGISKTGSGKTISYLLPLIRHIKAQNPLMKNETGPLGL 365

Query: 195 ILSPSRELAMQTHK-VFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIATPGRFLH 253
           IL+P+RELA+Q H+ + K  +  + + S+  TGG  L+ Q + +     +++ATPGR + 
Sbjct: 366 ILAPTRELALQIHQEIIKFISTDTAITSICCTGGSELKQQINSLKKGVHIVVATPGRLID 425

Query: 254 LKVEMNLDLHSIE---YVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSATLPSSLV 310
           L    N  L SI+   +V+ DEADRLF++GF+ Q+ +++ ++   +Q +LFSAT P+ L 
Sbjct: 426 LLTLNNGRLMSIKRVTFVIMDEADRLFDLGFEPQITQIMKTIRPDKQCVLFSATFPNKLR 485

Query: 311 DFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREAN-LLYLLQEVIKIPVATEEQL 369
           +FA   L +P+ + +++++ V+E ++  F    NDE + + LL +++E    P+ T +  
Sbjct: 486 NFAMRILRDPLSITINSQSLVNERVQQRFHICANDEEKFDELLAMIEENSSEPIETTDLG 545

Query: 370 QRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYVSNL 429
           +                                  +  P    TIIFV+++   +++   
Sbjct: 546 KE------------------------------EEEEHTPQDRKTIIFVASQQICDFIGTK 575

Query: 430 LKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSLPA 489
           L++ GY    ++       R Q L NF+    +ILV T+V +RG++I  ++ V+  +   
Sbjct: 576 LENEGYQPFSIHAGKSYQERVQNLENFKSTKNSILVATEVLSRGLNITEVSLVIIFNAVK 635

Query: 490 SSKIFVHRVGRTARAGNKGWAYTI 513
           +   +VH  GRTAR  + G A ++
Sbjct: 636 TFAQYVHTTGRTARGNHSGVAISL 659

>TDEL0F01190 Chr6 (211677..212937,213454..213842) [1650 bp, 549 aa]
           {ON} Anc_2.164 YNL112W
          Length = 549

 Score =  193 bits (491), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 112/387 (28%), Positives = 196/387 (50%), Gaps = 51/387 (13%)

Query: 130 FILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMH---S 186
           ++L  +  +GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I  +      +
Sbjct: 119 YVLKEVKAEGFDKPTGIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPSIVHINAQPLLA 178

Query: 187 AKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIA 246
              G   ++L+P+RELA+Q  K   +F K S +R+  + GG     Q   +    +++IA
Sbjct: 179 PGDGPIVLVLAPTRELAVQIQKECSKFGKSSRIRNTCVYGGVPRGQQIRDLARGAEIVIA 238

Query: 247 TPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSATLP 306
           TPGR + +      +L  + Y+V DEADR+ +MGF+ Q+ +++  +   RQTL++SAT P
Sbjct: 239 TPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWP 298

Query: 307 SSLVDFAKAGLTNPVLVRLDT-ETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVAT 365
             +   A   L +P+ V++ + E   S N++ +   + + E+   L   +       +A+
Sbjct: 299 KEVKQLASDYLHDPIQVQIGSLELAASHNIKQVVEVITDFEKRDRLTKHMD------IAS 352

Query: 366 EEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEY 425
           +++  +                                          ++F ST+   + 
Sbjct: 353 QDKESKI-----------------------------------------LVFASTKRTCDE 371

Query: 426 VSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNM 485
           ++  L+D G+    ++G  DQ  R   L+ FR G + I+V TDVAARG+D+  +  V+N 
Sbjct: 372 ITKYLRDDGWPALAIHGDKDQRERDWVLNEFRTGRSPIMVATDVAARGIDVKGINYVINY 431

Query: 486 SLPASSKIFVHRVGRTARAGNKGWAYT 512
            +P + + +VHR+GRT RAG  G A +
Sbjct: 432 DMPGNIEDYVHRIGRTGRAGATGTAIS 458

>Skud_15.370 Chr15 (661915..663744) [1830 bp, 609 aa] {ON} YOR204W
           (REAL)
          Length = 609

 Score =  194 bits (494), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 121/401 (30%), Positives = 200/401 (49%), Gaps = 67/401 (16%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLI-EKLK-- 183
           L   +L NI    F +PTP+Q+ ++P++   RD++  A+TGSGKT  F+ P++ E  K  
Sbjct: 153 LDSLLLENIKLARFTKPTPVQKYSVPIVANGRDLMACAQTGSGKTGGFLFPVLSESFKTG 212

Query: 184 ----------MHSAKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQ 233
                      +  K    A+I++P+RELA Q     K+F   S +++ ++ GG  + +Q
Sbjct: 213 PSPQPESQGSFYQKKAYPTAVIMAPTRELATQIFDESKKFTYRSWVKACVVYGGSPIGNQ 272

Query: 234 FSMMMSNPDVIIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLP 293
              +    D+++ATPGR   L     + L +++Y+V DEADR+ +MGF+ Q+  ++    
Sbjct: 273 LREIERGCDLLVATPGRLNDLLERGKISLSNVKYLVLDEADRMLDMGFEPQIRHIVEDCD 332

Query: 294 T----ARQTLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREA 349
                ARQTL+FSAT P+ +   A+  L++ + + +      SEN+    L V+N ++++
Sbjct: 333 MTPVGARQTLMFSATFPADIQHLARDFLSDYIFLSVGRVGSTSENITQKVLYVENQDKKS 392

Query: 350 NLLYLLQEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPS 409
            LL LL        A+ + L                                        
Sbjct: 393 ALLDLLS-------ASTDGL---------------------------------------- 405

Query: 410 PNSTIIFVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDV 469
              T+IFV T+   + +++ L    +  + ++G   Q  R + L  FR G  ++LV T V
Sbjct: 406 ---TLIFVETKRMADQLTDFLIMQNFRATAIHGDRTQSERERALAAFRSGTASLLVATAV 462

Query: 470 AARGVDIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWA 510
           AARG+DIP + +V+N  LP+    +VHR+GRT RAGN G A
Sbjct: 463 AARGLDIPNVTHVINYDLPSDVDDYVHRIGRTGRAGNTGVA 503

>Ecym_5422 Chr5 complement(868686..869065,869897..871199) [1683 bp,
           560 aa] {ON} similar to Ashbya gossypii AFL221C
          Length = 560

 Score =  193 bits (491), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 115/388 (29%), Positives = 196/388 (50%), Gaps = 51/388 (13%)

Query: 129 KFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMH--- 185
           +++L  +  +GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I  +      
Sbjct: 132 EYVLKEVKEEGFDKPTAIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIVHINAQPLL 191

Query: 186 SAKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVII 245
           S   G   ++L+P+RELA+Q  K   +F   S +R+  + GG     Q   +    +++I
Sbjct: 192 SPGDGPIVLVLAPTRELAVQIQKECSKFGHSSRIRNTCVYGGVPKSQQIRDLQRGVEILI 251

Query: 246 ATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSATL 305
           ATPGR + +      +L  + Y+V DEADR+ +MGF+ Q+ +++  +   RQTL++SAT 
Sbjct: 252 ATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATW 311

Query: 306 PSSLVDFAKAGLTNPVLVRLDT-ETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVA 364
           P  +   A+  L +P+ V + + E   S  +  +   + + E+   L+  L       +A
Sbjct: 312 PKEVQQLARDYLHDPIQVNIGSLELAASHTITQIVEVISDFEKRDRLVKHLD------IA 365

Query: 365 TEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVE 424
           +++                                  P +K        IIF ST+   +
Sbjct: 366 SKD----------------------------------PESK-------IIIFASTKRTCD 384

Query: 425 YVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVN 484
            +++ L+  G+    ++G   Q  R   L+ FRCG + I+V TDVAARG+D+  +  V+N
Sbjct: 385 DITSYLRQDGWPALAIHGDKQQQERDWVLNEFRCGRSPIMVATDVAARGIDVKGINFVIN 444

Query: 485 MSLPASSKIFVHRVGRTARAGNKGWAYT 512
             +P + + +VHR+GRT RAG  G A +
Sbjct: 445 YDMPGNIEDYVHRIGRTGRAGATGTAIS 472

>CAGL0L02915g Chr12 complement(342831..344684) [1854 bp, 617 aa]
           {ON} highly similar to uniprot|P06634 Saccharomyces
           cerevisiae YOR204w DED1 ATP-dependent RNA helicase
          Length = 617

 Score =  194 bits (494), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 122/401 (30%), Positives = 198/401 (49%), Gaps = 67/401 (16%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKM-- 184
           L   +L NI    F +PTP+Q+ ++P++ + RD++  A+TGSGKT  F+ P++ +  +  
Sbjct: 152 LDSLLLENIKLARFTKPTPVQKYSVPIVSKGRDLMACAQTGSGKTGGFLFPVLSESFLTG 211

Query: 185 -----------HSAKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQ 233
                      +  K    A++++P+RELA Q     K+F   S ++  ++ GG  + +Q
Sbjct: 212 PAEKAANDGYSYQRKAFPTAVVMAPTRELATQIFDEAKKFCYRSWVKPCVVYGGAPIGNQ 271

Query: 234 FSMMMSNPDVIIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSL- 292
              M    D+++ATPGR   L     + L +++Y+V DEADR+ +MGF+ Q+  ++    
Sbjct: 272 MREMDHGCDLLVATPGRLNDLLERGKVSLSNVKYLVLDEADRMLDMGFEPQIRHIVEDCD 331

Query: 293 --PTA-RQTLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREA 349
             PT  RQTL+FSAT P  +   A+  L + + + +      SEN+    L V+N ++ +
Sbjct: 332 MPPTGERQTLMFSATFPHDIQHLARDFLHDYIFLSVGRVGSTSENITQRILYVENRDKNS 391

Query: 350 NLLYLLQEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPS 409
            LL LL        A+ + L                                        
Sbjct: 392 ALLDLL-------AASNDNL---------------------------------------- 404

Query: 410 PNSTIIFVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDV 469
              T+IFV T+   + +++ L    +  + ++G   Q  R + L  FR G  NILV T V
Sbjct: 405 ---TLIFVETKRMADQLTDFLIMQNFSATAIHGDRSQAERERALAAFRSGRANILVATAV 461

Query: 470 AARGVDIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWA 510
           AARG+DIP + +V+N  LP+    +VHR+GRT RAGN G A
Sbjct: 462 AARGLDIPNVTHVINYDLPSDVDDYVHRIGRTGRAGNTGVA 502

>Suva_8.257 Chr8 (461776..463632) [1857 bp, 618 aa] {ON} YOR204W
           (REAL)
          Length = 618

 Score =  194 bits (493), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 121/401 (30%), Positives = 201/401 (50%), Gaps = 66/401 (16%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLI-EKLK-- 183
           L + +L NI    F +PTP+Q+ ++P++   RD++  A+TGSGKT  F+ P++ E  K  
Sbjct: 156 LDELLLENIKLARFTKPTPVQKYSVPIVANGRDLMACAQTGSGKTGGFLFPVLSESFKTG 215

Query: 184 ----------MHSAKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQ 233
                      +  K    A+I++P+RELA Q     K+F   S +++ ++ GG  + +Q
Sbjct: 216 PSPQPEAQGSFYQRKAYPTAVIMAPTRELATQIFDEAKKFTYRSWVKACVVYGGSPIGNQ 275

Query: 234 FSMMMSNPDVIIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSL- 292
              +    D+++ATPGR   L     + L +++Y+V DEADR+ +MGF+ Q+  ++    
Sbjct: 276 LREIERGCDLLVATPGRLNDLLERGKISLANVKYLVLDEADRMLDMGFEPQIRHIVEDCD 335

Query: 293 --PTA-RQTLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREA 349
             P   RQTL+FSAT P+ +   A+  L++ + + +      SEN+    L V+N ++++
Sbjct: 336 MTPVGERQTLMFSATFPADIQHLARDFLSDYIFLSVGRVGSTSENITQKVLYVENQDKKS 395

Query: 350 NLLYLLQEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPS 409
            LL LL         T++ L                                        
Sbjct: 396 ALLDLLS------ATTDDGL---------------------------------------- 409

Query: 410 PNSTIIFVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDV 469
              T+IFV T+   + +++ L    +  + ++G   Q  R + L  FR G  ++LV T V
Sbjct: 410 ---TLIFVETKRMADQLTDFLIMQNFRATAIHGDRTQSERERALAAFRSGAASLLVATAV 466

Query: 470 AARGVDIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWA 510
           AARG+DIP + +V+N  LP+    +VHR+GRT RAGN G A
Sbjct: 467 AARGLDIPNVTHVINYDLPSDVDDYVHRIGRTGRAGNTGLA 507

>CAGL0J06908g Chr10 complement(662041..663855) [1815 bp, 604 aa]
           {ON} similar to uniprot|P24784 Saccharomyces cerevisiae
           YPL119c DBP1 or uniprot|P06634 Saccharomyces cerevisiae
           YOR204w
          Length = 604

 Score =  194 bits (492), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 119/405 (29%), Positives = 203/405 (50%), Gaps = 69/405 (17%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHS 186
           L + +L N+    F +PTP+Q+ +IP++ + RD++  A+TGSGKT  F+ P++ +L ++ 
Sbjct: 145 LDELLLENVELANFSKPTPVQKYSIPIVTKNRDLMACAQTGSGKTGGFLFPVLSELFLNG 204

Query: 187 A-------------KIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQ 233
                         K    A++L+P+RELA+Q     K++   S ++  ++ GG  +  Q
Sbjct: 205 PAPLPEHTRHSYMRKCYPSALVLAPTRELAIQIFDEAKKYTYRSWVKPYVVYGGAPIGQQ 264

Query: 234 FSMMMSNPDVIIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELL--GS 291
              M    ++++ATPGR   L     + L +++Y+V DEADR+ +MGF+ Q+  ++    
Sbjct: 265 MRDMDRGCNLLVATPGRLNDLLERGKISLVNVKYLVLDEADRMLDMGFEPQIRHIVEDCD 324

Query: 292 LPTA--RQTLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREA 349
           +P+   RQTL+FSAT P  +   A+  L + + + +      SEN++   L V++ ++ +
Sbjct: 325 MPSVNDRQTLMFSATFPREIQHLARDFLKDYIFLSVGRVGSTSENIQQKVLFVEDYDKNS 384

Query: 350 NLL-YLLQEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMP 408
            LL  L+ E+  +                                               
Sbjct: 385 ALLDILINEIDGL----------------------------------------------- 397

Query: 409 SPNSTIIFVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTD 468
               T++FV T+   + +++ L    +  + ++G   Q  R + LH FR G+ NILV T 
Sbjct: 398 ----TLVFVETKRMADQLTDFLIVQNFKATAIHGDRTQAERERALHAFRNGIANILVATA 453

Query: 469 VAARGVDIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWAYTI 513
           VAARG+DIP + NV+N  LP     +VHR+GRT RAGN G A + 
Sbjct: 454 VAARGLDIPNVTNVINYDLPTDIDDYVHRIGRTGRAGNVGVATSF 498

>TPHA0E02410 Chr5 (512919..514490) [1572 bp, 523 aa] {ON} Anc_6.204
           YGL078C
          Length = 523

 Score =  192 bits (488), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 125/394 (31%), Positives = 198/394 (50%), Gaps = 55/394 (13%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHS 186
           L+K I   IS+  F +PTPIQ  + P +L  RD++G+A TGSGKT AF +P I  L   +
Sbjct: 117 LNKKIQDEISK--FPKPTPIQSVSWPYLLTGRDVIGVAETGSGKTFAFGVPAINNLVDAN 174

Query: 187 AKI----GARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPD 242
            ++    G + +++SP+RELA QT            L    + GG   + Q + +  +  
Sbjct: 175 GQLKYKKGIQVLVISPTRELASQTFDNLVILTDKLGLHCCCVYGGVPKDPQRTQLKVS-Q 233

Query: 243 VIIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELL-GSLPTARQTLLF 301
           V++ATPGR L L  E ++DL ++ Y+V DEADR+ E GF+E +  ++  +    RQTL+F
Sbjct: 234 VVVATPGRLLDLLQEGSVDLSNVNYLVLDEADRMLEKGFEEDIKNIIRETASVGRQTLMF 293

Query: 302 SATLPSSLVDFAKAGLTNPVLVRLDTETKVSEN--LEMLFLSVKNDEREANLLYLLQEVI 359
           +AT P  + + A   +  PV V +    +++ N  +  +   +   +++  LL LL++  
Sbjct: 294 TATWPKEVRELASTFMERPVKVSIGNRDELTANKRITQIVEVIDPFKKDRKLLDLLKKYH 353

Query: 360 KIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVST 419
             P   E+ L                                             IF   
Sbjct: 354 SGPKKDEKVL---------------------------------------------IFALY 368

Query: 420 RHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLL 479
           +     V   L+  GY V+ ++G L Q  R Q L+ F+ G  N+L+ TDVAARG+DIP +
Sbjct: 369 KKEASRVERNLQYNGYQVAAIHGDLSQQQRTQALNEFKSGKCNLLLATDVAARGLDIPNV 428

Query: 480 ANVVNMSLPASSKIFVHRVGRTARAGNKGWAYTI 513
             V+N++ P + + +VHR+GRT RAG  G A+T+
Sbjct: 429 KTVINLTFPLTVEDYVHRIGRTGRAGQTGTAHTL 462

>Ecym_2269 Chr2 complement(527849..530482) [2634 bp, 877 aa] {ON}
           similar to Ashbya gossypii AFL027C
          Length = 877

 Score =  198 bits (503), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 125/390 (32%), Positives = 209/390 (53%), Gaps = 69/390 (17%)

Query: 140 FRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLK----MHSAKIGARAMI 195
           F  PTPIQ + IP I+  RDI+G+++TGSGKT +F+LPL+ ++K    +   + G   ++
Sbjct: 318 FNFPTPIQSQAIPAIMSGRDIIGISKTGSGKTVSFLLPLLRQIKSQRPLRVGETGPIGLL 377

Query: 196 LSPSRELAMQTHK-VFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIATPGRFLHL 254
           L+P+RELA+Q H+ V K  A    ++S+  TGG  ++ Q + +    ++I+ATPGRF+ L
Sbjct: 378 LAPTRELAVQIHEEVVKFTAANPRIKSICCTGGSEIKKQINDIKRGIEIIVATPGRFIDL 437

Query: 255 KVEMN----LDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSATLPSSLV 310
            + +N    ++   I +VV DEADRLF++GF+ Q+N+++  +   +Q +LFSAT P+ L 
Sbjct: 438 -LSLNSGNLVNPKRIVFVVLDEADRLFDLGFEPQVNQIMKCIRPDKQCVLFSATFPTKLK 496

Query: 311 DFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDERE-ANLLYLLQEVIKIPVATEEQL 369
            FA   L NP+ + +++++ ++EN+E       ++E +  +LL+ L     +P  T E  
Sbjct: 497 SFASKILHNPIHITINSKSLINENIEQRVEIFGDEESKFKSLLHWL-----VPTQTREVD 551

Query: 370 QRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYVSNL 429
           ++                                         TIIFVS++   +++SN 
Sbjct: 552 EK-----------------------------------------TIIFVSSQQICDFLSNR 570

Query: 430 LKDCGYLVSYLYGTLDQHA------RRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVV 483
           L+  G       GT   HA      R   L +F+     IL+ T+V +RG+++P ++ V+
Sbjct: 571 LEVNG------LGTFSIHAGKPFNERTWNLRSFKETKNGILICTEVLSRGLNVPEVSLVL 624

Query: 484 NMSLPASSKIFVHRVGRTARAGNKGWAYTI 513
             +   S   +VH  GRTAR  NKG A T+
Sbjct: 625 IYNAAKSFAQYVHTTGRTARGTNKGMAVTL 654

>YNL112W Chr14 (413639..414911,415914..416281) [1641 bp, 546 aa]
           {ON}  DBP2Essential ATP-dependent RNA helicase of the
           DEAD-box protein family, involved in nonsense-mediated
           mRNA decay and rRNA processing
          Length = 546

 Score =  192 bits (488), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 115/385 (29%), Positives = 190/385 (49%), Gaps = 51/385 (13%)

Query: 130 FILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMH---S 186
           ++L  +  +GF +PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP I  +      +
Sbjct: 123 YVLNEVKAEGFDKPTGIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIVHINAQPLLA 182

Query: 187 AKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIA 246
              G   ++L+P+RELA+Q      +F   S +R+  + GG     Q   +    +++IA
Sbjct: 183 PGDGPIVLVLAPTRELAVQIQTECSKFGHSSRIRNTCVYGGVPKSQQIRDLSRGSEIVIA 242

Query: 247 TPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSATLP 306
           TPGR + +      +L  + Y+V DEADR+ +MGF+ Q+ +++  +   RQTL++SAT P
Sbjct: 243 TPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWP 302

Query: 307 SSLVDFAKAGLTNPVLVRLDT-ETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVAT 365
             +   A   L +P+ V++ + E   S N+  +   V + E+   L   L+        T
Sbjct: 303 KEVKQLAADYLNDPIQVQVGSLELSASHNITQIVEVVSDFEKRDRLNKYLE--------T 354

Query: 366 EEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEY 425
             Q   ++                                       T+IF ST+   + 
Sbjct: 355 ASQDNEYK---------------------------------------TLIFASTKRMCDD 375

Query: 426 VSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNM 485
           ++  L++ G+    ++G  DQ  R   L  FR G + I+V TDVAARG+D+  +  V+N 
Sbjct: 376 ITKYLREDGWPALAIHGDKDQRERDWVLQEFRNGRSPIMVATDVAARGIDVKGINYVINY 435

Query: 486 SLPASSKIFVHRVGRTARAGNKGWA 510
            +P + + +VHR+GRT RAG  G A
Sbjct: 436 DMPGNIEDYVHRIGRTGRAGATGTA 460

>AFL027C Chr6 complement(386001..388451) [2451 bp, 816 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR237W
           (PRP5)
          Length = 816

 Score =  196 bits (499), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 118/383 (30%), Positives = 203/383 (53%), Gaps = 55/383 (14%)

Query: 140 FRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLK----MHSAKIGARAMI 195
           F  PTPIQ + IP I+  RD++G+++TGSGKT +F+LPL+ ++K    +   + G   +I
Sbjct: 257 FTVPTPIQAQAIPAIMSGRDVIGISKTGSGKTVSFILPLLRQIKAQRPLGGDETGPLGLI 316

Query: 196 LSPSRELAMQTHKVFKEFAKGS-NLRSVLLTGGDGLEDQFSMMMSNPDVIIATPGRFLHL 254
           LSP+RELA+Q H+   +F  G  ++RS+  TGG  L+ Q + +    +++IATPGRF+ L
Sbjct: 317 LSPTRELALQIHEEVTKFTSGDPSIRSLCCTGGSELKRQINDIKRGVEIVIATPGRFIDL 376

Query: 255 KVEMN----LDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSATLPSSLV 310
            + +N    ++   I +VV DEADRLF++GF+ Q+N+++  +   +Q +LFSAT P+ L 
Sbjct: 377 -LSLNSGNLINPKRIVFVVMDEADRLFDLGFEPQVNQIMKCIRPDKQCVLFSATFPNKLK 435

Query: 311 DFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVATEEQLQ 370
            FA   L +PV + +++++ ++EN+E       N+E +       + +I     T++ L 
Sbjct: 436 SFASKILHDPVYITVNSKSLINENIEQKVEIFSNEEDK------FKSLIHWLALTQQNL- 488

Query: 371 RFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYVSNLL 430
                                                 +   TI+FVS++   + + N L
Sbjct: 489 --------------------------------------NDEKTIVFVSSQQICDILYNRL 510

Query: 431 KDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSLPAS 490
           +  G+    ++       R   L  F+     IL+ T+V +RG+++P ++ V+  +   +
Sbjct: 511 EANGFTTFAIHAGKIYTERAWNLKCFKETANGILICTEVLSRGLNVPEVSLVIIYNAAKT 570

Query: 491 SKIFVHRVGRTARAGNKGWAYTI 513
              +VH  GRTAR  NKG A T+
Sbjct: 571 FAQYVHTTGRTARGSNKGTALTL 593

>NCAS0B01730 Chr2 complement(286249..288105) [1857 bp, 618 aa] {ON}
           Anc_8.614
          Length = 618

 Score =  193 bits (490), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 124/402 (30%), Positives = 200/402 (49%), Gaps = 68/402 (16%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLI-EKLKM- 184
           L + +L NI    F +PTP+Q+ ++P++   RD++  A+TGSGKT  F+ P++ E  K  
Sbjct: 152 LDELLLENIKLARFTKPTPVQKYSVPIVAAGRDLMACAQTGSGKTGGFLFPVLSESFKTG 211

Query: 185 ------------HSAKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLED 232
                       +  K    A+I++P+RELA Q     K+F   S ++  ++ GG  + +
Sbjct: 212 PTVVDNAQSHGYYQKKAYPTAVIMAPTRELATQIFDEAKKFCYRSWVQPCVVYGGSPIGN 271

Query: 233 QFSMMMSNPDVIIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELL-GS 291
           Q   M    D+++ATPGR   L     + L +++Y+V DEADR+ +MGF+ Q+  ++ G+
Sbjct: 272 QMREMDRGCDLLVATPGRLSDLIDRGKISLSNVKYLVLDEADRMLDMGFEPQIRAIVEGA 331

Query: 292 LPTA---RQTLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDERE 348
             T    RQTL+FSAT P+ +   A+  L + + + +      SEN+    L V+N +++
Sbjct: 332 DMTPVGERQTLMFSATFPADIQHLARDFLADYIFLSVGRVGSTSENITQRVLYVENQDKK 391

Query: 349 ANLLYLLQEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMP 408
           + LL LL        A+ + L                                       
Sbjct: 392 SALLDLLS-------ASNDGL--------------------------------------- 405

Query: 409 SPNSTIIFVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTD 468
               T+IFV T+   + +++ L    +  + ++G   Q  R + L  FR G  N+LV T 
Sbjct: 406 ----TLIFVETKRMADQLTDFLIMQDFRATAIHGDRTQQERERALAAFRSGRANLLVATA 461

Query: 469 VAARGVDIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWA 510
           VAARG+DIP + +V+N  LP     +VHR+GRT RAGN G A
Sbjct: 462 VAARGLDIPNVTHVINYDLPGDIDDYVHRIGRTGRAGNTGVA 503

>KLTH0D09328g Chr4 complement(773449..773837,774557..775823) [1656
           bp, 551 aa] {ON} similar to uniprot|P24783 Saccharomyces
           cerevisiae YNL112W DBP2 Essential ATP-dependent RNA
           helicase of the DEAD-box protein family involved in
           nonsense-mediated mRNA decay and rRNA processing
          Length = 551

 Score =  191 bits (486), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 115/391 (29%), Positives = 194/391 (49%), Gaps = 51/391 (13%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMH- 185
             +++L  +  +GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I  +    
Sbjct: 118 FPEYVLSEVKAEGFEKPTGIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIVHINAQP 177

Query: 186 --SAKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDV 243
             S   G   ++L+P+RELA+Q      +F K S +R+  + GG     Q   +    ++
Sbjct: 178 LLSPGDGPIVLVLAPTRELAVQIQTECSKFGKSSRIRNTCVYGGVPRGHQIRELTRGAEI 237

Query: 244 IIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSA 303
           +IATPGR + +      +L  + Y+V DEADR+ +MGF+ Q+ +++  +   RQTL++SA
Sbjct: 238 VIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSA 297

Query: 304 TLPSSLVDFAKAGLTNPVLVRLDT-ETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIP 362
           T P  +   A+  L +P+ V + + E   S N+  +   V + E+   LL  L+      
Sbjct: 298 TWPKEVQQLARDYLHDPIQVNVGSLELAASHNIAQIVEVVSDMEKRDRLLKHLE------ 351

Query: 363 VATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHH 422
            A+E++  +                                          +IF ST+  
Sbjct: 352 TASEDKDSKI-----------------------------------------LIFASTKRT 370

Query: 423 VEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANV 482
            + ++  L+  G+    ++G   Q+ R   L  FR G + I+V TDVAARG+D+  +  V
Sbjct: 371 CDEITRYLRQDGWPALAIHGDKAQNERDWVLQEFRTGNSPIMVATDVAARGIDVKGINFV 430

Query: 483 VNMSLPASSKIFVHRVGRTARAGNKGWAYTI 513
           +N  +P + + +VHR+GRT RAG  G A + 
Sbjct: 431 INYDMPGNIEDYVHRIGRTGRAGATGTAISF 461

>YOR204W Chr15 (722911..724725) [1815 bp, 604 aa] {ON}
           DED1ATP-dependent DEAD (Asp-Glu-Ala-Asp)-box RNA
           helicase, required for translation initiation of all
           yeast mRNAs; mutations in human DEAD-box DBY are a
           frequent cause of male infertility
          Length = 604

 Score =  192 bits (489), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 121/401 (30%), Positives = 199/401 (49%), Gaps = 67/401 (16%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLI-EKLK-- 183
           L   +L NI    F +PTP+Q+ ++P++   RD++  A+TGSGKT  F+ P++ E  K  
Sbjct: 149 LDGLLLENIKLARFTKPTPVQKYSVPIVANGRDLMACAQTGSGKTGGFLFPVLSESFKTG 208

Query: 184 ----------MHSAKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQ 233
                      +  K    A+I++P+RELA Q     K+F   S +++ ++ GG  + +Q
Sbjct: 209 PSPQPESQGSFYQRKAYPTAVIMAPTRELATQIFDEAKKFTYRSWVKACVVYGGSPIGNQ 268

Query: 234 FSMMMSNPDVIIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSL- 292
              +    D+++ATPGR   L     + L +++Y+V DEADR+ +MGF+ Q+  ++    
Sbjct: 269 LREIERGCDLLVATPGRLNDLLERGKISLANVKYLVLDEADRMLDMGFEPQIRHIVEDCD 328

Query: 293 --PTA-RQTLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREA 349
             P   RQTL+FSAT P+ +   A+  L++ + + +      SEN+    L V+N ++++
Sbjct: 329 MTPVGERQTLMFSATFPADIQHLARDFLSDYIFLSVGRVGSTSENITQKVLYVENQDKKS 388

Query: 350 NLLYLLQEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPS 409
            LL LL        A+ + L                                        
Sbjct: 389 ALLDLLS-------ASTDGL---------------------------------------- 401

Query: 410 PNSTIIFVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDV 469
              T+IFV T+   + +++ L    +  + ++G   Q  R + L  FR G   +LV T V
Sbjct: 402 ---TLIFVETKRMADQLTDFLIMQNFRATAIHGDRTQSERERALAAFRSGAATLLVATAV 458

Query: 470 AARGVDIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWA 510
           AARG+DIP + +V+N  LP+    +VHR+GRT RAGN G A
Sbjct: 459 AARGLDIPNVTHVINYDLPSDVDDYVHRIGRTGRAGNTGLA 499

>Smik_14.215 Chr14 (393283..394555,395537..395907) [1644 bp, 547 aa]
           {ON} YNL112W (REAL)
          Length = 547

 Score =  191 bits (485), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 114/385 (29%), Positives = 190/385 (49%), Gaps = 51/385 (13%)

Query: 130 FILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMH---S 186
           ++L  +  +GF +PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP I  +      +
Sbjct: 123 YVLSEVKAEGFDKPTGIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIVHINAQPLLA 182

Query: 187 AKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIA 246
              G   ++L+P+RELA+Q      +F   S +R+  + GG     Q   +    +++IA
Sbjct: 183 PGDGPIVLVLAPTRELAVQIQTECSKFGHSSRIRNTCVYGGVPKSQQIRDLSRGSEIVIA 242

Query: 247 TPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSATLP 306
           TPGR + +      +L  + Y+V DEADR+ +MGF+ Q+ +++  +   RQTL++SAT P
Sbjct: 243 TPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWP 302

Query: 307 SSLVDFAKAGLTNPVLVRLDT-ETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVAT 365
             +   A   L +P+ V++ + E   S N+  +   V + E+   L   L+        T
Sbjct: 303 KEVKQLAADYLNDPIQVQVGSLELSASHNITQIVEVVSDFEKRDRLNKYLE--------T 354

Query: 366 EEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEY 425
             Q   ++                                       T++F ST+   + 
Sbjct: 355 ASQDNEYK---------------------------------------TLVFASTKRMCDD 375

Query: 426 VSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNM 485
           ++  L++ G+    ++G  DQ  R   L  FR G + I+V TDVAARG+D+  +  V+N 
Sbjct: 376 ITKYLREDGWPALAIHGDKDQRERDWVLQEFRNGRSPIMVATDVAARGIDVKGINYVINY 435

Query: 486 SLPASSKIFVHRVGRTARAGNKGWA 510
            +P + + +VHR+GRT RAG  G A
Sbjct: 436 DMPGNIEDYVHRIGRTGRAGATGTA 460

>NDAI0E02430 Chr5 complement(503901..505886) [1986 bp, 661 aa] {ON}
           Anc_8.614
          Length = 661

 Score =  193 bits (491), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 123/404 (30%), Positives = 200/404 (49%), Gaps = 67/404 (16%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKL---- 182
           L   +L NI+   F +PTP+Q+ +IP+I   RD++  A+TGSGKT  F+ P++ +     
Sbjct: 192 LDDLLLENINLARFSKPTPVQKYSIPIIANGRDLMACAQTGSGKTGGFLFPVLSEAFKSG 251

Query: 183 ---------KMHSAKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQ 233
                      +S K    ++IL+P+RELA Q  +  K+F   S ++  ++ GG  + +Q
Sbjct: 252 PSPTPEQGRNFYSKKGYPTSLILAPTRELATQIFEEAKKFTYRSWVKPCVVYGGAPIGNQ 311

Query: 234 FSMMMSNPDVIIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGS-- 291
              +    D+++ATPGR   L     + L +I+Y+V DEADR+ +MGF+ Q+  ++    
Sbjct: 312 MREIDHGCDLLVATPGRLSDLLERGKISLQNIKYLVLDEADRMLDMGFEPQIRHIVEGVD 371

Query: 292 LPTA--RQTLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREA 349
           +P    RQTL+FSAT P  +   A+  L + V + +      S+N+    L V++ ++ +
Sbjct: 372 MPQVGERQTLMFSATFPIDIQQLARDFLNDYVFLSVGRVGSTSDNITQKILYVEDQDKYS 431

Query: 350 NLLYLLQEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPS 409
            LL LL        AT + L                                        
Sbjct: 432 ALLDLLS-------ATSDGL---------------------------------------- 444

Query: 410 PNSTIIFVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDV 469
              T+IFV T+   + +++ L    +  + ++G   Q  R + L  F+ G  N+LV T V
Sbjct: 445 ---TLIFVETKRMADQLTDFLIMQNFRATAIHGDRTQAERERALSAFKAGTANLLVATAV 501

Query: 470 AARGVDIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWAYTI 513
           AARG+DIP + +V+N  LP+    +VHR+GRT RAGN G A + 
Sbjct: 502 AARGLDIPNVTHVINFDLPSDIDDYVHRIGRTGRAGNTGVATSF 545

>Smik_15.390 Chr15 (672576..674405) [1830 bp, 609 aa] {ON} YOR204W
           (REAL)
          Length = 609

 Score =  192 bits (488), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 121/401 (30%), Positives = 201/401 (50%), Gaps = 67/401 (16%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLI-EKLK-- 183
           L + +L NI    F +PTP+Q+ ++P++   RD++  A+TGSGKT  F+ P++ E  K  
Sbjct: 153 LDELLLENIKLARFTKPTPVQKYSVPIVANGRDLMACAQTGSGKTGGFLFPVLSESFKTG 212

Query: 184 ----------MHSAKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQ 233
                      +  K    A+I++P+RELA Q     K+F   S +++ ++ GG  + +Q
Sbjct: 213 PSPQPESQGSFYQRKAYPTAVIMAPTRELATQIFDEAKKFTYRSWVKACVVYGGSPIGNQ 272

Query: 234 FSMMMSNPDVIIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSL- 292
              +    D+++ATPGR   L     + L +++Y+V DEADR+ +MGF+ Q+  ++    
Sbjct: 273 LREIERGCDLLVATPGRLNDLLERGKISLVNVKYLVLDEADRMLDMGFEPQIRHIVEDCD 332

Query: 293 --PTA-RQTLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREA 349
             P   RQTL+FSAT P+ +   A+  L++ + + +      SEN+    L V+N ++++
Sbjct: 333 MTPVGDRQTLMFSATFPADIQHLARDFLSDYIFLSVGRVGSTSENITQKVLYVENQDKKS 392

Query: 350 NLLYLLQEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPS 409
            LL LL        A+ + L                                        
Sbjct: 393 ALLDLLS-------ASTDGL---------------------------------------- 405

Query: 410 PNSTIIFVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDV 469
              T+IFV T+   + +++ L    +  + ++G   Q  R + L  FR G  ++LV T V
Sbjct: 406 ---TLIFVETKRMADQLTDFLIMQNFRATAIHGDRTQSERERALAAFRSGAASLLVATAV 462

Query: 470 AARGVDIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWA 510
           AARG+DIP + +V+N  LP+    +VHR+GRT RAGN G A
Sbjct: 463 AARGLDIPNVTHVINYDLPSDVDDYVHRIGRTGRAGNTGLA 503

>KLLA0C15499g Chr3 complement(1345201..1346715) [1515 bp, 504 aa]
           {ON} similar to uniprot|P20447 Saccharomyces cerevisiae
           YGL078C DBP3 Putative ATP-dependent RNA helicase of the
           DEAD-box family involved in ribosomal biogenesis
          Length = 504

 Score =  190 bits (482), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 116/376 (30%), Positives = 182/376 (48%), Gaps = 46/376 (12%)

Query: 140 FRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHSAKIGA-RAMILSP 198
           F +PTPIQ  + P +L  +D++G+A TGSGKT AF +P I  +     K  + + +++SP
Sbjct: 112 FPKPTPIQAVSWPYLLAGKDVIGIAETGSGKTFAFGVPAINNIVTSGDKSSSVKVLVISP 171

Query: 199 SRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIATPGRFLHLKVEM 258
           +RELA Q +           LRS  + GG   +DQ    +    V++ATPGR L L  E 
Sbjct: 172 TRELASQIYDNLIVLTDACGLRSCCVYGGVP-KDQQREDLRRSQVVVATPGRLLDLIEEG 230

Query: 259 NLDLHSIEYVVFDEADRLFEMGFQEQLNELL-GSLPTARQTLLFSATLPSSLVDFAKAGL 317
           ++DL  + Y+V DEADR+ E GF+E + +++  +  T+RQTL+F+AT P  + + A +  
Sbjct: 231 SVDLSHVNYLVLDEADRMLEKGFEEDIKKIIRQTRSTSRQTLMFTATWPKEVRELASS-- 288

Query: 318 TNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVATEEQLQRFRXXXX 377
                                                + E +K+ +   ++L   +    
Sbjct: 289 ------------------------------------FMSEPVKVSIGNRDELSANKRITQ 312

Query: 378 XXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYVSNLLKDCGYLV 437
                                   P+  D       +IF   +     V   LK  GY V
Sbjct: 313 IVEVVDPFRKEKKLLELLKKYHSGPTKND-----KVLIFALYKKEASRVERNLKYNGYDV 367

Query: 438 SYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSLPASSKIFVHR 497
           + ++G L Q  R Q L+ F+ G  N+L+ TDVAARG+DIP +  V+N++ P + + +VHR
Sbjct: 368 AAIHGDLSQQQRTQALNEFKAGKCNLLLATDVAARGLDIPNVKTVINLTFPLTVEDYVHR 427

Query: 498 VGRTARAGNKGWAYTI 513
           +GRT RAG  G A+T+
Sbjct: 428 IGRTGRAGQYGTAHTL 443

>ZYRO0A02948g Chr1 (240353..242026) [1674 bp, 557 aa] {ON} similar
           to uniprot|P23394 Saccharomyces cerevisiae YDR243C PRP28
           RNA helicase in the DEAD-box family involved in RNA
           isomerization at the 5' splice site
          Length = 557

 Score =  191 bits (484), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 120/385 (31%), Positives = 194/385 (50%), Gaps = 62/385 (16%)

Query: 140 FRQPTPIQRKTIPLILQQ--RDIVGMARTGSGKTAAFVLPLIEKLKMHSAKI-------G 190
           + +PTPIQR  +P +  +  RD++G+A TGSGKT AF++P++ K+    ++        G
Sbjct: 175 YHEPTPIQRAAVPNVCNKKFRDLLGIASTGSGKTLAFLIPILMKIDQLPSRPLVLKKMDG 234

Query: 191 ARAMILSPSRELAMQTHKVFKEF--AKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIATP 248
             A+IL+P+RELA Q  K  +E   A G N     + GG  +E+    +    D+++ATP
Sbjct: 235 PLALILAPTRELAQQIEKEAEELIDAWGKNCEVASIVGGHSIEEISLQVSQGTDILVATP 294

Query: 249 GRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSATLPSS 308
           GR +       L L  +E +V DEADR+ +MGF+EQ+  +LG+L   RQT++F+A++   
Sbjct: 295 GRLIDCLENHVLTLGKVETLVLDEADRMIDMGFEEQVTSILGNLTQKRQTMMFTASMTPG 354

Query: 309 LVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVATEEQ 368
               A   L NPV V +      +  +  L   + ++E+        Q ++       E 
Sbjct: 355 TEKIAAGYLKNPVRVTVSGSQGSTPMIRQLVEHIGSEEQR------FQRIV-------EF 401

Query: 369 LQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEY-VS 427
           L ++R                          P+            IIF++ +   ++ V 
Sbjct: 402 LPQYRA-------------------------PI------------IIFINYKRAADWLVQ 424

Query: 428 NLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSL 487
              K+  Y V+ LYG+  Q  R Q L   R G   I++ T+VAARG+D+P ++ V+N  L
Sbjct: 425 KFYKETQYKVTVLYGSKSQEQREQSLQLLRKGKVQIMIATNVAARGLDVPDVSLVINFQL 484

Query: 488 PASSKIFVHRVGRTARAGNKGWAYT 512
             + + +VHR+GRT RAG++G A T
Sbjct: 485 SKTFEDYVHRIGRTGRAGHEGTAIT 509

>KAFR0G02030 Chr7 complement(428516..430336) [1821 bp, 606 aa] {ON}
           Anc_8.614 YOR204W
          Length = 606

 Score =  191 bits (486), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 122/401 (30%), Positives = 200/401 (49%), Gaps = 67/401 (16%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLI-EKLK-- 183
           L   +L NI    F +PTP+Q+ ++P++   RD++  A+TGSGKT  F+ P++ E  K  
Sbjct: 145 LEGLLLENIKLARFTKPTPVQKYSVPIVANGRDLMACAQTGSGKTGGFLFPVLSESFKNG 204

Query: 184 ----------MHSAKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQ 233
                      +  K    A+I++P+REL  Q     K+F   S ++  ++ GG  + +Q
Sbjct: 205 PTPLPENSGSHYQRKAYPTAVIMAPTRELVSQIFDEAKKFTYRSWVKPCVVYGGAPIANQ 264

Query: 234 FSMMMSNPDVIIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSL- 292
              M    D+++ATPGR   L     + L +++Y+V DEADR+ +MGF+ Q+  ++    
Sbjct: 265 MREMDRGCDLLVATPGRLSDLLERGKISLANVKYLVLDEADRMLDMGFEPQIRHIVEGCD 324

Query: 293 --PTA-RQTLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREA 349
             P   RQTL+FSAT P+ +   A+  L++ + + +      SEN+    L V+++++++
Sbjct: 325 MTPVGERQTLMFSATFPADIQHLARDFLSDYIFLSVGRVGSTSENITQRVLYVEDEDKKS 384

Query: 350 NLLYLLQEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPS 409
            LL LL        A++E L                                        
Sbjct: 385 ALLDLL-------AASDEGL---------------------------------------- 397

Query: 410 PNSTIIFVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDV 469
              T+IFV T+   + +++ L    +  + ++G   Q  R + L  FR G  N+LV T V
Sbjct: 398 ---TLIFVETKRLADQLTDFLIMQNFRATAIHGDRTQSERERALAAFRSGAANLLVATAV 454

Query: 470 AARGVDIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWA 510
           AARG+DIP + +V+N  LP+    +VHR+GRT RAGN G A
Sbjct: 455 AARGLDIPNVTHVINFDLPSDIDDYVHRIGRTGRAGNTGVA 495

>NDAI0E01590 Chr5 complement(315658..317484) [1827 bp, 608 aa] {ON} 
          Length = 608

 Score =  191 bits (486), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 121/400 (30%), Positives = 199/400 (49%), Gaps = 66/400 (16%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLI------- 179
           L + +L NI    F +PTP+Q+ +IP++   RD++  A+TGSGKT  F+ P++       
Sbjct: 142 LDELLLENIQLARFTKPTPVQKYSIPIVAAGRDLMACAQTGSGKTGGFLFPVLSESFKTG 201

Query: 180 -----EKLKMHSAKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQF 234
                ++   +  K    A++++P+RELA Q     K+F   S ++  +  GG  + +Q 
Sbjct: 202 PTATHDQGSYYQKKAFPTAVVMAPTRELATQIFDEAKKFCYRSWVQPCVAYGGAPIGNQM 261

Query: 235 SMMMSNPDVIIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELL-GSLP 293
             M    D+++ATPGR   L     + L +++Y+V DEADR+ +MGF+ Q+  ++ G+  
Sbjct: 262 REMDRGCDLLVATPGRLSDLIDRGKISLSNVKYLVLDEADRMLDMGFEPQIRAIVEGADM 321

Query: 294 TA---RQTLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREAN 350
           T    RQTL+FSAT P+ +   A+  L + + + +      SEN+    L V+N ++++ 
Sbjct: 322 TPVGERQTLMFSATFPADIQHLARDFLADYIFLSVGRVGSTSENITQRVLYVENQDKKSA 381

Query: 351 LLYLLQEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSP 410
           LL LL        A+E+ L                                         
Sbjct: 382 LLDLLS-------ASEDGL----------------------------------------- 393

Query: 411 NSTIIFVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVA 470
             T+IFV T+   + +++ L    +  + ++G   Q  R + L  F+ G   +LV T VA
Sbjct: 394 --TLIFVETKRMADQLTDFLIMQNFRATAIHGDRTQAERERALAAFKSGAATLLVATAVA 451

Query: 471 ARGVDIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWA 510
           ARG+DIP + +V+N  LP     +VHR+GRT RAGN G A
Sbjct: 452 ARGLDIPNVTHVINYDLPGDIDDYVHRIGRTGRAGNTGIA 491

>Suva_14.226 Chr14 (410416..411691,412742..413097) [1632 bp, 543 aa]
           {ON} YNL112W (REAL)
          Length = 543

 Score =  190 bits (482), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 116/388 (29%), Positives = 191/388 (49%), Gaps = 51/388 (13%)

Query: 130 FILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMH---S 186
           ++L  +  +GF +PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP I  +      +
Sbjct: 124 YVLSEVKAEGFAKPTGIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIVHINAQPLLA 183

Query: 187 AKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIA 246
              G   ++LSP+RELA+Q      +F + S +R+  + GG     Q   +    +++IA
Sbjct: 184 PGDGPIVLVLSPTRELAVQIQTECSKFGQSSRIRNTCVYGGVPKSQQIRDLSRGSEIVIA 243

Query: 247 TPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSATLP 306
           TPGR + +      +L  + Y+V DEADR+ +MGF+ Q+ +++  +   RQTL++SAT P
Sbjct: 244 TPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWP 303

Query: 307 SSLVDFAKAGLTNPVLVRLDT-ETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVAT 365
             +   A   L +P+ V++ + E   S  +  L   V + E+   L   L+        T
Sbjct: 304 KEVKQLAADYLNDPIQVQVGSLELAASHTITQLVEVVSDFEKRDRLNKHLE--------T 355

Query: 366 EEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEY 425
             Q   ++                                       T+IF ST+   + 
Sbjct: 356 ASQDDEYK---------------------------------------TLIFASTKRMCDD 376

Query: 426 VSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNM 485
           ++  L++ G+    ++G  DQ  R   L  FR G + I+V TDVAARG+D+  +  V+N 
Sbjct: 377 ITKYLREDGWPALAIHGDKDQRERDWVLQEFRNGGSPIMVATDVAARGIDVKGINYVINY 436

Query: 486 SLPASSKIFVHRVGRTARAGNKGWAYTI 513
            +P + + +VHR+GRT RAG  G A + 
Sbjct: 437 DMPGNIEDYVHRIGRTGRAGATGTAVSF 464

>Kpol_1033.40 s1033 complement(104203..105795) [1593 bp, 530 aa]
           {ON} complement(104203..105795) [1593 nt, 531 aa]
          Length = 530

 Score =  189 bits (480), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 121/381 (31%), Positives = 192/381 (50%), Gaps = 53/381 (13%)

Query: 140 FRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHSA----KIGARAMI 195
           F +PTPIQ  + P +L  +D++G+A TGSGKT AF +P I  +   S     K G + +I
Sbjct: 135 FPKPTPIQAVSWPYLLAGKDVIGVAETGSGKTFAFGVPAINNILTKSGSKPGKNGIQVLI 194

Query: 196 LSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIATPGRFLHLK 255
           +SP+RELA Q +           L    + GG   ++Q + +  +  V++ATPGR L L 
Sbjct: 195 ISPTRELASQIYDNLVILTDKVGLECCCVYGGVPKDEQRTQLKRS-QVVVATPGRLLDLI 253

Query: 256 VEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELL-GSLPTARQTLLFSATLPSSLVDFAK 314
            E   +L ++ Y+V DEADR+ E GF+E +  ++  +  T RQTL+F+AT P  + + A 
Sbjct: 254 QEGAANLSNVNYLVLDEADRMLEKGFEEDIKNIIRETKSTGRQTLMFTATWPKEVRELAS 313

Query: 315 AGLTNPVLVRLDTETKVSEN--LEMLFLSVKNDEREANLLYLLQEVIKIPVATEEQLQRF 372
             + +P+ V +    ++S N  +  +   +   ++E  LL              E L+++
Sbjct: 314 TFMNSPIKVSIGNTDELSANKRITQIVEVIDPFKKERKLL--------------ELLKKY 359

Query: 373 RXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYVSNLLKD 432
           +                             S KD    +  +IF   +     V   L  
Sbjct: 360 QSG---------------------------SKKD----DKVLIFALYKKEAARVERNLNY 388

Query: 433 CGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSLPASSK 492
            GY VS ++G L Q  R   L  F+ G ++IL+ TDVAARG+DIP +  V+N++ P + +
Sbjct: 389 NGYKVSAIHGDLSQQQRTNALDEFKTGRSSILLATDVAARGLDIPNVKTVINLTFPLTVE 448

Query: 493 IFVHRVGRTARAGNKGWAYTI 513
            +VHR+GRT RAG  G A+T+
Sbjct: 449 DYVHRIGRTGRAGKTGTAHTL 469

>AFL080W Chr6 (288205..289812) [1608 bp, 535 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL078C (DBP3)
          Length = 535

 Score =  189 bits (480), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 121/378 (32%), Positives = 185/378 (48%), Gaps = 50/378 (13%)

Query: 140 FRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMH-SAKIGARAMILSP 198
           F +PTPIQ  + P +L  +D++G+A TGSGKT AF +P I  L    S   G + +++SP
Sbjct: 143 FPKPTPIQAVSWPYLLAGKDVIGVAETGSGKTFAFGVPAINSLMSEKSTPRGVKCLVISP 202

Query: 199 SRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIATPGRFLHLKVEM 258
           +RELA Q +    +      L    + GG   + Q    +    V++ATPGR L L  E 
Sbjct: 203 TRELASQIYDNLVQLTDKVGLNCCCVYGGVQKDSQ-REQLKKAQVVVATPGRLLDLIEEG 261

Query: 259 NLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPT-ARQTLLFSATLPSSLVDFAKAGL 317
           +  L  ++Y+V DEADR+ E GF+E +  ++    +  RQTL+F+AT P  + + A   +
Sbjct: 262 SAKLAGVQYLVLDEADRMLEKGFEEDIKRIIKETKSDVRQTLMFTATWPKEVRELASTFM 321

Query: 318 TNPVLVRLDTETKVSEN--LEMLFLSVKNDEREANLLYLLQEVIKIPVATEEQLQRFRXX 375
             PV V +    ++S N  +  +   +   ++E  LL LL+                   
Sbjct: 322 RAPVKVSIGNRDELSANKRITQVVEVIDPFKKEKRLLELLK------------------- 362

Query: 376 XXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYVSNLLKDCGY 435
                                  Q    AK     +  +IF   +     V   LK  GY
Sbjct: 363 -----------------------QYQSGAK---KNDKVLIFALYKKEASRVERNLKYNGY 396

Query: 436 LVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSLPASSKIFV 495
            V+ ++G L Q  R Q L  F+ G  N+L+ TDVAARG+DIP +  V+N++ P + + +V
Sbjct: 397 NVAAIHGDLSQQQRTQALSEFKAGTANLLLATDVAARGLDIPNVKTVINLTFPLTVEDYV 456

Query: 496 HRVGRTARAGNKGWAYTI 513
           HR+GRT RAG  G A+T+
Sbjct: 457 HRIGRTGRAGATGVAHTL 474

>TDEL0A05590 Chr1 (980392..982185) [1794 bp, 597 aa] {ON} Anc_8.614
           YOR204W
          Length = 597

 Score =  191 bits (484), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 122/399 (30%), Positives = 200/399 (50%), Gaps = 67/399 (16%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLI-EKLKMH 185
           L + +L NI    F +PTP+Q+ ++P++   RD++  A+TGSGKT  F+ P++ E     
Sbjct: 147 LDELLLENIKLARFTKPTPVQKYSVPIVANGRDLMACAQTGSGKTGGFLFPVLSESFSTG 206

Query: 186 SAKI--GAR----------AMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQ 233
            ++I   AR          A++L+P+RELA Q     K+F   S +R+ ++ GG  +  Q
Sbjct: 207 PSEIPENARGGYMRKAFPTAVVLAPTRELATQIFDEAKKFTYRSWVRATVVYGGADVGSQ 266

Query: 234 FSMMMSNPDVIIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELL--GS 291
              +    D+++ATPGR   L     + L  ++Y+V DEADR+ +MGF+ Q+  ++    
Sbjct: 267 MRELDRGCDLLVATPGRLNDLLERGKISLAKVKYLVLDEADRMLDMGFEPQIRHIVEGCD 326

Query: 292 LPTA--RQTLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREA 349
           +P    RQTL+FSAT P  +   A+  L++ + + +      SEN+    L V+++++++
Sbjct: 327 MPGVEDRQTLMFSATFPVDIQHLARDFLSDYIFLSVGRVGSTSENITQHVLYVEDEDKKS 386

Query: 350 NLLYLLQEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPS 409
            LL L+                                               SA D   
Sbjct: 387 ALLDLIS----------------------------------------------SATD--- 397

Query: 410 PNSTIIFVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDV 469
              T+IFV T+   + +++ L    +  + ++G   Q  R + L  FR G  N+LV T V
Sbjct: 398 -GLTLIFVETKRMADQLTDFLIMQNFAATAIHGDRTQGERERALAAFRSGKANLLVATAV 456

Query: 470 AARGVDIPLLANVVNMSLPASSKIFVHRVGRTARAGNKG 508
           AARG+DIP + +V+N  LP+    +VHR+GRT RAGN G
Sbjct: 457 AARGLDIPNVTHVINYDLPSDVDDYVHRIGRTGRAGNTG 495

>TBLA0B04200 Chr2 complement(970057..971952) [1896 bp, 631 aa] {ON}
           Anc_8.614 YOR204W
          Length = 631

 Score =  191 bits (485), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 123/401 (30%), Positives = 200/401 (49%), Gaps = 67/401 (16%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLI-EKLKMH 185
           L+  ++ NI    F +PTP+Q+ +IP++ Q RD++  A+TGSGKT  F+ P++ E     
Sbjct: 162 LADLLMENIKLAHFTKPTPVQKYSIPIVEQGRDLMACAQTGSGKTGGFLFPVLSESFSTG 221

Query: 186 SA------------KIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQ 233
            A            K    A+IL+P+RELA Q     K+F   S ++  ++ GG  + +Q
Sbjct: 222 PADLPENTQSSYMRKAYPTAVILAPTRELATQIFDEAKKFTYRSWVKPCVVYGGADIRNQ 281

Query: 234 FSMMMSNPDVIIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGS-- 291
              +     +++ATPGR   L     + L +++Y+V DEADR+ +MGF+ Q+  ++    
Sbjct: 282 IRELERGCALLVATPGRLNDLLERGRISLANVKYLVLDEADRMLDMGFEPQIRHIVDGCD 341

Query: 292 LPTA--RQTLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREA 349
           +P A  RQTL+FSAT P  +   A+  L++ + + +      SEN+    L V++ ++++
Sbjct: 342 MPPAGERQTLMFSATFPDDIQHLARDFLSDYIFLSVGRVGSTSENITQHILYVEDMDKKS 401

Query: 350 NLLYLLQEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPS 409
            LL LL        A+   L                                        
Sbjct: 402 ALLDLLS-------ASNSGL---------------------------------------- 414

Query: 410 PNSTIIFVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDV 469
              T+IFV T+   + +++ L    +  + ++G   Q  R + LH FR G  ++LV T V
Sbjct: 415 ---TLIFVETKRMADELTDFLIMQNFRATAIHGDRTQSERERALHAFRNGRADLLVATAV 471

Query: 470 AARGVDIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWA 510
           AARG+DIP + +V+N  LP+    +VHR+GRT RAGN G A
Sbjct: 472 AARGLDIPNVTHVINYDLPSDIDDYVHRIGRTGRAGNTGTA 512

>ADL273C Chr4 complement(225068..226939) [1872 bp, 623 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR204W
           (DED1) and YPL119C (DBP1)
          Length = 623

 Score =  191 bits (484), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 121/400 (30%), Positives = 198/400 (49%), Gaps = 66/400 (16%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLI------- 179
           L + +L NI    F +PTP+Q+ ++P++ + RD++  A+TGSGKT  F+ P++       
Sbjct: 153 LDELLLENIKLARFTKPTPVQKYSVPIVAKGRDLMACAQTGSGKTGGFLFPVLSQSFSNG 212

Query: 180 -----EKLKMHSAKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQF 234
                ++   +  K    A++L+P+RELA Q     K+F   S ++  ++ GG  +  Q 
Sbjct: 213 PASTPDESGYYMRKAYPTAVVLAPTRELATQIFDEAKKFTYRSWVKPCVVYGGADIRQQI 272

Query: 235 SMMMSNPDVIIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELL--GSL 292
             +    D+I+ATPGR   L     + L S++Y+V DEADR+ +MGF+ Q+  ++    +
Sbjct: 273 RELERGCDLIVATPGRLNDLLERGKISLCSVKYLVLDEADRMLDMGFEPQIRHIVEGCDM 332

Query: 293 PTA--RQTLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREAN 350
           PT   RQTL+FSAT P+ +   A   L + + + +      SEN+    L V++ ++ + 
Sbjct: 333 PTVENRQTLMFSATFPTDIQHLAADFLKDYIFLSVGRVGSTSENITQKVLHVEDIDKRSV 392

Query: 351 LLYLLQEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSP 410
           LL LL        A++  L                                         
Sbjct: 393 LLDLL-------AASDGGL----------------------------------------- 404

Query: 411 NSTIIFVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVA 470
             T++FV T+   + +++ L       + ++G   Q  R + L  FR G  N+LV T VA
Sbjct: 405 --TLVFVETKRMADALTDFLIMQNLSATAIHGDRTQAERERALAFFRTGRANVLVATAVA 462

Query: 471 ARGVDIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWA 510
           ARG+DIP + +V+N  LP+    +VHR+GRT RAGN G A
Sbjct: 463 ARGLDIPNVTHVINYDLPSDIDDYVHRIGRTGRAGNTGLA 502

>Kpol_1072.50 s1072 complement(115009..116961) [1953 bp, 650 aa]
           {ON} complement(115009..116961) [1953 nt, 651 aa]
          Length = 650

 Score =  191 bits (484), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 121/401 (30%), Positives = 200/401 (49%), Gaps = 67/401 (16%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEK----- 181
           L   +L NI    F +PTP+Q+ ++P++ + RD++  A+TGSGKT  F+ P++ +     
Sbjct: 167 LDALLLENIILARFTKPTPVQKYSVPIVSRGRDLMACAQTGSGKTGGFLFPVLSESFKNG 226

Query: 182 --------LKMHSAKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQ 233
                    K    K    A++L+P+RELA Q +   K+F   S +R  ++ GG  +  Q
Sbjct: 227 PSPMPESARKSFVKKAYPTALVLAPTRELATQIYDEAKKFTYRSWVRPTVVYGGSDIGSQ 286

Query: 234 FSMMMSNPDVIIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGS-- 291
              +    D+++ATPGR   L     + L +++Y+V DEADR+ +MGF+ Q+ +++    
Sbjct: 287 IRDLSRGCDLLVATPGRLSDLLERGRVSLANVKYLVLDEADRMLDMGFEPQIRQIVDGCD 346

Query: 292 LPTA--RQTLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREA 349
           +P    RQTL+FSAT P  +   A+  L++ + + +      SEN+    L V++ ++++
Sbjct: 347 MPPVGERQTLMFSATFPDDIQHLARDFLSDYIFLSVGKVGSTSENITQRILYVEDMDKKS 406

Query: 350 NLLYLLQEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPS 409
            LL LL        A+ + L                                        
Sbjct: 407 TLLDLLS-------ASNDGL---------------------------------------- 419

Query: 410 PNSTIIFVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDV 469
              T+IFV T+   + +++ L    +  + ++G   Q  R + L  F+ G  N+LV T V
Sbjct: 420 ---TLIFVETKRMADELTDFLIMQDFRATAIHGDRTQSERERALAAFKNGNANLLVATAV 476

Query: 470 AARGVDIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWA 510
           AARG+DIP + +VVN  LP+    +VHR+GRT RAGN G A
Sbjct: 477 AARGLDIPNVTHVVNYDLPSDIDDYVHRIGRTGRAGNTGVA 517

>Smik_6.318 Chr6 (498013..499854) [1842 bp, 613 aa] {ON} YPL119C
           (REAL)
          Length = 613

 Score =  190 bits (482), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 122/402 (30%), Positives = 197/402 (49%), Gaps = 69/402 (17%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKL---- 182
           L   ++ NI   GF +PTP+Q+ +IP++ + RD++  A+TGSGKT  F+ PL  +L    
Sbjct: 157 LDALLMENIKLAGFNKPTPVQKYSIPIVTKGRDLMACAQTGSGKTGGFLFPLFTELFRFG 216

Query: 183 ---------KMHSAKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQ 233
                      +S K    A++L+P+RELA Q  +  ++F   S +R  ++ GG  + +Q
Sbjct: 217 PSPVPEKTQSFYSRKGYPSALVLAPTRELATQIFEEARKFTYRSWVRPCVVYGGAPIGNQ 276

Query: 234 FSMMMSNPDVIIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELL--GS 291
              +    D+++ATPGR   L     + L +I+Y+V DEADR+ +MGF+ Q+  ++    
Sbjct: 277 MREVDRGCDLLVATPGRLNDLLERGKISLANIKYLVLDEADRMLDMGFEPQIRHIVEGCD 336

Query: 292 LPTA--RQTLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKN-DERE 348
           +P+   RQTL+FSAT P  +   A+  L N + + +      SEN+    L V + D++ 
Sbjct: 337 MPSVGNRQTLMFSATFPVDIQHLARDFLDNYIFLSVGRVGSTSENITQRILYVDDLDKKS 396

Query: 349 ANLLYLLQEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMP 408
           A L  L  E   +                                               
Sbjct: 397 ALLDLLSAEHTGL----------------------------------------------- 409

Query: 409 SPNSTIIFVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTD 468
               T+IFV T+   + +++ L    +  + ++G   Q  R + L  F+  + +ILV T 
Sbjct: 410 ----TLIFVETKRMADQLTDFLIMQNFKATAIHGDRTQAERERALFAFKTNVADILVATA 465

Query: 469 VAARGVDIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWA 510
           VAARG+DIP + +V+N  LP+    +VHR+GRT RAGN G A
Sbjct: 466 VAARGLDIPNVTHVINYDLPSDIDDYVHRIGRTGRAGNTGVA 507

>KLTH0D09746g Chr4 (805863..807728) [1866 bp, 621 aa] {ON} similar
           to uniprot|P06634 Saccharomyces cerevisiae YOR204W DED1
           ATP-dependent DEAD (Asp-Glu-Ala- Asp)-box RNA helicase
           required for translation initiation of all yeast mRNAs
           mutations in human DEAD-box DBY are a frequent cause of
           male infertility
          Length = 621

 Score =  190 bits (483), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 122/401 (30%), Positives = 199/401 (49%), Gaps = 67/401 (16%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLI------- 179
           L + +L NI +  F +PTP+Q+ ++P+I  +RD++  A+TGSGKT  F+ P++       
Sbjct: 156 LDQLLLDNIIKARFTKPTPVQKYSVPIIAARRDLMACAQTGSGKTGGFLFPVLSESFANG 215

Query: 180 ------EKLKMHSAKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQ 233
                 +    +  K    A++L+P+RELA Q     K+F   S +R  ++ GG  +  Q
Sbjct: 216 PAPVPEQASNFYIKKAFPTAVVLAPTRELATQIFDEAKKFTYRSWVRPCVVYGGADIGSQ 275

Query: 234 FSMMMSNPDVIIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELL--GS 291
              +    D+++ATPGR   L     + L +I+Y+V DEADR+ +MGF+ Q+  ++    
Sbjct: 276 IKELNRGCDLLVATPGRLSDLLERGRISLCNIKYLVLDEADRMLDMGFEPQIRHIVEGCD 335

Query: 292 LPTA--RQTLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREA 349
           +P+   RQTL+FSAT P  +   A+  L + V + +      SEN+    L V++ ++++
Sbjct: 336 MPSVDERQTLMFSATFPMDIQHLARDFLKDYVFLSVGRVGSTSENITQHVLYVEDMDKKS 395

Query: 350 NLLYLLQEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPS 409
            LL LL        A+++ L                                        
Sbjct: 396 ALLDLL-------AASDDGL---------------------------------------- 408

Query: 410 PNSTIIFVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDV 469
              T+IFV T+   + +++ L       + ++G   Q  R + L  FR G  ++LV T V
Sbjct: 409 ---TLIFVETKRMADALTDFLIMQNLRATAIHGDRSQSERERALAAFRSGKASLLVATAV 465

Query: 470 AARGVDIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWA 510
           AARG+DIP + +V+N  LP     +VHR+GRT RAGN G A
Sbjct: 466 AARGLDIPNVTHVINYDLPNDIDDYVHRIGRTGRAGNTGVA 506

>SAKL0H08162g Chr8 complement(702292..704166) [1875 bp, 624 aa] {ON}
           similar to uniprot|P06634 Saccharomyces cerevisiae
           YOR204W DED1 ATP-dependent DEAD (Asp-Glu-Ala-Asp)-box
           RNA helicase required for translation initiation of all
           yeast mRNAs mutations in human DEAD-box DBY are a
           frequent cause of male infertility
          Length = 624

 Score =  190 bits (483), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 121/401 (30%), Positives = 198/401 (49%), Gaps = 67/401 (16%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLI------- 179
           L++ +L NI    F +PTP+Q+ ++P++   RD++  A+TGSGKT  F+ P++       
Sbjct: 158 LNELLLDNIKSARFTKPTPVQKYSVPIVAAGRDLMACAQTGSGKTGGFLFPVLSESFNNG 217

Query: 180 ------EKLKMHSAKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQ 233
                 +    +  K    A++L+P+RELA Q     K+F   S ++  ++ GG  +  Q
Sbjct: 218 PAPVPEQASSFYIRKAYPTAVVLAPTRELATQIFDEAKKFTYRSWVKPCVVYGGADIRSQ 277

Query: 234 FSMMMSNPDVIIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELL--GS 291
              +    D+++ATPGR   L     + L +++Y+V DEADR+ +MGF+ Q+  ++    
Sbjct: 278 IRELERGCDLLVATPGRLNDLLERGKISLCNVKYLVLDEADRMLDMGFEPQIRHIVQDCD 337

Query: 292 LPTA--RQTLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREA 349
           +P+A  RQTL+FSAT P  +   A+  L + + + +      SEN+    L V++ ++ +
Sbjct: 338 MPSAENRQTLMFSATFPMDIQHLARDFLEDYIFLSVGRVGSTSENITQKVLYVEDADKRS 397

Query: 350 NLLYLLQEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPS 409
            LL LL        AT+  L                                        
Sbjct: 398 ALLDLL-------AATDGGL---------------------------------------- 410

Query: 410 PNSTIIFVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDV 469
              T+IFV T+   + +++ L       + ++G   Q  R + L  FR G  N+LV T V
Sbjct: 411 ---TLIFVETKRMADALTDFLIMQELKATAIHGDRSQPERERALAAFRSGRANLLVATAV 467

Query: 470 AARGVDIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWA 510
           AARG+DIP + +V+N  LP+    +VHR+GRT RAGN G A
Sbjct: 468 AARGLDIPNVTHVINYDLPSDIDDYVHRIGRTGRAGNTGVA 508

>KLTH0H05852g Chr8 complement(514352..516787) [2436 bp, 811 aa] {ON}
           similar to uniprot|P21372 Saccharomyces cerevisiae
           YBR237W PRP5 RNA helicase in the DEAD-box family
          Length = 811

 Score =  192 bits (488), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 114/385 (29%), Positives = 201/385 (52%), Gaps = 53/385 (13%)

Query: 139 GFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLK----MHSAKIGARAM 194
            F  PTPIQ + IP I+  RD++G+++TGSGKT +F+LPL+ ++K    + S + G   +
Sbjct: 252 AFVSPTPIQAQAIPAIMAGRDVIGISKTGSGKTVSFLLPLLRQIKALRPLTSGETGPMGL 311

Query: 195 ILSPSRELAMQTHKVFKEFAKG-SNLRSVLLTGGDGLEDQFSMMMSNPDVIIATPGRFLH 253
           IL+P+RELA+Q H+  ++F    S LRS+  TGG  L+ Q   +    ++++ATPGRF+ 
Sbjct: 312 ILAPTRELAVQIHEETEKFLNPVSKLRSICCTGGSELKQQIKELKKGVEIVVATPGRFID 371

Query: 254 LKVEMN----LDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSATLPSSL 309
           L + +N    L+   + +VV DEADRLF++GF+ Q+ E++ ++   +Q +LFSAT P+ L
Sbjct: 372 L-LTLNSGKLLNTERVTFVVMDEADRLFDLGFEPQITEIMKTIRPDKQCVLFSATFPTKL 430

Query: 310 VDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDERE-ANLLYLLQEVIKIPVATEEQ 368
             FA   L  P+ + +++++ ++EN+E       NDE +   LL +L++  ++       
Sbjct: 431 KSFASRILDRPISITINSKSLINENIEQQLRIYDNDESKFEGLLDILRKQTQM------- 483

Query: 369 LQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYVSN 428
                                              + D       I+F+S++   + +  
Sbjct: 484 -----------------------------------SSDDERDEKIIVFLSSQQICDLIYY 508

Query: 429 LLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSLP 488
            L++  Y    ++     + R   L  F+     IL+ T+V +RG+++P ++ V+  +  
Sbjct: 509 RLQEQNYTTYAIHAGKPYNERASSLEKFKNTKNGILLCTEVLSRGLNVPEVSLVIIYNAV 568

Query: 489 ASSKIFVHRVGRTARAGNKGWAYTI 513
            +   +VH  GRTAR    G A T+
Sbjct: 569 KTFAQYVHTTGRTARGDKHGTAVTL 593

>KAFR0C02220 Chr3 complement(439704..441239) [1536 bp, 511 aa] {ON}
           Anc_6.204 YGL078C
          Length = 511

 Score =  187 bits (474), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 116/379 (30%), Positives = 190/379 (50%), Gaps = 51/379 (13%)

Query: 140 FRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHSAKIGARAMILSPS 199
           F +PTPIQ  + P +L  +D++G+A TGSGKT AF +P I  L   S K     +++SP+
Sbjct: 118 FPKPTPIQAASWPYLLAGKDVIGVAETGSGKTFAFGVPAIHSLVSSSNKKDISVLVISPT 177

Query: 200 RELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIATPGRFLHLKVEMN 259
           RELA Q +           L    + GG   ++Q   +  +  V++ATPGR L L  E +
Sbjct: 178 RELASQIYDNLIILTDKVGLECCCIYGGVPKDEQRKQLRRS-QVVVATPGRLLDLIQEGS 236

Query: 260 LDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLP---TARQTLLFSATLPSSLVDFAKAG 316
           ++L  ++Y+V DEADR+ E GF+E +  ++         RQTL+F+AT P  + + A   
Sbjct: 237 VNLSKVQYLVLDEADRMLEKGFEEDIKNIIKETNGNRANRQTLMFTATWPKEVRELASTF 296

Query: 317 LTNPVLVRLDTETKVSEN--LEMLFLSVKNDEREANLLYLLQEVIKIPVATEEQLQRFRX 374
           + +PV V +    +++ N  +  +   V+   +E  LL L              L++++ 
Sbjct: 297 MRDPVKVSIGNRDELTANKRITQIVEVVEPHTKERKLLDL--------------LKKYQG 342

Query: 375 XXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYVSNLLKDCG 434
                                               +  +IF   +     V   L+  G
Sbjct: 343 GAKKN-------------------------------DKVLIFALYKKEAARVERNLRYNG 371

Query: 435 YLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSLPASSKIF 494
           Y V+ ++G L Q  R Q L++F+ G +++L+ TDVAARG+DIP +  V+N++ P + + +
Sbjct: 372 YDVAAIHGDLSQQQRTQALNDFKQGKSSLLLATDVAARGLDIPNVKTVINLTFPLTVEDY 431

Query: 495 VHRVGRTARAGNKGWAYTI 513
           VHR+GRT RAG  G A+T+
Sbjct: 432 VHRIGRTGRAGQTGVAHTL 450

>KNAG0H01520 Chr8 complement(267709..269574) [1866 bp, 621 aa] {ON}
           Anc_8.614 YOR204W
          Length = 621

 Score =  189 bits (480), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 119/406 (29%), Positives = 196/406 (48%), Gaps = 69/406 (16%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKL---- 182
           L + +  N+ R GF +PTP+Q+ +IP++   RD++G A+TGSGKT  F+ P++ ++    
Sbjct: 143 LEQLLFDNVQRAGFSKPTPVQKYSIPIVTAGRDLMGCAQTGSGKTGGFLFPILSEMFTAG 202

Query: 183 -----------KMHSAKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLE 231
                        +  K+   A++L+P+RELA Q  +  ++F   S +R  ++ GG  + 
Sbjct: 203 PAPKPQAASGGYSYQRKVYPTALVLAPTRELATQIFEEARKFTYRSWVRPCVVYGGAPVG 262

Query: 232 DQFSMMMSNPDVIIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELL-- 289
            Q   +    D+++ATPGR   L     + L +I+Y+  DEADR+ +MGF+ Q+  ++  
Sbjct: 263 AQMGELERGCDLLVATPGRLNDLLERGKISLANIKYLTLDEADRMLDMGFEPQIRHIVED 322

Query: 290 GSLPTA--RQTLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDER 347
             +P    RQTL+FSAT P  +   A+  L + + + +      SEN+    L V + ++
Sbjct: 323 CDMPPVNERQTLMFSATFPRDIQHLARDFLNDYIFLSVGRVGSTSENITQKVLYVDDMDK 382

Query: 348 EANLLYLLQEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDM 407
           ++ LL L                                              L S K  
Sbjct: 383 KSALLDL----------------------------------------------LSSTKG- 395

Query: 408 PSPNSTIIFVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVT 467
                T+IFV T+   + +++ L       + ++G   Q  R + L  F+ G  ++LV T
Sbjct: 396 ---GLTLIFVETKRMADQLTDFLIMQNIRATAIHGDRTQMERERALGAFKSGTADVLVAT 452

Query: 468 DVAARGVDIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWAYTI 513
            VAARG+DIP +  V+N  LP     +VHR+GRT RAGN G A + 
Sbjct: 453 AVAARGLDIPNVTLVINYDLPGDIDDYVHRIGRTGRAGNTGTAISF 498

>KLLA0F23716g Chr6 complement(2215454..2215845,2216857..2218129)
           [1665 bp, 554 aa] {ON} similar to uniprot|P24783
           Saccharomyces cerevisiae YNL112W DBP2 Essential
           ATP-dependent RNA helicase of the DEAD-box protein
           family involved in nonsense-mediated mRNA decay and rRNA
           processing
          Length = 554

 Score =  187 bits (474), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 113/387 (29%), Positives = 194/387 (50%), Gaps = 51/387 (13%)

Query: 130 FILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMH---S 186
           ++L  + ++GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I  +      S
Sbjct: 123 YVLDEVKQEGFAKPTGIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIVHINAQPLLS 182

Query: 187 AKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIA 246
              G   ++L+P+RELA+Q  K   +F   S +R+  + GG     Q   +    +++IA
Sbjct: 183 PGDGPIVLVLAPTRELAVQIQKECSKFGASSRIRNTCVYGGVPKSQQIRDLQRGVEILIA 242

Query: 247 TPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSATLP 306
           TPGR + +      +L  + Y+V DEADR+ +MGF+ Q+ +++  +   RQTL++SAT P
Sbjct: 243 TPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWP 302

Query: 307 SSLVDFAKAGLTNPVLVRLDT-ETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVAT 365
             +   A   L +P+ V++ + E   S  +  +   + + E+   L   L+       A+
Sbjct: 303 KEVKQLASDYLHDPIQVQIGSLELSASHTITQIVEVLTDFEKRDRLAKHLE------TAS 356

Query: 366 EEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEY 425
           ++Q  +                                          IIF ST+   + 
Sbjct: 357 QDQDSKI-----------------------------------------IIFASTKRTCDE 375

Query: 426 VSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNM 485
           +++ L+  G+    ++G   Q+ R   L  FR G + I+V TDVAARG+D+  +  V+N 
Sbjct: 376 ITSYLRTEGWPALAIHGDKAQNERDWVLAEFRSGRSPIMVATDVAARGIDVKGINYVINY 435

Query: 486 SLPASSKIFVHRVGRTARAGNKGWAYT 512
            +P + + +VHR+GRT RAG+ G A +
Sbjct: 436 DMPGNIEDYVHRIGRTGRAGSTGTAIS 462

>ZYRO0F10934g Chr6 (890412..892223) [1812 bp, 603 aa] {ON} similar
           to uniprot|P06634 Saccharomyces cerevisiae YOR204W DED1
           ATP-dependent DEAD (Asp-Glu-Ala-Asp)-box RNA helicase
           required for translation initiation of all yeast mRNAs
           mutations in human DEAD-box DBY are a frequent cause of
           male infertility
          Length = 603

 Score =  188 bits (477), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 121/401 (30%), Positives = 199/401 (49%), Gaps = 67/401 (16%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLI-EKLKMH 185
           L + +L NI    F +PTP+Q+ +IP++  +RD++  A+TGSGKT  F+ P++ E     
Sbjct: 140 LDELLLENIKFAHFVKPTPVQKYSIPIVANKRDLMACAQTGSGKTGGFLFPVLSESFFTG 199

Query: 186 SAKI--GAR----------AMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQ 233
            ++I   AR          A++L+P+RELA Q     K+F   S +R  ++ GG  +  Q
Sbjct: 200 PSEIPEAARSSYMRKAFPTAVVLAPTRELATQIFDEAKKFTYRSWVRPTVVYGGSDVGSQ 259

Query: 234 FSMMMSNPDVIIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELL--GS 291
              +    D+++ATPGR   L     + L  ++Y+V DEADR+ +MGF+ Q+  ++    
Sbjct: 260 MRDLDRGCDLLVATPGRLNDLLERGKISLAKVKYLVLDEADRMLDMGFEPQIRNIVEGCD 319

Query: 292 LPTA--RQTLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREA 349
           +P    RQTL+FSAT P  +   A+  L++ + + +      SEN+    L V+++++++
Sbjct: 320 MPGVDQRQTLMFSATFPVDIQHLARDFLSDYIFLSVGRVGSTSENITQRVLYVEDEDKKS 379

Query: 350 NLLYLLQEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPS 409
            LL LL                                                     S
Sbjct: 380 ALLDLLS--------------------------------------------------ASS 389

Query: 410 PNSTIIFVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDV 469
              T+IFV T+   + +++ L    +  + ++G   Q  R + L +F+ G  ++LV T V
Sbjct: 390 GGLTLIFVETKRMADQLTDFLIMQNFRATAIHGDRTQSERERALGSFKTGKADLLVATAV 449

Query: 470 AARGVDIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWA 510
           AARG+DIP + +V+N  LP     +VHR+GRT RAGN G A
Sbjct: 450 AARGLDIPNVTHVINYDLPGDVDDYVHRIGRTGRAGNTGLA 490

>ZYRO0G14960g Chr7 (1201495..1203990) [2496 bp, 831 aa] {ON} similar
           to uniprot|P21372 Saccharomyces cerevisiae YBR237W PRP5
           RNA helicase in the DEAD-box family
          Length = 831

 Score =  191 bits (484), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 118/387 (30%), Positives = 206/387 (53%), Gaps = 49/387 (12%)

Query: 140 FRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLK----MHSAKIGARAMI 195
           F  PT IQ + IP I+  RD++G+++TGSGKT +++LPLI  +K    + S + G   ++
Sbjct: 261 FENPTSIQAQAIPAIMCGRDVIGISKTGSGKTISYLLPLIRHIKAQRHLASDESGPLGLV 320

Query: 196 LSPSRELAMQTHKVFKEF-AKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIATPGRFLHL 254
           L+P+RELA+Q ++   +F AK  ++ SV  TGG  L++Q   +    ++++ATPGRF+ L
Sbjct: 321 LAPTRELAIQINEEVTKFTAKDKSVNSVCCTGGSELKEQIRKLKKGIEIVVATPGRFIDL 380

Query: 255 KVEMN----LDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSATLPSSLV 310
            + +N    L    I +V+ DEADRLF+MGF+ Q+ +++ ++   +Q +LFSAT P+ L 
Sbjct: 381 -LTLNTGKLLSTRRITFVIMDEADRLFDMGFEPQITQIMKTIRPDKQCVLFSATFPNKLR 439

Query: 311 DFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVATEEQLQ 370
           +FA   L  P+ + +++++ V+EN+   F    +DE + N L      ++I    EE   
Sbjct: 440 NFAMRVLHRPLSITINSKSLVNENVTQRFDIANSDEEKFNTL------LRILEKHEE--- 490

Query: 371 RFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNS----TIIFVSTRHHVEYV 426
                                         +P  +D     +     IIFVS++   + +
Sbjct: 491 --------------------------SSNGVPMQQDWNDSENKDEKAIIFVSSQQICDLL 524

Query: 427 SNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMS 486
              L++ GY +  ++       R   L NF+    +IL+ T+V +RG+++P ++ V+  +
Sbjct: 525 HIKLENEGYTIYSIHAGKPYQERLNNLENFKSTPNSILLCTEVLSRGLNVPEVSLVLIYN 584

Query: 487 LPASSKIFVHRVGRTARAGNKGWAYTI 513
              +   +VH  GRTAR  + G A T+
Sbjct: 585 AVKTFAQYVHTTGRTARGTHTGVAMTL 611

>NCAS0E03920 Chr5 complement(769305..770618) [1314 bp, 437 aa] {ON} 
          Length = 437

 Score =  182 bits (463), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 126/398 (31%), Positives = 181/398 (45%), Gaps = 62/398 (15%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHS 186
           LS+++   +      QPT IQ+  IP IL+ RD +G A+TGSGKT AF  P++ K     
Sbjct: 14  LSRWLQEALQAMKINQPTAIQKACIPEILKGRDCIGGAKTGSGKTVAFAAPMLTKWSEDP 73

Query: 187 AKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIA 246
           +  G   ++L+P+RELAMQ  + F       N+R  L+ GG+ + DQ   +   P  IIA
Sbjct: 74  S--GMFGVVLTPTRELAMQIAEQFTALGSSMNIRVALVVGGESIVDQAIQLQKKPHFIIA 131

Query: 247 TPGRFLHLKVEMNLD----LHSIEYVVFDEADRLFEMGFQEQLNELLGSLPT--ARQTLL 300
           TPGR  H  +    D    L   +++V DEAD L    F   L   +G+LP+   RQTLL
Sbjct: 132 TPGRLAHHIMSSGEDTIGGLKRAKFLVLDEADSLLTDTFASDLATCIGALPSKDKRQTLL 191

Query: 301 FSATLPSSLVDFAKAGLT--NPVLVRLDTET----KVSENLEMLFLSVKNDEREANLLYL 354
           F+AT+   +     A +    P L     E+     +   L+  ++ V    +EA L  L
Sbjct: 192 FTATITDQVRALEDAPIQEGKPPLFTYQVESVDKVAIPSTLKTEYILVPEHVKEAYLYQL 251

Query: 355 LQEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTI 414
           L                                               + KD    +S I
Sbjct: 252 LT--------------------------------------------CETYKD----SSAI 263

Query: 415 IFVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGV 474
           IFV+     E +   L      V+ L+  + Q  R   LH FR  +  +L+ TDVA+RG+
Sbjct: 264 IFVNRTMTAEILRRTLYHLEVRVASLHSQMPQQERTNSLHRFRANVARVLIATDVASRGL 323

Query: 475 DIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWAYT 512
           DIP +  V+N  +PA    F+HR GRTARAG  G A +
Sbjct: 324 DIPTVELVINYDIPADPDTFIHRAGRTARAGRSGDAIS 361

>YBR237W Chr2 (691969..694518) [2550 bp, 849 aa] {ON}  PRP5RNA
           helicase in the DEAD-box family, necessary for
           prespliceosome formation, bridges U1 and U2 snRNPs and
           enables stable U2 snRNP association with intron RNA
          Length = 849

 Score =  190 bits (482), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 114/387 (29%), Positives = 210/387 (54%), Gaps = 47/387 (12%)

Query: 140 FRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLK----MHSAKIGARAMI 195
           F   TPIQ + +P I+  RD++G+++TGSGKT +++LPL+ ++K    +   + G   +I
Sbjct: 276 FGSLTPIQSQALPAIMSGRDVIGISKTGSGKTISYLLPLLRQVKAQRPLSKHETGPMGLI 335

Query: 196 LSPSRELAMQTHKVFKEFAKG-SNLRSVLLTGGDGLEDQFSMMMSNPDVIIATPGRFLHL 254
           L+P+RELA+Q H+   +F +  +++RSV  TGG  ++ Q + +    ++++ATPGRF+ +
Sbjct: 336 LAPTRELALQIHEEVTKFTEADTSIRSVCCTGGSEMKKQITDLKRGTEIVVATPGRFIDI 395

Query: 255 KVEMN----LDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSATLPSSLV 310
            + +N    L    I +VV DEADRLF++GF+ Q+ +++ ++   +Q +LFSAT P+ L 
Sbjct: 396 -LTLNDGKLLSTKRITFVVMDEADRLFDLGFEPQITQIMKTVRPDKQCVLFSATFPNKLR 454

Query: 311 DFAKAGLTNPVLVRLDTETKVSENLEMLF-LSVKNDEREANLLYLLQEVIKI--PVATEE 367
            FA   L +P+ + ++++  V+EN++  F +    DE+  NL+ L+ E  +    V +E 
Sbjct: 455 SFAVRVLHSPISITINSKGMVNENVKQKFRICHSEDEKFDNLVQLIHERSEFFDEVQSEN 514

Query: 368 QLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNS-TIIFVSTRHHVEYV 426
             Q                                 + D+   ++  IIFVS+++  +++
Sbjct: 515 DGQ---------------------------------SSDVEEVDAKAIIFVSSQNICDFI 541

Query: 427 SNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMS 486
           S  L + G +   ++       R   L  F+    +IL+ T+V +RG+++P ++ V+  +
Sbjct: 542 SKKLLNAGIVTCAIHAGKPYQERLMNLEKFKREKNSILLCTEVLSRGLNVPEVSLVIIYN 601

Query: 487 LPASSKIFVHRVGRTARAGNKGWAYTI 513
              +   +VH  GRTAR    G A T+
Sbjct: 602 AVKTFAQYVHTTGRTARGSRSGTAITL 628

>TBLA0D03520 Chr4 (873710..876379) [2670 bp, 889 aa] {ON} Anc_6.148
           YBR237W
          Length = 889

 Score =  190 bits (482), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 117/386 (30%), Positives = 199/386 (51%), Gaps = 47/386 (12%)

Query: 140 FRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLK----MHSAKIGARAMI 195
           F  PTPIQ + IP I+  +DI+G+++TGSGKT A++LPL+  ++    +   + G  A++
Sbjct: 310 FETPTPIQAQAIPAIMSGKDIIGISKTGSGKTIAYILPLLRHVRAQKPLSRNETGPIALV 369

Query: 196 LSPSRELAMQTHKVFKEFAKGSN--LRSVLLTGGDGLEDQFSMMMSNPDVIIATPGRFLH 253
           L+P+RELA+Q +     F    N  L S+   GG  L  Q +++     +I+ATPGR++ 
Sbjct: 370 LAPTRELAIQINDEINNFLSNDNYQLNSICCAGGSDLRGQINIIKKGVSIIVATPGRYID 429

Query: 254 LKVEMNLDLHS---IEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSATLPSSLV 310
           L      +L +   I ++V DEADRLF++GF+ Q+++++ ++   +  +LFSAT P  L 
Sbjct: 430 LLTLNGGNLLNTKRISFIVMDEADRLFDLGFEPQISQIMKTIRPDKHGVLFSATFPKKLR 489

Query: 311 DFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKND-EREANLLYLLQEVIKIPVATEEQL 369
            FA   L +P+ + +D+E  ++EN+E  F   K+D E+  NLL +L +            
Sbjct: 490 SFALKALNSPITITIDSENMINENIEQKFKICKSDNEKFNNLLDILNK------------ 537

Query: 370 QRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNS--TIIFVSTRHHVEYVS 427
                                        Q   S   + + N    IIFVS++   E + 
Sbjct: 538 -----------------------HDYENIQSSASRDGISNENDKKIIIFVSSQQISELIY 574

Query: 428 NLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSL 487
           N L++ G+    ++     + R Q L NFR    +IL+ T+V +RG+++P  + V+  + 
Sbjct: 575 NKLENNGFSPFLIHAGKPYNERVQNLENFRRAKNSILLCTEVLSRGLNVPETSLVIIYNA 634

Query: 488 PASSKIFVHRVGRTARAGNKGWAYTI 513
             +   +VH  GRT R   +G A ++
Sbjct: 635 VKAFAQYVHTTGRTGRGIYRGVAISL 660

>KLLA0F10505g Chr6 complement(966736..969174) [2439 bp, 812 aa] {ON}
           similar to uniprot|Q754U8 Ashbya gossypii AFL027C PRP5
           Pre-mRNA-processing ATP-dependent RNA helicase PRP5 and
           weakly similar to YBR237W uniprot|P21372 Saccharomyces
           cerevisiae PRP5 RNA helicase in the DEAD-box family
          Length = 812

 Score =  188 bits (477), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 118/383 (30%), Positives = 195/383 (50%), Gaps = 56/383 (14%)

Query: 140 FRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLK----MHSAKIGARAMI 195
           F   TPIQ + IP I+  RD++G+++TGSGKT AF+LPL+ ++K    +   + G   +I
Sbjct: 266 FVTLTPIQCQAIPAIMSGRDVIGISKTGSGKTVAFLLPLVRQIKAQPPLAPDETGPIGLI 325

Query: 196 LSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIATPGRFLHLK 255
           L+P+RELA+Q  +   +F KGS + S+   GG  L+ Q + +    D+I+ATPGRF+ L 
Sbjct: 326 LTPTRELAVQIQEEALKFCKGSGISSICCVGGSELKQQINELKRGVDIIVATPGRFIDLM 385

Query: 256 VEMNLDLHS---IEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSATLPSSLVDF 312
              +  L S   I +VV DEADRLF++GF  Q+N+++G +   +Q +LFSAT PS L  F
Sbjct: 386 TLNSGHLLSPTRISFVVMDEADRLFDLGFGPQVNQIMGCIRPDKQCVLFSATFPSKLKHF 445

Query: 313 AKAGLTNPVLVRLDTETKVSENLE---MLFLSVKNDEREANLLYLLQEVIKIPVATEEQL 369
           A   L NP+ + +++++ ++EN++    +F     DE      +LL+ +        ++L
Sbjct: 446 ASRTLKNPIQITINSKSLINENIQQRVQIF-----DEEHVKFEFLLKRL-------SDRL 493

Query: 370 QRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYVSNL 429
              R                                       TIIFV ++   + + + 
Sbjct: 494 ALHRG----------------------------------EDEKTIIFVGSQQLCDLLYDE 519

Query: 430 LKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSLPA 489
           L   G     ++       R + L  F+     IL+ T+V +RG+++P ++ V+  +   
Sbjct: 520 LLLNGITTFPIHAGKPSAERLRNLQKFKETDNGILICTEVLSRGLNVPEVSLVIIYNAAK 579

Query: 490 SSKIFVHRVGRTARAGNKGWAYT 512
           +   +VH VGRT R  N G A +
Sbjct: 580 TIAQYVHTVGRTGRGTNNGVALS 602

>Smik_8.253 Chr8 (419155..420468) [1314 bp, 437 aa] {ON} YHR169W
           (REAL)
          Length = 437

 Score =  180 bits (457), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 131/399 (32%), Positives = 182/399 (45%), Gaps = 64/399 (16%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHS 186
           LSK++  ++      QPT IQR  IP IL+ RD +G A+TGSGKT AF  P++ K     
Sbjct: 15  LSKWLTESLKAMKITQPTAIQRACIPKILEGRDCIGGAKTGSGKTIAFAGPMLTKWSEDP 74

Query: 187 AKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIA 246
              G   ++L+P+RELAMQ  + F       N+R  ++ GG+ +  Q   +   P  IIA
Sbjct: 75  C--GMFGVVLTPTRELAMQIAEQFTALGSSMNIRVSVVVGGESIVQQALDLQRKPHFIIA 132

Query: 247 TPGRFLHLKVEMNLD----LHSIEYVVFDEADRLFEMGFQEQLNELLGSLPT--ARQTLL 300
           TPGR  H  +    D    L   +Y+V DEAD L    F   L   +G+LP    RQTLL
Sbjct: 133 TPGRLAHHIMSSGDDTVGGLMRTKYLVLDEADILLTSTFAGHLATCIGALPPKDKRQTLL 192

Query: 301 FSATLPS---SLVDFAKAGLTNPVLVRLDTET----KVSENLEMLFLSVKNDEREANLLY 353
           F+AT+     SL D A A    P L     E+     +   L+  ++ V    +EA L  
Sbjct: 193 FTATITDQVRSLQD-APAQEAKPPLFAYQVESVDNVAIPSTLKTEYILVPEHVKEAYLYQ 251

Query: 354 LLQEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNST 413
           LL         T E+ +                                         + 
Sbjct: 252 LL---------TCEEYEN---------------------------------------KTA 263

Query: 414 IIFVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARG 473
           IIFV+     E +   LK     V+ L+  + Q  R   LH FR     +L+ TDVA+RG
Sbjct: 264 IIFVNRTMTAEILRRTLKQLEVRVASLHSQMPQQERTNSLHRFRANAARVLIATDVASRG 323

Query: 474 VDIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWAYT 512
           +DIP +  VVN  +P+   +F+HR GRTARAG  G A +
Sbjct: 324 LDIPTVELVVNYDIPSDPDVFIHRAGRTARAGRNGDAIS 362

>SAKL0E10670g Chr5 complement(888829..889205,889934..891281) [1725
           bp, 574 aa] {ON} similar to uniprot|P24783 Saccharomyces
           cerevisiae YNL112W DBP2 Essential ATP-dependent RNA
           helicase of the DEAD-box protein family involved in
           nonsense-mediated mRNA decay and rRNA processing
          Length = 574

 Score =  183 bits (465), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 111/388 (28%), Positives = 190/388 (48%), Gaps = 51/388 (13%)

Query: 130 FILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMH---S 186
           ++L  +  +GF  PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I  +       
Sbjct: 148 YVLSEVKAQGFPSPTGIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIVHINAQPLLG 207

Query: 187 AKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIA 246
              G   ++L+P+RELA+Q  K   +F K S +R+  + GG     Q   +    ++ IA
Sbjct: 208 PGDGPIVLVLAPTRELAVQIQKECSKFGKSSRIRNTCVYGGVPRGQQIRDLQRGAEICIA 267

Query: 247 TPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSATLP 306
           TPGR + +      +L  + Y+V DEADR+ +MGF+ Q+ +++  +   RQTL++SAT P
Sbjct: 268 TPGRLIDMLEMGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWP 327

Query: 307 SSLVDFAKAGLTNPVLVRLDT-ETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVAT 365
             +   A+  L + + V + + E   S N+  +   V + ++   L      V  + VA+
Sbjct: 328 KEVQQLAQDYLHDYIQVNVGSLELAASHNITQVIEVVSDFDKRDRL------VKHMEVAS 381

Query: 366 EEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEY 425
           ++                                         + +  ++F ST+   + 
Sbjct: 382 QD-----------------------------------------AESKILVFASTKRMCDE 400

Query: 426 VSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNM 485
           ++  L++ G+    ++G   Q  R   L  FR G + I+V TDVAARG+D+  +  V+N 
Sbjct: 401 ITKYLREDGWPALAIHGDKQQQERDWVLEEFRSGRSPIMVATDVAARGIDVKGINFVINY 460

Query: 486 SLPASSKIFVHRVGRTARAGNKGWAYTI 513
            +P + + +VHR+GRT RAG  G A + 
Sbjct: 461 DMPGNIEDYVHRIGRTGRAGATGTAISF 488

>NDAI0B00900 Chr2 complement(209012..210322) [1311 bp, 436 aa] {ON}
           Anc_5.69
          Length = 436

 Score =  180 bits (456), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 127/398 (31%), Positives = 182/398 (45%), Gaps = 62/398 (15%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHS 186
           LSK++  ++S     QPT IQ   IP IL+ RD +G A+TGSGKT AF  P++ K     
Sbjct: 14  LSKWLYESLSAMKITQPTAIQSACIPEILKGRDCIGGAKTGSGKTIAFAGPMLTKWS--E 71

Query: 187 AKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIA 246
              G   ++L+P+RELAMQ  + F       N+R  ++ GG  + +Q   + + P  IIA
Sbjct: 72  DPCGMFGVVLTPTRELAMQIAEQFTALGSSMNIRVAIVVGGQSIVEQAIQLQNKPHFIIA 131

Query: 247 TPGRFLHLKVEMNLD----LHSIEYVVFDEADRLFEMGFQEQLNELLGSLPT--ARQTLL 300
           TPGR  H  +    D    L   +++V DEAD L    F   L   +G+LP    RQTLL
Sbjct: 132 TPGRLAHHIMNSGEDTVGGLKRTKFLVLDEADSLLTDSFAGDLATCIGALPPKHKRQTLL 191

Query: 301 FSATLPSSL--VDFAKAGLTNPVLVRLDTET----KVSENLEMLFLSVKNDEREANLLYL 354
           F+AT+   +  ++ A A    P +     E+     +   L+  ++ V    +EA L  L
Sbjct: 192 FTATITDQVRTLENAPAQDGKPSVFTYQVESVDKVAIPSTLKTEYILVPEHVKEAYLYQL 251

Query: 355 LQEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTI 414
           L                                               + KD    +S I
Sbjct: 252 LT--------------------------------------------CETYKD----SSAI 263

Query: 415 IFVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGV 474
           IFV+     E +   L      V+ L+  + Q  R   LH FR     +LV TDVAARG+
Sbjct: 264 IFVNRAMTAEVLRRTLYHLDVRVASLHSYMPQQERTNSLHRFRANAARVLVATDVAARGL 323

Query: 475 DIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWAYT 512
           DIP++  V+N  +P+    F+HR GRTARAG  G A +
Sbjct: 324 DIPIVELVINYDIPSDPDTFIHRAGRTARAGRSGDAIS 361

>Skud_8.233 Chr8 (413556..414869) [1314 bp, 437 aa] {ON} YHR169W
           (REAL)
          Length = 437

 Score =  180 bits (456), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 126/398 (31%), Positives = 181/398 (45%), Gaps = 62/398 (15%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHS 186
           LSK++  ++      QPT IQ+  IP IL+ RD +G A+TGSGKT AF  P++ K     
Sbjct: 15  LSKWLTESLKAMKITQPTAIQKACIPKILEGRDCIGGAKTGSGKTIAFAGPMLTKWSEDP 74

Query: 187 AKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIA 246
              G   ++L+P+RELAMQ  + F       N+R  ++ GG+ +  Q   +   P  IIA
Sbjct: 75  C--GMFGVVLTPTRELAMQIAEQFTALGSSMNIRVSVVVGGESIIQQALALQRKPHFIIA 132

Query: 247 TPGRFLHLKVEMNLD----LHSIEYVVFDEADRLFEMGFQEQLNELLGSLPT--ARQTLL 300
           TPGR  H  +    D    L   +Y+V DEAD L    F + L   +G+LP    RQTLL
Sbjct: 133 TPGRLAHHIMSSGEDTVGGLMRAKYLVLDEADILLTSTFADHLATCIGALPAKDKRQTLL 192

Query: 301 FSATLPSSLVDFAKAGLT--NPVLVRLDTET----KVSENLEMLFLSVKNDEREANLLYL 354
           F+AT+   +     A +    P L     E+     +   L+  ++ V    +EA L  L
Sbjct: 193 FTATITDQVRSLQDAPVQEGKPPLFAYQVESVDNVAIPSTLKTEYILVPEHVKEAYLYQL 252

Query: 355 LQEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTI 414
           L         T E+ +                                         + I
Sbjct: 253 L---------TCEEYEN---------------------------------------KTAI 264

Query: 415 IFVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGV 474
           IFV+     E +   LK     V+ L+  + Q  R   LH FR     +L+ TDVA+RG+
Sbjct: 265 IFVNRTMTAEILRRTLKQLEVRVASLHSQMPQQERTNSLHRFRANAARVLIATDVASRGL 324

Query: 475 DIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWAYT 512
           DIP +  VVN  +P+   +F+HR GRTARAG  G A +
Sbjct: 325 DIPTVELVVNYDIPSDPDVFIHRSGRTARAGRNGDAIS 362

>KAFR0B04480 Chr2 complement(929008..930315) [1308 bp, 435 aa] {ON}
           Anc_5.69 YHR169W
          Length = 435

 Score =  180 bits (456), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 126/398 (31%), Positives = 186/398 (46%), Gaps = 62/398 (15%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHS 186
           LSK++L ++      QPT IQ   IP IL+ RD +G A+TGSGKT  F  P++ +     
Sbjct: 12  LSKWLLDSLRAMKITQPTTIQSHCIPEILKGRDCIGGAKTGSGKTITFAAPMLARWSEDP 71

Query: 187 AKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIA 246
              G   ++L+P+RELAMQ  + F       N+R  L+ GG+ + +Q   +   P  IIA
Sbjct: 72  C--GMFGVVLTPTRELAMQIAEQFTALGSSMNIRVALIVGGESIVNQAIELQRKPHFIIA 129

Query: 247 TPGRFLHLKVEMNLD----LHSIEYVVFDEADRLFEMGFQEQLNELLGSLP--TARQTLL 300
           TPGR  H  +    D    L   +Y+V DEAD L    F + L+  +G+LP   ARQTLL
Sbjct: 130 TPGRLAHHILNSGEDTVGGLKRAKYLVLDEADFLLNDTFAKDLSTCIGALPDKNARQTLL 189

Query: 301 FSATLPSSLVDF----AKAGLTNPVLVRLDTETKVS--ENLEMLFLSVKNDEREANLLYL 354
           F+AT+   +       AK G       ++++  KV+    L++ ++ +    +EA L  L
Sbjct: 190 FTATITDQVRALQNAPAKGGKLPIFAYQVESVDKVAIPSTLKVEYILIPEHVKEAYLYQL 249

Query: 355 LQEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTI 414
           L                                               + ++  + N  I
Sbjct: 250 L-----------------------------------------------TCENYINSN-VI 261

Query: 415 IFVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGV 474
           IFV+     E +   LK     V+ L+  + Q  R   LH FR     IL+ TDVA+RG+
Sbjct: 262 IFVNRTATAEVLRKTLKHLDLRVASLHSQMSQQERTNSLHRFRANAARILIATDVASRGL 321

Query: 475 DIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWAYT 512
           DIP +  VVN  +P+    ++HR GRTARAG  G A +
Sbjct: 322 DIPTVELVVNYDIPSDPDTYIHRSGRTARAGKSGDAIS 359

>Ecym_8298 Chr8 (605258..607174) [1917 bp, 638 aa] {ON} similar to
           Ashbya gossypii ADL273C
          Length = 638

 Score =  184 bits (468), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 120/404 (29%), Positives = 195/404 (48%), Gaps = 70/404 (17%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKL---- 182
           L   +L NI    F +PTP+Q+ ++P++   RD++  A+TGSGKT  F+ P++ +     
Sbjct: 159 LDNLLLENIKMARFTRPTPVQKYSVPIVALGRDLMACAQTGSGKTGGFLFPVLSQSFGAG 218

Query: 183 ------------KMHSAKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGL 230
                         +S K    A++L+P+RELA Q     K+F   S ++  ++ GG  +
Sbjct: 219 PAVVTEESGNNNYYNSRKAYPTAVVLAPTRELATQIFDEAKKFTYRSWVKPCVVYGGADI 278

Query: 231 EDQFSMMMSNPDVIIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELL- 289
             Q   +    D+I+ATPGR   L     + L +++Y+V DEADR+ +MGF+ Q+  ++ 
Sbjct: 279 RQQLRELEHGCDLIVATPGRLNDLLERGKISLCNVKYLVLDEADRMLDMGFEPQIRHIVE 338

Query: 290 -GSLPTA--RQTLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDE 346
              +P+   RQTL+FSAT P+ +   A   L + + + +      SEN+    L V++ +
Sbjct: 339 GCDMPSVENRQTLMFSATFPTDIQHLAADFLKDYIFLSVGRVGSTSENITQKVLYVEDLD 398

Query: 347 REANLLYLLQEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKD 406
           + + LL LL        A++  L                                     
Sbjct: 399 KRSVLLDLL-------AASDGGL------------------------------------- 414

Query: 407 MPSPNSTIIFVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVV 466
                 T++FV T+   + +++ L       + ++G   Q  R + L  FR    NILV 
Sbjct: 415 ------TLVFVETKRMADALTDFLIMQNLSATAIHGDRSQAERERALQFFRTARANILVA 468

Query: 467 TDVAARGVDIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWA 510
           T VAARG+DIP + +V+N  LP+    +VHR+GRT RAGN G A
Sbjct: 469 TAVAARGLDIPNVTHVINYDLPSDIDDYVHRIGRTGRAGNTGLA 512

>Kpol_534.31 s534 complement(73551..76169) [2619 bp, 872 aa] {ON}
           complement(73551..76169) [2619 nt, 873 aa]
          Length = 872

 Score =  187 bits (474), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 111/387 (28%), Positives = 205/387 (52%), Gaps = 47/387 (12%)

Query: 140 FRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLK----MHSAKIGARAMI 195
           + +PT IQ + IP I+  RD++G+++TGSGKT +++LP++ ++K    +   + G   +I
Sbjct: 297 YDEPTAIQSQAIPAIMSGRDLIGISKTGSGKTISYILPMLRQIKAQRTLSKNETGPLGLI 356

Query: 196 LSPSRELAMQTHKVFKEFAKGS-NLRSVLLTGGDGLEDQFSMMMSNPDVIIATPGRFLHL 254
           L+P+RELA+Q ++  ++F K   ++R++  TGG  ++ Q + +    ++++ATPGR + +
Sbjct: 357 LAPTRELALQINEEVEKFTKQDRSIRTICCTGGSEMKKQINDLKRGVEIVVATPGRLIDI 416

Query: 255 KVEMN----LDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSATLPSSLV 310
            + +N    +    I +VV DEADRLF+MGF+ Q+ +++ ++   +Q +LFSAT P+ L 
Sbjct: 417 -LTLNSGKLISTKRITFVVMDEADRLFDMGFEPQITQIMKTVRPDKQCVLFSATFPNKLR 475

Query: 311 DFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKND----EREANLLYLLQEVIKIPVATE 366
            FA   LT+P+ V +++   V+EN+   F    N+     R  N+L    +V K   +  
Sbjct: 476 SFAARILTDPLTVTINSNNLVNENVNQSFYIEDNENDKFNRLVNILDGFYKVNKNITSNS 535

Query: 367 EQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYV 426
           E+ +                                   +  S    IIFVS++   + +
Sbjct: 536 EERE---------------------------------IDEEVSDKKIIIFVSSQQFCDLL 562

Query: 427 SNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMS 486
            + L++ GY    ++       R   L  F+    +IL+ T+V +RG+++P ++ V+  +
Sbjct: 563 YSKLENFGYFPYTIHAGKPYQERVMNLEKFKTTTNSILLCTEVLSRGLNVPEVSLVIIYN 622

Query: 487 LPASSKIFVHRVGRTARAGNKGWAYTI 513
              +   +VH  GRTAR  +KG A T+
Sbjct: 623 AAKTFAQYVHTTGRTARGTHKGDAITL 649

>TPHA0N01130 Chr14 complement(237020..239653) [2634 bp, 877 aa] {ON}
           Anc_6.148 YBR237W
          Length = 877

 Score =  186 bits (473), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 118/383 (30%), Positives = 202/383 (52%), Gaps = 40/383 (10%)

Query: 140 FRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLK----MHSAKIGARAMI 195
           +  PTPIQ + IP I+  RD++G+++TGSGKT ++ LPLI  +K    + +++ G   +I
Sbjct: 302 YDTPTPIQSQAIPAIMTGRDVIGISKTGSGKTISYALPLIRHVKAQRPLSNSETGPLGLI 361

Query: 196 LSPSRELAMQTHKVFKEFAKGS-NLRSVLLTGGDGLEDQFSMMMSNPDVIIATPGRFLHL 254
           ++P+RELA+Q ++  ++F K   ++RS+  TGG  L++Q        ++++ATPGRF+ L
Sbjct: 362 IAPTRELAIQINEEIQKFIKSDPSIRSICCTGGSELKNQIYEFKRGIEIVVATPGRFIDL 421

Query: 255 KVEMN----LDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSATLPSSLV 310
            + +N    L+   I  V+ DEADRLF+MGF+ Q+ +++ ++   +Q +LFSAT P  L 
Sbjct: 422 -LTLNTGKLLNTKRITSVILDEADRLFDMGFEPQVTQIMKTIRPDKQCVLFSATFPIKLQ 480

Query: 311 DFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVATEEQLQ 370
            F K  L NP+ + +D++T V+EN+   F  + ND  +    + L E++   V   E  Q
Sbjct: 481 AFVKRVLHNPLTITIDSKTMVNENVHQAFEILNNDSEK---FFKLIEILDNFVEKRESSQ 537

Query: 371 RFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYVSNLL 430
                                       +     +D       IIFVS++   + V+  L
Sbjct: 538 ---------------------------SKGSEQVEDEIIDKKIIIFVSSQQTCDAVAANL 570

Query: 431 KDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSLPAS 490
           +   Y V  ++       R   L  F+    +IL+ T+V +RG+++P ++ V+  +    
Sbjct: 571 EKYDYDVFSIHAGRSYQERVSNLEKFKKTKNSILLCTEVLSRGLNVPEVSLVIIYNAVNK 630

Query: 491 SKIFVHRVGRTARAGNKGWAYTI 513
              +VH  GRTAR   +G A T+
Sbjct: 631 FSQYVHTTGRTARGTRRGNAITL 653

>KNAG0A03280 Chr1 complement(416099..417922) [1824 bp, 607 aa] {ON}
           Anc_8.614 YOR204W
          Length = 607

 Score =  182 bits (463), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 121/402 (30%), Positives = 199/402 (49%), Gaps = 68/402 (16%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLI-EKLKM- 184
           L   ++ N+    F +PTP+Q+ +IP+I   RD++  A+TGSGKT  F+ P++ E  K+ 
Sbjct: 156 LDDLLMENVKLARFTKPTPVQKYSIPIISIGRDLMACAQTGSGKTGGFLFPVLSESFKVG 215

Query: 185 -----------HSAKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQ 233
                      +  K    A+I++P+RELA Q     K+F   S +   ++ GG  + +Q
Sbjct: 216 PSVVQGNEGYSYQRKAYPTAVIMAPTRELATQIFDEAKKFCYRSWVNPCVVYGGAPIGNQ 275

Query: 234 FSMMMSNPDVIIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELL--GS 291
              M    D+++ATPGR   +     + L +++Y+V DEADR+ +MGF+ Q+ +++    
Sbjct: 276 LREMDRGCDLLVATPGRLSDMIERGKISLSNVKYLVLDEADRMLDMGFEIQIRQIVEGCD 335

Query: 292 LPTA--RQTLLFSATLPSSLVDFAKAGL-TNPVLVRLDTETKVSENLEMLFLSVKNDERE 348
           +P +  RQTL+FSAT P+ +   A+  L  + + + +      SEN+    + V++ +++
Sbjct: 336 MPPSSERQTLMFSATFPADIQHLARDFLRPDYIFLSVGKVGSTSENITQRVMYVESMDKK 395

Query: 349 ANLLYLLQEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMP 408
           + LL LL        A+ E                                         
Sbjct: 396 SALLDLL--------ASSE----------------------------------------- 406

Query: 409 SPNSTIIFVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTD 468
            P  T+IFV T+   + +++ L       + ++G   Q  R + L  F+ G  NILV T 
Sbjct: 407 -PGLTLIFVETKRMADQLTDFLIMQNLRATAIHGDRTQSERERALAAFKSGRANILVATA 465

Query: 469 VAARGVDIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWA 510
           VAARG+DIP + +V+N  LP     +VHR+GRT RAGN G A
Sbjct: 466 VAARGLDIPNVTHVINYDLPGDIDDYVHRIGRTGRAGNTGLA 507

>Suva_15.369 Chr15 (648232..649545) [1314 bp, 437 aa] {ON} YHR169W
           (REAL)
          Length = 437

 Score =  179 bits (453), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 127/398 (31%), Positives = 181/398 (45%), Gaps = 62/398 (15%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHS 186
           LSK++  ++      QPT IQ+  IP IL+ RD +G A+TGSGKT AF  P++ K     
Sbjct: 15  LSKWLTESLKAMKITQPTAIQKACIPKILEGRDCIGGAKTGSGKTIAFAGPMLTKWSEDP 74

Query: 187 AKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIA 246
              G   ++L+P+RELAMQ  + F       N+R  ++ GG+ +  Q   +   P  IIA
Sbjct: 75  C--GMFGVVLTPTRELAMQIAEQFTALGSNMNIRVSVVVGGESIVKQALDLQRKPHFIIA 132

Query: 247 TPGRFLHLKVEMNLD----LHSIEYVVFDEADRLFEMGFQEQLNELLGSLPT--ARQTLL 300
           TPGR  H  +    D    L   +Y+V DEAD L    F   L   +G+LP    RQTLL
Sbjct: 133 TPGRLAHHIMSSGEDTVGGLMRAKYLVLDEADILLTSTFANHLATCIGALPPKDKRQTLL 192

Query: 301 FSATLPS---SLVDFAKAGLTNPVL---VRLDTETKVSENLEMLFLSVKNDEREANLLYL 354
           F+AT+     SL D    G   P+    V    +  +   L+  ++ V    +EA L  L
Sbjct: 193 FTATITDQVRSLQDAPVQGNKPPLFAYQVESVDDVAIPSTLKTEYILVPEHVKEAYLYQL 252

Query: 355 LQEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTI 414
           L         T E+ +                                         + I
Sbjct: 253 L---------TCEEYEN---------------------------------------KTAI 264

Query: 415 IFVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGV 474
           +FV+     E +   LK     V+ L+  + Q  R   LH FR     +L+ TDVA+RG+
Sbjct: 265 VFVNRTMSAEILRRTLKQLEVRVASLHSQMPQQERTNSLHRFRANAARVLIATDVASRGL 324

Query: 475 DIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWAYT 512
           DIP +  VVN  +P+   +F+HR GRTARAG  G A +
Sbjct: 325 DIPTVELVVNYDIPSDPDVFIHRSGRTARAGRDGDAIS 362

>TBLA0D02800 Chr4 (686898..688661) [1764 bp, 587 aa] {ON} Anc_8.469
           YDR243C
          Length = 587

 Score =  182 bits (461), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 122/399 (30%), Positives = 195/399 (48%), Gaps = 76/399 (19%)

Query: 140 FRQPTPIQRKTIPLI----LQQRDIVGMARTGSGKTAAFVLPLIEKLKMHSAKI------ 189
           F +P+ IQR  IP I      +RD +G+A TGSGKT AFVLP+I  L   S +I      
Sbjct: 190 FEEPSAIQRVAIPNISSKKTPKRDFLGIASTGSGKTLAFVLPIICSLIKSSPRIPLLKIK 249

Query: 190 -GARAMILSPSRELAMQTH-------KVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNP 241
            G +A+IL+P+RELA Q         K   E     N  SV + GG  +++Q   + +  
Sbjct: 250 NGPKALILAPTRELAQQCQQEASNILKYIFERDPSLNFNSVSVIGGHSIQEQLQDLRNGA 309

Query: 242 DVIIATPGRFLHLKVEMNLDLHS-IEYVVFDEADRLFEMGFQEQLNELLGSLPTAR---- 296
           D++IATPGR + + +E ++ + S ++++V DEADR+ ++GF++QL  +L  +  A     
Sbjct: 310 DILIATPGRLIDV-LESHMTVFSDLDFLVLDEADRMVDLGFEDQLLTILTHIQKASTILN 368

Query: 297 -QTLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLL 355
            QT++F+AT+   +   A   L  PV   +   T     +E +     N++ +   L   
Sbjct: 369 IQTIMFTATMSPKIEKIANRYLKKPVYATIGNATSTEPQIEQIVDYAANEDVKFKKL--- 425

Query: 356 QEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTII 415
                                                        L    + PSP   II
Sbjct: 426 ---------------------------------------------LEYVSNFPSP--III 438

Query: 416 FVSTRHHVEY-VSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGV 474
           F++ +   ++ V    ++  + V+ ++G+  Q  R Q L+N R G  +IL+ T+VAARG+
Sbjct: 439 FINYKRTADWLVDKFYQETTFRVTTIHGSKSQEQREQALNNLRSGKAHILIATNVAARGI 498

Query: 475 DIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWAYTI 513
           DIP ++ VVN  +P   + ++HR+GRT RA  KG A T+
Sbjct: 499 DIPNVSLVVNYQMPLKFEDYIHRIGRTGRASQKGTAVTL 537

>Kwal_56.24760 s56 (1136947..1138248) [1302 bp, 433 aa] {ON} YHR169W
           (DBP8) - DEAD-box protein [contig 160] FULL
          Length = 433

 Score =  178 bits (451), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 125/394 (31%), Positives = 178/394 (45%), Gaps = 62/394 (15%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHS 186
           +SK++   +       PT IQ+  IP IL+ +D +G A+TGSGKT AF  P++ K     
Sbjct: 10  VSKWLTEALRAMKIDHPTAIQKACIPQILKGKDCIGGAKTGSGKTIAFAAPMLTKWSEDP 69

Query: 187 AKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIA 246
           +  G   ++L+P+RELAMQ  + F       N+R  L+ GG+ + DQ   +   P  IIA
Sbjct: 70  S--GMFGVVLTPTRELAMQIAEQFTALGSSMNIRVALVVGGESIVDQAIALQRKPHFIIA 127

Query: 247 TPGRFLHLKVEMNLD----LHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTA--RQTLL 300
           TPGR  H  +    D    L  ++++V DEAD L    F E L   +G LP    RQ LL
Sbjct: 128 TPGRLAHHVMNSGEDTIGGLKRVKFLVLDEADILLTDTFTEHLAICIGILPPKERRQNLL 187

Query: 301 FSATLPSS--LVDFAKAGLTNPVLVRLDTET----KVSENLEMLFLSVKNDEREANLLYL 354
           F+AT+     ++  A A    P L   + E+     +   L+  +L V    +EA L  +
Sbjct: 188 FTATVTDQVKMLQNAPATEGKPPLFSYEVESMDKVAIPSTLKTSYLLVPEQVKEAYLYQI 247

Query: 355 LQEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTI 414
           L     I                                                 +S I
Sbjct: 248 LTSAAYI------------------------------------------------DSSAI 259

Query: 415 IFVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGV 474
           IFV+     E +   LK     V+ L+  + Q  R   LH FR     +L+ TDVA+RG+
Sbjct: 260 IFVNRTVTAEILRRTLKQLDVRVASLHSQMPQQERTNSLHRFRANAARVLIATDVASRGL 319

Query: 475 DIPLLANVVNMSLPASSKIFVHRVGRTARAGNKG 508
           DIP +  VVN  + A+   F+HR GRTARAG KG
Sbjct: 320 DIPTVQLVVNYDISANPDTFIHRAGRTARAGRKG 353

>Kwal_27.11734 s27 complement(923899..925614) [1716 bp, 571 aa] {ON}
           YDR243C (PRP28) - RNA helicase [contig 27] FULL
          Length = 571

 Score =  181 bits (458), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 122/393 (31%), Positives = 197/393 (50%), Gaps = 71/393 (18%)

Query: 136 SRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKM-----HSAKI- 189
           S+  +R+PTPIQR TIP +L+ RD VG+A TGSGKT AF+LP + +L          K+ 
Sbjct: 185 SKLKYREPTPIQRITIPNVLRGRDFVGIAATGSGKTLAFLLPSLCQLSKLPPLNDITKLD 244

Query: 190 GARAMILSPSRELAMQTH----KVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVII 245
           G   +IL+P+RELA Q      KV   +++ + + S++  GG  +E+    +    D+++
Sbjct: 245 GPFTLILAPTRELAQQIEAEAKKVVNLWSRPTKVTSIV--GGHSIEEISYSLSDGCDILV 302

Query: 246 ATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLP--TARQTLLFSA 303
           ATPGR +       L L  +  +V DEADR+ + GF++QL  +L      + RQT++F+A
Sbjct: 303 ATPGRLIDCLENRMLVLKQVRILVLDEADRMIDFGFEDQLTTILARTESVSGRQTMMFTA 362

Query: 304 TLPSSLVDFAKAGLTNPVLVRL---DTETKVSENLEMLFLSVKNDEREANLLYLLQEVIK 360
           T+ +++   A   LT P  VR+   DT+ ++ + +E                YL  E  +
Sbjct: 363 TMSNTVEKIANGYLTKPAYVRVGSDDTKAQIKQIVE----------------YLPSEEQR 406

Query: 361 IPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTR 420
                 + L +FR                          P+            +IF++ +
Sbjct: 407 FQKMARDILPKFRA-------------------------PI------------MIFINYK 429

Query: 421 HHVEY-VSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLL 479
              ++ VS    +  + V+ L+G+  Q  R   L+  R G  +I++ TDVA RG+DIP +
Sbjct: 430 KTADWLVSKFSSETRFKVTTLHGSKSQEQREHSLNMLRTGKVDIMIATDVAGRGIDIPDV 489

Query: 480 ANVVNMSLPASSKIFVHRVGRTARAGNKGWAYT 512
           + VVN  +  + + +VHR+GRT RAG  G A T
Sbjct: 490 SLVVNFQMCTAFESYVHRIGRTGRAGRSGCALT 522

>YHR169W Chr8 (442181..443476) [1296 bp, 431 aa] {ON}  DBP8ATPase,
           putative RNA helicase of the DEAD-box family; component
           of 90S preribosome complex involved in production of 18S
           rRNA and assembly of 40S small ribosomal subunit; ATPase
           activity stimulated by association with Esf2p
          Length = 431

 Score =  177 bits (449), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 126/398 (31%), Positives = 182/398 (45%), Gaps = 62/398 (15%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHS 186
           LSK++  ++      QPT IQ+  IP IL+ RD +G A+TGSGKT AF  P++ K     
Sbjct: 9   LSKWLTESLRAMKITQPTAIQKACIPKILEGRDCIGGAKTGSGKTIAFAGPMLTKWSEDP 68

Query: 187 AKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIA 246
           +  G   ++L+P+RELAMQ  + F       N+R  ++ GG+ +  Q   +   P  IIA
Sbjct: 69  S--GMFGVVLTPTRELAMQIAEQFTALGSSMNIRVSVIVGGESIVQQALDLQRKPHFIIA 126

Query: 247 TPGRFLHLKVEMNLD----LHSIEYVVFDEADRLFEMGFQEQLNELLGSLPT--ARQTLL 300
           TPGR  H  +    D    L   +Y+V DEAD L    F + L   + +LP    RQTLL
Sbjct: 127 TPGRLAHHIMSSGDDTVGGLMRAKYLVLDEADILLTSTFADHLATCISALPPKDKRQTLL 186

Query: 301 FSATLPSSLVDFAKAGLT--NPVLVRLDTET----KVSENLEMLFLSVKNDEREANLLYL 354
           F+AT+   +     A +    P L     E+     +   L++ ++ V    +EA L  L
Sbjct: 187 FTATITDQVKSLQNAPVQKGKPPLFAYQVESVDNVAIPSTLKIEYILVPEHVKEAYLYQL 246

Query: 355 LQEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTI 414
           L         T E+ +                                         + I
Sbjct: 247 L---------TCEEYEN---------------------------------------KTAI 258

Query: 415 IFVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGV 474
           IFV+     E +   LK     V+ L+  + Q  R   LH FR     IL+ TDVA+RG+
Sbjct: 259 IFVNRTMTAEILRRTLKQLEVRVASLHSQMPQQERTNSLHRFRANAARILIATDVASRGL 318

Query: 475 DIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWAYT 512
           DIP +  VVN  +P+   +F+HR GRTARAG  G A +
Sbjct: 319 DIPTVELVVNYDIPSDPDVFIHRSGRTARAGRIGDAIS 356

>Suva_4.494 Chr4 (862220..864772) [2553 bp, 850 aa] {ON} YBR237W
           (REAL)
          Length = 850

 Score =  184 bits (468), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 111/385 (28%), Positives = 206/385 (53%), Gaps = 43/385 (11%)

Query: 140 FRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLK----MHSAKIGARAMI 195
           F   TPIQ + +P I+  RD++G+++TGSGKT +++LPL+ ++K    +   + G   +I
Sbjct: 276 FDSLTPIQSQALPAIMSGRDVIGISKTGSGKTISYLLPLLRQVKAQRPLSKHETGPLGLI 335

Query: 196 LSPSRELAMQTHKVFKEFAK-GSNLRSVLLTGGDGLEDQFSMMMSNPDVIIATPGRFLHL 254
           L+P+RELA+Q H+   +F +  + +RSV  TGG  ++ Q + +    ++++ATPGRF+ +
Sbjct: 336 LAPTRELALQIHEEVNKFTETDAGIRSVCCTGGSEMKKQITDLKRGAEIVVATPGRFIDI 395

Query: 255 KVEMN----LDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSATLPSSLV 310
            + +N    L    I +V+ DEADRLF++GF+ Q+ +++ ++   +Q +LFSAT P+ L 
Sbjct: 396 -LTLNDGKLLSTKRITFVIMDEADRLFDLGFEPQITQIMKTVRPDKQFVLFSATFPNKLR 454

Query: 311 DFAKAGLTNPVLVRLDTETKVSENLEMLF-LSVKNDEREANLLYLLQEVIKIPVATEEQL 369
            FA   L +P+ + ++++  V+EN++  F +    DE+  NL+ +L++         E L
Sbjct: 455 SFAVRVLRSPISITINSKGMVNENVKQKFKICHSEDEKFDNLMQILRK-------RNELL 507

Query: 370 QRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNS-TIIFVSTRHHVEYVSN 428
              +                                D+   ++  IIFVS++   +++S 
Sbjct: 508 DEVQSDVDG------------------------ETSDLEEVDAKAIIFVSSQQICDFISK 543

Query: 429 LLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSLP 488
            L + G +   ++       R   L  F+    +IL+ T+V +RG+++P ++ V+  +  
Sbjct: 544 KLANVGVVTYAIHAGKPYQERVMNLEKFKREKNSILLCTEVLSRGLNVPEVSLVIIYNSV 603

Query: 489 ASSKIFVHRVGRTARAGNKGWAYTI 513
            +   +VH  GRTAR    G A T+
Sbjct: 604 KTFAQYVHTTGRTARGSRSGTAITL 628

>CAGL0K11198g Chr11 complement(1087381..1089129) [1749 bp, 582 aa]
           {ON} similar to uniprot|P23394 Saccharomyces cerevisiae
           YDR243c PRP28
          Length = 582

 Score =  181 bits (458), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 124/394 (31%), Positives = 195/394 (49%), Gaps = 70/394 (17%)

Query: 139 GFRQPTPIQRKTIPLILQQ-----RDIVGMARTGSGKTAAFVLPLIEKLKMHSAKI---- 189
           GF +PT IQR TIP  +       RDI+G+A TGSGKT AF +P++ +L    A+     
Sbjct: 190 GFDEPTAIQRITIPNAISSNKSVPRDILGIASTGSGKTLAFSIPILARLDALPARPVNLK 249

Query: 190 ---GARAMILSPSRELAMQT----HKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPD 242
              G  A++L P+RELA Q     +++   +    NL +V + GG  + D    + +  D
Sbjct: 250 TLDGPLALVLVPTRELAQQISQEINRLLSAWENKKNLNAVSIVGGHSMSDISHTLRNGCD 309

Query: 243 VIIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLP----TARQT 298
           ++IATPGR L +     + L+ I+ +V DEADR+ ++GF++Q+  +L  L      ARQT
Sbjct: 310 ILIATPGRLLDVLDNHLVVLNKIQSLVLDEADRMIDLGFEDQMKSILSHLMADELAARQT 369

Query: 299 LLFSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEV 358
           +LF+ATL SS+   AK  L NP+ V + +     + L    +    D+ +  L +L  ++
Sbjct: 370 MLFTATLSSSVESIAKGYLKNPLHVSVGSRWDSDKPLITQVVRHTGDD-DKKLSFLKDDL 428

Query: 359 IKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVS 418
           IK                                        LP+          IIF++
Sbjct: 429 IK--------------------------------------NGLPA----------IIFIN 440

Query: 419 TRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPL 478
            +   ++++  L D   +V+ L+G+  Q  R   +   + G  N+L+ T+VAARG+DIP 
Sbjct: 441 YKETADWLTLRLSDRFNIVT-LHGSKSQSQRESAIQKLKSGTANVLIATNVAARGLDIPD 499

Query: 479 LANVVNMSLPASSKIFVHRVGRTARAGNKGWAYT 512
           +A VVN  +      ++HR+GRT RAG  G A T
Sbjct: 500 VALVVNFQMSKKFDDYIHRIGRTGRAGKTGIAVT 533

>KAFR0E02810 Chr5 complement(567875..569581) [1707 bp, 568 aa] {ON}
           Anc_8.469 YDR243C
          Length = 568

 Score =  180 bits (456), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 117/385 (30%), Positives = 201/385 (52%), Gaps = 62/385 (16%)

Query: 140 FRQPTPIQRKTIP-LILQQRDIVGMARTGSGKTAAFVLPLIEKL--KMHSAKI--GARAM 194
           F++PTPIQR  IP  I   RD +G+A TGSGKT AF++P++ +L  +  S KI  G +++
Sbjct: 185 FQEPTPIQRVAIPNTIKTNRDFLGVASTGSGKTLAFIIPILIRLPQRPKSLKILDGPKSL 244

Query: 195 ILSPSRELAMQTHKVFKEFAK--GSNLRSVL-LTGGDGLEDQFSMMMSNPDVIIATPGRF 251
           I+ P+RELA Q     KE  K   SN  +VL + GG  +E     +    D+++ATPG+ 
Sbjct: 245 IIVPTRELAQQIETSAKEITKRWKSNECNVLSIVGGHSIEKITLDLSIGCDILVATPGKL 304

Query: 252 LHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTAR---QTLLFSATLPSS 308
           +       L L+ ++ +V DEAD++ ++GF++Q+  +L  L   R   QT++F+ATL  S
Sbjct: 305 IECLQSHILTLNQVDTLVMDEADKMIDLGFEDQITAILARLSMERSSLQTMMFTATLSQS 364

Query: 309 LVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVATEEQ 368
           +   +   L +P++V++ +E    + +  +  +V+  E E N                  
Sbjct: 365 IEKISNNYLNSPIIVKIGSE---EDQVPKIQQTVEYSENEEN------------------ 403

Query: 369 LQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYVSN 428
             RF+                         Q + + K+   P   IIF++ +   +Y++ 
Sbjct: 404 --RFK-------------------------QIIKTLKNCSPP--IIIFINYKSTADYLTK 434

Query: 429 LLKD-CGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSL 487
             ++   +  + L+G+ +Q  R   ++  R G   +L+ T+VAARG+DIP ++ V+N  +
Sbjct: 435 KFRNETNFKFTILHGSKNQEQREHSINLLRTGAVQVLIATNVAARGIDIPNVSLVINFQM 494

Query: 488 PASSKIFVHRVGRTARAGNKGWAYT 512
           P   + ++HR+GRT RAGN G + T
Sbjct: 495 PKHFEDYIHRIGRTGRAGNLGASVT 519

>Smik_2.380 Chr2 (678057..680609) [2553 bp, 850 aa] {ON} YBR237W
           (REAL)
          Length = 850

 Score =  184 bits (466), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 109/387 (28%), Positives = 206/387 (53%), Gaps = 47/387 (12%)

Query: 140 FRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLK----MHSAKIGARAMI 195
           F   TPIQ + +P I+  RD++G+++TGSGKT +++LPL+ ++K    +   + G   +I
Sbjct: 276 FESLTPIQSQALPAIMSGRDVIGISKTGSGKTISYLLPLLRQVKAQRPLSKHETGPLGLI 335

Query: 196 LSPSRELAMQTHKVFKEFAKGSNL-RSVLLTGGDGLEDQFSMMMSNPDVIIATPGRFLHL 254
           L+P+RELA+Q H+  ++F     L RSV  TGG  ++ Q + +    ++++ATPGRF+ +
Sbjct: 336 LAPTRELALQIHEEVRKFTGAEALIRSVCCTGGSEMKKQITDLKRGAEIVVATPGRFIDI 395

Query: 255 KVEMN----LDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSATLPSSLV 310
            + +N    L    I +V+ DEADRLF++GF+ Q+ +++ ++   +Q +LFSAT P+ L 
Sbjct: 396 -LTLNDGKLLSTKRITFVIMDEADRLFDLGFEPQITQIMKTVRPDKQCVLFSATFPNKLR 454

Query: 311 DFAKAGLTNPVLVRLDTETKVSENLEMLF-LSVKNDEREANLLYLLQEVIKI--PVATEE 367
            FA   L +P+ + ++++  V+EN++  F +   +DE+  NL+ ++    +    + TE 
Sbjct: 455 SFAVRVLRSPISITINSKGLVNENVKQKFKICNSDDEKFDNLVQIVHGRAEFFNEILTEA 514

Query: 368 QLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTII-FVSTRHHVEYV 426
             +                                 + D    ++  I FVS++   +++
Sbjct: 515 DGE---------------------------------SSDFEEADAKAIIFVSSQQICDFI 541

Query: 427 SNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMS 486
           S  L++ G +   ++       R   L  F+    ++L+ T+V +RG+++P ++ V+  +
Sbjct: 542 SKKLQNAGIITCAIHAGKPYQERLMNLEKFKREKNSVLLCTEVLSRGLNVPEVSLVIIYN 601

Query: 487 LPASSKIFVHRVGRTARAGNKGWAYTI 513
              +   +VH  GRTAR    G A T+
Sbjct: 602 AVKTFAQYVHTTGRTARGSRSGTAITL 628

>KLLA0C15433g Chr3 complement(1339439..1341058) [1620 bp, 539 aa]
           {ON} similar to uniprot|P23394 Saccharomyces cerevisiae
           YDR243C PRP28 RNA helicase in the DEAD-box family
           involved in RNA isomerization at the 5' splice site
          Length = 539

 Score =  179 bits (453), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 119/387 (30%), Positives = 194/387 (50%), Gaps = 68/387 (17%)

Query: 140 FRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMH--------SAKIGA 191
           + +PT IQR TIP ++  RD +G+A TGSGKT AF+LP++  +K+H        +   G 
Sbjct: 158 YNEPTSIQRSTIPNVINNRDFIGVASTGSGKTLAFLLPIL--IKLHGIPPLNSITKHDGP 215

Query: 192 RAMILSPSRELAMQT----HKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIAT 247
            A++L+P+RELA Q       + K + +  N+ S++  GG  LE+  + +    D+++AT
Sbjct: 216 LALVLAPTRELAQQIQHEGQSITKLWKRPCNIVSIV--GGHSLEEISANLRDGCDILVAT 273

Query: 248 PGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTA--RQTLLFSATL 305
           PGR L       L L  +  +V DEAD++ + GF++QL  +L    T   RQT++F+AT 
Sbjct: 274 PGRLLDCLDSHLLFLKQVNTLVLDEADKMIDFGFEDQLTTILAKTETISNRQTMMFTATF 333

Query: 306 PSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVAT 365
             ++   A   L  P                  +++V  +E +      ++++++     
Sbjct: 334 SPTIEKVANGYLKKPS-----------------YVTVGGEESKPK----IKQIVRYVPDE 372

Query: 366 EEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEY 425
           EE+L+                              LP+ K   +P   IIF++ +   ++
Sbjct: 373 EEKLKIL------------------------VKDFLPNYK---AP--IIIFINYKRTADW 403

Query: 426 VSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNM 485
           + + L++  +  + L+G+  Q  R   L   R G  +IL+ TDVA RG+DIP ++ VVN+
Sbjct: 404 LFDKLREARFRATTLHGSKSQEQREHSLSLLRNGKVDILIATDVAGRGIDIPNVSLVVNL 463

Query: 486 SLPASSKIFVHRVGRTARAGNKGWAYT 512
             P S   FVHRVGRT RAG  G A T
Sbjct: 464 QFPKSFDSFVHRVGRTGRAGKTGTALT 490

>TBLA0E04100 Chr5 (1032727..1035327) [2601 bp, 866 aa] {ON}
           Anc_8.614 YOR204W
          Length = 866

 Score =  184 bits (466), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 126/412 (30%), Positives = 198/412 (48%), Gaps = 76/412 (18%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKL---- 182
           L   ++ NI    F +PTPIQ+ +IP++ Q RD++  A+TGSGKT AF+ P++ K     
Sbjct: 364 LDNLLVENIKLARFNKPTPIQKYSIPIVNQGRDLMACAQTGSGKTDAFLFPILSKAFSLG 423

Query: 183 --------------------KMHSAKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSV 222
                               K  +  I    +IL+P+RELA Q  +  ++F+  S +R  
Sbjct: 424 PSINNNNDNDNDANQYNKISKYRAKNIKPIILILAPTRELANQIFEEARKFSYRSWIRPC 483

Query: 223 LLTGGDGLEDQFSMMMSNPDVIIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQ 282
           ++ GG  +  Q   + +   +++ATPGR   L     + L +I+Y++ DEADR+ +MGF+
Sbjct: 484 VVYGGTNIFTQMKNLENGSQLLVATPGRLNDLMERGKISLSNIKYLILDEADRMLDMGFE 543

Query: 283 EQLNELLGS----LPTARQTLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEML 338
            Q+ +++      + T+RQTL+FSAT PS++                       +NL   
Sbjct: 544 LQIRQIVEHYDMPIATSRQTLMFSATFPSNI-----------------------QNLAGD 580

Query: 339 FLSVKNDEREANLLYLLQEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXX 398
           FL   ND       Y+   V KI   T+  +Q                            
Sbjct: 581 FL---ND-------YIFLSVGKIGSTTDNIIQHIYYVRQEEKDNTLLD------------ 618

Query: 399 QPLPSAKDMPSPNSTIIFVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRC 458
             L  +K+      T+IFV T+   + +++LL   GY  + ++G   Q  R + L  F+ 
Sbjct: 619 --LLDSKNYKKK-QTLIFVETKRSADALTDLLIIEGYKATAIHGDRTQLERERALTAFKT 675

Query: 459 GLTNILVVTDVAARGVDIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWA 510
              N+LV T VAARG+DIP +A+V+N  LP +   +VHR+GRT R GN G A
Sbjct: 676 KRANVLVATSVAARGLDIPNVAHVLNYDLPNNIDDYVHRIGRTGRVGNIGMA 727

>KLTH0H00638g Chr8 complement(64621..65922) [1302 bp, 433 aa] {ON}
           highly similar to uniprot|P38719 Saccharomyces
           cerevisiae YHR169W DBP8 Putative ATP-dependent RNA
           helicase of the DEAD-box family involved in biogenesis
           of the 40S ribosomal subunit
          Length = 433

 Score =  176 bits (446), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 124/394 (31%), Positives = 180/394 (45%), Gaps = 62/394 (15%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHS 186
           +SK+++  +      QPT IQ+  IP ILQ +D +G A+TGSGKT AF  P++ K     
Sbjct: 10  ISKWLVEALQAMKITQPTAIQKACIPQILQGKDCIGGAKTGSGKTIAFGAPMLTKWSEDP 69

Query: 187 AKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIA 246
           +  G   ++L+P+RELAMQ  + F       N+R  L+ GG+ + DQ   +   P  I+A
Sbjct: 70  S--GMFGVVLTPTRELAMQIAEQFTALGSSMNIRVALVVGGESIVDQAINLQRKPHFIVA 127

Query: 247 TPGRFLHLKVEMNLD----LHSIEYVVFDEADRLFEMGFQEQLNELLGSLPT--ARQTLL 300
           TPGR  H  +    D    L   +++V DEAD L    F E L   +  LP    RQTLL
Sbjct: 128 TPGRMAHHIMNSGEDTIGGLKRAKFLVLDEADILLTDTFSEHLATCISILPPKEKRQTLL 187

Query: 301 FSATLPSSL--VDFAKAGLTNPVLVRLDTET----KVSENLEMLFLSVKNDEREANLLYL 354
           F+AT+   +  +  A A    P L   + E+     +   L+  +L V    +EA L  +
Sbjct: 188 FTATVTDQVKALQNAPAAEGKPPLFSYEVESMDKVAIPSTLKTTYLLVPEQVKEAYLYQI 247

Query: 355 LQEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTI 414
           L        AT  +                                          +S I
Sbjct: 248 LTN------ATYNE------------------------------------------SSAI 259

Query: 415 IFVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGV 474
           IFV+     E +   LK     V+ L+  + Q  R   LH FR     +L+ TDVA+RG+
Sbjct: 260 IFVNRTVTAEILRRTLKQLDVRVASLHSQMPQQERTNSLHRFRANAARVLIATDVASRGL 319

Query: 475 DIPLLANVVNMSLPASSKIFVHRVGRTARAGNKG 508
           DIP +  V+N  + ++   F+HR GRTARAG  G
Sbjct: 320 DIPTVQLVINYDISSNPDTFIHRAGRTARAGRSG 353

>CAGL0I02354g Chr9 (209279..210592) [1314 bp, 437 aa] {ON} highly
           similar to uniprot|P38719 Saccharomyces cerevisiae
           YHR169w DBP8
          Length = 437

 Score =  176 bits (445), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 125/393 (31%), Positives = 182/393 (46%), Gaps = 52/393 (13%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHS 186
           LSK+++ ++     R PT IQ   IP IL+ RD +G A+TGSGKT AF  P++ +     
Sbjct: 16  LSKWLVESLDAMRIRTPTAIQSGCIPEILKGRDCIGGAKTGSGKTIAFAGPMLTQWSEDP 75

Query: 187 AKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIA 246
              G   ++L+P+RELAMQ  + F       N+R  L+ GG+ + DQ   +   P  IIA
Sbjct: 76  T--GMFGIVLTPTRELAMQIAEQFTALGSYMNIRVALVVGGESIVDQALQLQRKPHFIIA 133

Query: 247 TPGRFLHLKVEMNLD----LHSIEYVVFDEADRLFEMGFQEQLNELLGSLPT--ARQTLL 300
           TPGR  H  +    D    L  ++Y+V DEAD L    F   L   +G+LP    RQTLL
Sbjct: 134 TPGRLAHHILNSGDDTVGGLKRVKYLVLDEADILLTETFSNDLKTCVGALPPKEKRQTLL 193

Query: 301 FSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFL-SVKNDEREANLLYLLQEVI 359
           F+AT+                 VR   +  V +  + LF   V+N +  A    L  E +
Sbjct: 194 FTATITDQ--------------VRALQDAPVQKGKQPLFCYEVENVDNVAIPSTLNTEYV 239

Query: 360 KIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVST 419
            +P   +E                                 L + +   +  + I FV+ 
Sbjct: 240 LVPEHVKE----------------------------AYLYQLLTCESYANSTAII-FVNR 270

Query: 420 RHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLL 479
               E +   LK     V+ L+  + Q  R   +H FR     +L+ TDVA+RG+DIP +
Sbjct: 271 TTAAEVLRRTLKALDVRVASLHSQMPQQERTNSMHRFRANAARVLIATDVASRGLDIPTV 330

Query: 480 ANVVNMSLPASSKIFVHRVGRTARAGNKGWAYT 512
             V+N  +P+    F+HR GRTARAG KG A +
Sbjct: 331 ELVINYDIPSDPDTFIHRSGRTARAGRKGDAIS 363

>KAFR0G03480 Chr7 (718012..720570) [2559 bp, 852 aa] {ON} Anc_6.148
           YBR237W
          Length = 852

 Score =  182 bits (463), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 110/383 (28%), Positives = 202/383 (52%), Gaps = 45/383 (11%)

Query: 140 FRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLK----MHSAKIGARAMI 195
           F++ TPIQ + +P I+  RD++G+++TGSGKT +++LPL+ ++K    + +++ G   ++
Sbjct: 279 FQELTPIQAQALPAIMSGRDVIGISKTGSGKTISYLLPLLRQVKSQRDLSNSETGPIGLV 338

Query: 196 LSPSRELAMQTHK-VFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIATPGRFLHL 254
           L+P+RELA+Q H+ + K     ++L  +  TGG  L+DQ S +     +++ATPGRF+ L
Sbjct: 339 LAPTRELALQIHEEINKLINDDASLNCICCTGGSELKDQISSVKRGVKIVVATPGRFIDL 398

Query: 255 KVEMN----LDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSATLPSSLV 310
            + +N    L    I +VV DEADRLF+MGF+ Q+ +++ ++   +Q +LFSAT  + + 
Sbjct: 399 -LTINSGKLLSTGRITFVVMDEADRLFDMGFEPQVTQIMKAIRPDKQCVLFSATFSNKIR 457

Query: 311 DFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREAN-LLYLLQEVIKIPVATEEQL 369
            FA   L NP+ + +++   V+EN+   F   ++D ++ + L+ LL+E            
Sbjct: 458 SFAMRVLKNPITITINSNNIVNENVSQNFRVCESDTQKFDELISLLKE------------ 505

Query: 370 QRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYVSNL 429
                                        Q      D    N TIIFV+++   + +   
Sbjct: 506 ----------------------RNDKHEAQEGFEESDNLQDNKTIIFVASQQICDILETN 543

Query: 430 LKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSLPA 489
           L   G+ +  ++       R   L  +R    ++L+ T+V +RG+++P ++ V+  +   
Sbjct: 544 LVSSGFEIFSIHAGKPYQERVLNLEKYRRTRNSLLLCTEVLSRGLNVPEVSLVIIYNAVK 603

Query: 490 SSKIFVHRVGRTARAGNKGWAYT 512
           +   ++H  GRTAR  +KG A +
Sbjct: 604 TFAQYIHTTGRTARGNSKGKAVS 626

>KLTH0E10890g Chr5 complement(976948..978717) [1770 bp, 589 aa] {ON}
           similar to uniprot|P23394 Saccharomyces cerevisiae
           YDR243C PRP28 RNA helicase in the DEAD-box family
           involved in RNA isomerization at the 5' splice site
          Length = 589

 Score =  179 bits (454), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 124/399 (31%), Positives = 196/399 (49%), Gaps = 72/399 (18%)

Query: 131 ILGNISRK-GFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMH---- 185
           I+G I  K  + +PTPIQR TIP +L  RD VG+A TGSGKT AF++P + +L       
Sbjct: 197 IVGIIETKLKYLEPTPIQRATIPNVLNGRDFVGVAATGSGKTLAFLIPPLCQLNNTPPLN 256

Query: 186 --SAKIGARAMILSPSRELAMQ----THKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMS 239
             +   G  A+IL+P+RELA Q     +KV K   + + +  V L GG  +E+    +  
Sbjct: 257 DITKMDGPSALILAPTRELAQQIEAEANKVVKFLHRPTKV--VSLVGGHSVEEISYSLSH 314

Query: 240 NPDVIIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPT--ARQ 297
             D+++ATPGR +       L L  +  ++ DEADR+ + GF++QL  +L    +   RQ
Sbjct: 315 GCDILVATPGRLIDCLESNILVLQQVRTLILDEADRMIDFGFEDQLTTILARTESVKGRQ 374

Query: 298 TLLFSATLPSSLVDFAKAGLTNPVLVRL---DTETKVSENLEMLFLSVKNDEREANLLYL 354
           T++F+AT+ S++   A   L  P  VR+   DT+ ++ + ++                YL
Sbjct: 375 TMMFTATMSSTIERIANGYLNKPAYVRVGSQDTKAQIKQVVQ----------------YL 418

Query: 355 LQEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTI 414
             E  +      + L RFR                                   SP   +
Sbjct: 419 PSEEQRFSRLCRDVLPRFR-----------------------------------SP--IM 441

Query: 415 IFVSTRHHVEYV-SNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARG 473
           IF++ +   +++ +    +  Y V+ L+G+  Q  R   L+  R G  +I++ TDVA RG
Sbjct: 442 IFINYKRTADWLAAKFSSETRYRVTTLHGSKSQEQREHSLNLLRSGKADIMIATDVAGRG 501

Query: 474 VDIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWAYT 512
           +DIP ++ VVN  +  S + ++HR+GRT RAG  G A T
Sbjct: 502 IDIPNVSLVVNFQMCTSFEGYIHRIGRTGRAGKSGCALT 540

>TDEL0E03850 Chr5 complement(723551..725836) [2286 bp, 761 aa] {ON}
           Anc_5.241 YJL033W
          Length = 761

 Score =  181 bits (460), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 117/394 (29%), Positives = 196/394 (49%), Gaps = 63/394 (15%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKL--KM 184
           +S   L  +    F + T IQR++IP+ L+  D++G A+TGSGKT AF++P++EKL  + 
Sbjct: 48  ISDATLKGLKEAAFVKLTEIQRESIPVSLKGHDLLGAAKTGSGKTLAFLIPVLEKLYREK 107

Query: 185 HSAKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVI 244
            +   G  A+I+SP+RELAMQ ++V  +    ++  + L+ GG  ++ +   + S  +++
Sbjct: 108 WTEFDGLGALIISPTRELAMQIYEVLTKIGGHTSFSAGLVIGGKDVKFELERI-SRINIL 166

Query: 245 IATPGRFL-HLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSA 303
           + TPGR L H+   + L+  +++ +V DEADR  +MGF++ L+ ++ +LP +RQTLLFSA
Sbjct: 167 VGTPGRILQHMDQAVGLNADNLQMLVLDEADRCLDMGFKKTLDAIVSNLPPSRQTLLFSA 226

Query: 304 TLPSSLVDFAKAGLTNPVLVRL-------DTETKVSENLEMLFLSVKNDEREANLLYLLQ 356
           T   SL D A+  LT+   V         D+E    E L+  ++ V+  ++   L   ++
Sbjct: 227 TQSQSLADLARLSLTDYKSVGTADTVNGGDSEVSTPETLQQSYIVVELADKLDTLFSFIK 286

Query: 357 EVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIF 416
             +K                                                  +  I+F
Sbjct: 287 THLK--------------------------------------------------SKMIVF 296

Query: 417 VSTRHHVEYVSNLLKDC--GYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGV 474
           +S+   V +V    +    G  + +L+G   Q AR + L  F       L+ TDV ARG+
Sbjct: 297 LSSSKQVHFVYETFRKMQPGISLMHLHGRQKQTARTETLDKFSRAQQVCLIATDVVARGI 356

Query: 475 DIPLLANVVNMSLPASSKIFVHRVGRTARAGNKG 508
           D P +  VV +  P     ++HRVGR+AR G +G
Sbjct: 357 DFPAVDWVVQVDCPEDVDTYIHRVGRSARYGKQG 390

>Ecym_1395 Chr1 complement(818424..820121) [1698 bp, 565 aa] {ON}
           similar to Ashbya gossypii AFR452C
          Length = 565

 Score =  178 bits (452), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 123/386 (31%), Positives = 191/386 (49%), Gaps = 63/386 (16%)

Query: 139 GFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEK------LKMHSAKIGAR 192
           G+ +PTPIQR TIP +   RD +G+A TGSGKT AF++P+  K      L + + + G +
Sbjct: 182 GYEEPTPIQRATIPNVQNNRDFMGVASTGSGKTLAFLIPIFMKFTKLPPLNVITRQDGPQ 241

Query: 193 AMILSPSRELAMQTHKVFKEFAKGSNLRSVLLT---GGDGLEDQFSMMMSNPDVIIATPG 249
           A+IL+P+RELA Q     K+F      R  L+T   GG  LE+    +    ++++ATPG
Sbjct: 242 ALILAPTRELAQQIEAEAKKFCAHWK-RPCLVTSIVGGHTLEEIIFNLQDGCNILVATPG 300

Query: 250 RFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTA--RQTLLFSATLPS 307
           R +       L L  +  +V DEADR+ + GF++QL  +L        +QTL+F+AT+ S
Sbjct: 301 RLIDCLENHVLVLKQVYTLVLDEADRMVDFGFEDQLTTILARTDDILEKQTLMFTATMSS 360

Query: 308 SLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVATEE 367
           S+   A   L NP  V +       +                     +Q++I+  VAT+E
Sbjct: 361 SIERIANGYLRNPGFVTIGGSGSAPQ---------------------IQQIIEY-VATDE 398

Query: 368 QLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEY-V 426
             QRF+                           LP+ +        IIF++ +   ++ +
Sbjct: 399 --QRFKMLTQDI---------------------LPNYRP-----PVIIFINYKVTADWLL 430

Query: 427 SNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMS 486
               ++  + V+ L+G+  Q  R   L  FR G  +I+V TDVA RG+DIP ++ VVN  
Sbjct: 431 RKFQEESKFRVTILHGSKSQTQREHSLKAFREGKVDIMVATDVAGRGIDIPNVSLVVNFQ 490

Query: 487 LPASSKIFVHRVGRTARAGNKGWAYT 512
           +P+    ++HR+GRT RA  KG   T
Sbjct: 491 MPSKLDDYIHRIGRTGRANQKGTTLT 516

>NCAS0B02570 Chr2 (429423..431195) [1773 bp, 590 aa] {ON} Anc_8.469
          Length = 590

 Score =  179 bits (453), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 123/393 (31%), Positives = 192/393 (48%), Gaps = 64/393 (16%)

Query: 140 FRQPTPIQRKTIPLILQ-QRDIVGMARTGSGKTAAFVLPLIEKLKMHSAKI-------GA 191
           F  PTP+QR TIP I++  RD VG+A TGSGKT AFVLP++ +L  +           G 
Sbjct: 195 FDFPTPVQRITIPNIVKGNRDFVGVASTGSGKTLAFVLPMLTQLLTNGVPPIALKKMNGP 254

Query: 192 RAMILSPSRELAMQTH----KVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIAT 247
             ++L P+RELA Q      KV     +   ++   + GG  LE+  S +    D++IAT
Sbjct: 255 IGLVLVPTRELAQQIQLEAEKVVNLIREEYPIKIESIVGGHSLEEISSNLNEGCDILIAT 314

Query: 248 PGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSL-------PTARQTLL 300
           PG+ +       L + ++ Y+V DEAD++ ++GF++QL  +L +L        +  +TL+
Sbjct: 315 PGKLIECLENHLLVISNLSYLVLDEADKMIDLGFEDQLKTILNNLEVNNSNVSSLYRTLM 374

Query: 301 FSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIK 360
           F+ATL S L   A   L NP+   +  E                    A+ +  +Q+V++
Sbjct: 375 FTATLSSPLEKIASGYLRNPIYASIKAEG-------------------ADAMPQIQQVVQ 415

Query: 361 IPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTR 420
               T++  Q+F+                           L     M +P   IIF++ +
Sbjct: 416 Y-CPTDD--QKFKAIESI----------------------LREKNTMDNP-RVIIFINYK 449

Query: 421 HHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLA 480
              ++++N      Y V+ L+G+  Q  R   +   R G   IL+ T+VAARG+DIP +A
Sbjct: 450 ATADWLANKFASTKYKVTILHGSKSQEQREHSIQLLRSGKIQILIATNVAARGLDIPNVA 509

Query: 481 NVVNMSLPASSKIFVHRVGRTARAGNKGWAYTI 513
            V+N   P     +VHR+GRT RAGN G A T+
Sbjct: 510 LVINFHFPKDFADYVHRIGRTGRAGNLGTAVTL 542

>Skud_2.369 Chr2 (660665..663211) [2547 bp, 848 aa] {ON} YBR237W
           (REAL)
          Length = 848

 Score =  182 bits (462), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 109/385 (28%), Positives = 204/385 (52%), Gaps = 43/385 (11%)

Query: 140 FRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHSA----KIGARAMI 195
           F   TPIQ + +P I+  RD++G+++TGSGKT +++LPL+ ++K   +    + G   +I
Sbjct: 274 FDSLTPIQSQALPAIMSGRDVIGISKTGSGKTISYLLPLLRQVKAQRSLSKHETGPLGLI 333

Query: 196 LSPSRELAMQTHKVFKEF-AKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIATPGRFLHL 254
           L+P+RELA+Q H+   +F    +++RSV  TGG  ++ Q + +    ++++ATPGRF+ +
Sbjct: 334 LAPTRELALQIHEEVTKFTGTDASIRSVCCTGGSEMKKQITDLKRGAEIVVATPGRFIDI 393

Query: 255 KVEMN----LDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSATLPSSLV 310
            + +N    L    I +V+ DEADRLF++GF+ Q+ +++ ++   +Q +LFSAT P+ L 
Sbjct: 394 -LTLNDGKLLSTKRITFVIMDEADRLFDLGFEPQITQIMKTVRPDKQCVLFSATFPNKLR 452

Query: 311 DFAKAGLTNPVLVRLDTETKVSENLEMLF-LSVKNDEREANLLYLLQEVIKIPVATEEQL 369
            FA   L +P+ + ++++  V+EN++  F +   +DE+  NL+ +     K     + ++
Sbjct: 453 SFAVRVLRSPISITINSKGLVNENVKQKFKICHSDDEKFENLIQIAHGGNKFFDEGQTEI 512

Query: 370 QRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNS-TIIFVSTRHHVEYVSN 428
                                               D+   ++  IIFVS++   + +S 
Sbjct: 513 D-------------------------------GETSDLDETDAKAIIFVSSQQICDLISK 541

Query: 429 LLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSLP 488
            L + G +   ++       R   L  F+    +IL+ T+V +RG+++P ++ V+  +  
Sbjct: 542 KLTNAGIVAYAIHAGKPYQERLMNLEKFKREKNSILLCTEVLSRGLNVPEVSLVIIYNAV 601

Query: 489 ASSKIFVHRVGRTARAGNKGWAYTI 513
            +   +VH  GRTAR    G A T+
Sbjct: 602 KTFAQYVHTTGRTARGSRSGTAITL 626

>KAFR0E01640 Chr5 complement(335123..337405) [2283 bp, 760 aa] {ON}
           Anc_5.241 YJL033W
          Length = 760

 Score =  181 bits (459), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 127/385 (32%), Positives = 191/385 (49%), Gaps = 44/385 (11%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKL--KM 184
           +S   L  ++   F Q T IQR +IP+ L+  D++G ARTGSGKT AF++P++EKL  + 
Sbjct: 48  ISAQTLKGLNESAFIQLTGIQRDSIPVSLKGHDVLGAARTGSGKTLAFLIPVLEKLYREK 107

Query: 185 HSAKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVI 244
            +A  G  A+I+SP+RELAMQ ++V  +  + ++  + L+ GG  ++ + S  +S  +++
Sbjct: 108 WTAFDGLGALIISPTRELAMQIYEVLIKIGRHTSFSAGLVIGGKDVKFE-SERISKINIL 166

Query: 245 IATPGRFL-HLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSA 303
           I TPGR L HL   + L   +++ +V DEADR  +MGF++ L+ ++ +LP +RQTLLFSA
Sbjct: 167 IGTPGRVLQHLDQAVGLSTSNLQMLVLDEADRCLDMGFKKTLDAIVSNLPASRQTLLFSA 226

Query: 304 TLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPV 363
           T  +SL D A+  LT+          K    LEM       D+ +AN             
Sbjct: 227 TQSNSLADLARLSLTD---------YKSVGTLEM------ADDNQAN-----------SS 260

Query: 364 ATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHV 423
           AT E LQ+                             L S+K +              H 
Sbjct: 261 ATPETLQQSHIIVALPDKLDILFSFIKTHLKAKLIVFLSSSKQV--------------HF 306

Query: 424 EYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVV 483
            Y +      G  + +L+G   Q AR + L  F       L  TDV ARG+D P +  V+
Sbjct: 307 VYETFRKMQPGISLMHLHGRQKQKARTETLDKFNRAQHVCLFATDVVARGIDFPAVNWVI 366

Query: 484 NMSLPASSKIFVHRVGRTARAGNKG 508
            +  P     ++HRVGRT R G KG
Sbjct: 367 QVDCPEDVDTYIHRVGRTGRYGKKG 391

>KLLA0A05203g Chr1 complement(462167..463474) [1308 bp, 435 aa] {ON}
           highly similar to uniprot|P38719 Saccharomyces
           cerevisiae YHR169W DBP8 Putative ATP-dependent RNA
           helicase of the DEAD-box family involved in biogenesis
           of the 40S ribosomal subunit
          Length = 435

 Score =  174 bits (442), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 122/394 (30%), Positives = 181/394 (45%), Gaps = 62/394 (15%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHS 186
            SK+++  ++     QPT IQ+  IP IL+ RD +G A TGSGKT AF  P++ K     
Sbjct: 11  CSKWLVEALNAMKIVQPTAIQKACIPEILKGRDCIGGANTGSGKTIAFAAPMLTKWSEDP 70

Query: 187 AKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIA 246
              G   ++L+P+RELAMQ  + F  F    N+R  ++ GG+ +  Q   +   P  IIA
Sbjct: 71  Q--GMFGIVLTPTRELAMQIAEQFTAFGSAMNIRVAIVVGGESIVQQAIELQKRPHFIIA 128

Query: 247 TPGRFLHLKVEMNLD----LHSIEYVVFDEADRLFEMGFQEQLNELLGSLP--TARQTLL 300
           TPGR  H  +    D    L  ++++V DEAD L    F + L   +  LP    RQ LL
Sbjct: 129 TPGRLAHHVLNSGEDTIGGLKRVKFLVLDEADILLTETFSKDLATCVSILPPKNKRQNLL 188

Query: 301 FSATLPSSLVDFAKAGLT--NPVLVRLDTET----KVSENLEMLFLSVKNDEREANLLYL 354
           F+AT+   +   + A  T   P +   + E+     + + LE  +L V    +E+   YL
Sbjct: 189 FTATMTDQVKALSDAPQTEGKPPVFTFEVESVDNVAIPKTLETTYLLVPEHVKES---YL 245

Query: 355 LQEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTI 414
            Q      + T E+  +                                       +S I
Sbjct: 246 YQ------ILTSEKYVK---------------------------------------SSCI 260

Query: 415 IFVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGV 474
           IFV+     E +   LK     V+ L+  + Q  R   +  FR     +L+ TDVA+RG+
Sbjct: 261 IFVNRTVTAEILRRTLKSLDVRVTSLHSQMPQQERTNSVQRFRAQAARVLIATDVASRGL 320

Query: 475 DIPLLANVVNMSLPASSKIFVHRVGRTARAGNKG 508
           DIP++  VVN  +P +   F+HR GRTARAG  G
Sbjct: 321 DIPIVELVVNYDIPGNPDTFIHRAGRTARAGRHG 354

>AFL221C Chr6 complement(22711..23108,23775..25050) [1674 bp, 557
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YNL112W (DBP2); 1-intron
          Length = 557

 Score =  177 bits (449), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 110/390 (28%), Positives = 190/390 (48%), Gaps = 51/390 (13%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMH- 185
             +++L  +  +GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I  +    
Sbjct: 121 FPEYVLKEVKEEGFEKPTAIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIVHINAQP 180

Query: 186 --SAKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDV 243
             S   G   ++L+P+RELA+Q  K   +F + S +R+  + GG     Q   +    ++
Sbjct: 181 LLSPGDGPVVLVLAPTRELAVQIQKECSKFGRSSRIRNTCVYGGVPKSQQIRDLQRGVEI 240

Query: 244 IIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSA 303
           +IATPGR + +      +L  + Y+V DEADR+ +MGF+ Q+ +++  +   RQTL++SA
Sbjct: 241 LIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSA 300

Query: 304 TLPSSLVDFAKAGLTNPVLVRLDT-ETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIP 362
           T P  +   A+  L +P+ V + + E   S  +  L   V + ++   L+  L+      
Sbjct: 301 TWPKEVQQLARDYLHDPIQVNIGSLELAASHTITQLGEVVSDFDKRDRLVKHLEI----- 355

Query: 363 VATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHH 422
                                                    +KD  S    II  ST+  
Sbjct: 356 ----------------------------------------GSKDKDS--KIIILHSTKRT 373

Query: 423 VEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANV 482
            + +++ L+  G+    ++G          L+++R G + I+V TDV ARG+D+  +  V
Sbjct: 374 CDEITSYLRQDGWPALAIHGPTPLQDIDCTLNDYRTGRSPIMVATDVVARGIDVKGINFV 433

Query: 483 VNMSLPASSKIFVHRVGRTARAGNKGWAYT 512
           +N  +P + + +VHR+GRT RAG  G A +
Sbjct: 434 INYDMPGNIEDYVHRIGRTGRAGATGTAIS 463

>TDEL0G00930 Chr7 complement(186836..188146) [1311 bp, 436 aa] {ON}
           Anc_5.69 YHR169W
          Length = 436

 Score =  173 bits (439), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 123/398 (30%), Positives = 187/398 (46%), Gaps = 62/398 (15%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHS 186
           L ++++  +S     QPT IQ+  IP I++  D +G A+TGSGKT AF  P++ K     
Sbjct: 14  LPRWLVDALSAMRITQPTSIQKGCIPAIMKGGDCIGGAKTGSGKTIAFAAPMLTKWSEDP 73

Query: 187 AKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIA 246
           +  G   ++L+P+RELAMQ  + F       N+R  ++ GG+ +  Q   +   P  IIA
Sbjct: 74  S--GMFGVVLTPTRELAMQIAEQFTALGSSMNIRVSIVVGGESIVKQALELQRKPHFIIA 131

Query: 247 TPGRFLHLKVEMNLD----LHSIEYVVFDEADRLFEMGFQEQLNELLGSLPT--ARQTLL 300
           TPGR  H  +    D    L   +++V DEAD L    F + LN  + +LP    RQTLL
Sbjct: 132 TPGRLAHHILNSGEDTVGGLMRAKFLVLDEADSLLTSTFAKDLNVCVSALPPKDKRQTLL 191

Query: 301 FSATLPSSL--VDFAKAGLTNPVLVRLDTE----TKVSENLEMLFLSVKNDEREANLLYL 354
           F+AT+   +  +  A +    P L   + E      V   L+  ++ +    +EA L +L
Sbjct: 192 FTATITDQVRALQDAPSQENKPPLYCYEVENVDNVAVPSTLKTEYILIPEYVKEAYLYHL 251

Query: 355 LQEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTI 414
           L         T E+                                    KD    +S I
Sbjct: 252 L---------TSEEY-----------------------------------KD----SSAI 263

Query: 415 IFVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGV 474
           IFV+     E +   LK+    V+ L+  + Q  R   L  FR     +L+ TDVA+RG+
Sbjct: 264 IFVNRTMTAEIMRRTLKNLDIRVASLHSQMPQQERTNSLQRFRANAARVLIATDVASRGL 323

Query: 475 DIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWAYT 512
           DIP++  VVN  +P+   +++HR GRTARAG +G A +
Sbjct: 324 DIPVVELVVNYDIPSDPDVYIHRSGRTARAGRRGDAIS 361

>YDR243C Chr4 complement(948518..950284) [1767 bp, 588 aa] {ON}
           PRP28RNA helicase in the DEAD-box family, involved in
           RNA isomerization at the 5' splice site
          Length = 588

 Score =  177 bits (448), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 120/396 (30%), Positives = 195/396 (49%), Gaps = 73/396 (18%)

Query: 140 FRQPTPIQRKTIPLIL---QQRDIVGMARTGSGKTAAFVLPLIEKL-----KMHSAKI-- 189
           F  PTPIQR TIP +    Q RD +G+A TGSGKT AFV+P++ K+     +  S KI  
Sbjct: 194 FPSPTPIQRITIPNVCNMKQYRDFLGVASTGSGKTLAFVIPILIKMSRSPPRPPSLKIID 253

Query: 190 GARAMILSPSRELAMQ----THKVFKEFAKGSN--LRSVLLTGGDGLEDQFSMMMSNPDV 243
           G +A+IL+P+REL  Q    T KV K ++K SN   + + + GG  LE+    +    D+
Sbjct: 254 GPKALILAPTRELVQQIQKETQKVTKIWSKESNYDCKVISIVGGHSLEEISFSLSEGCDI 313

Query: 244 IIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSL------PTARQ 297
           ++ATPGR +       L +  +E +V DEAD++ ++GF++Q+  +L  +         RQ
Sbjct: 314 LVATPGRLIDSLENHLLVMKQVETLVLDEADKMIDLGFEDQVTNILTKVDINADSAVNRQ 373

Query: 298 TLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQE 357
           TL+F+AT+   +   A   +  PV   +  ET                        L+Q+
Sbjct: 374 TLMFTATMTPVIEKIAAGYMQKPVYATIGVETGSEP--------------------LIQQ 413

Query: 358 VIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFV 417
           V++     E++ ++ +                          P+ +  D P     IIF+
Sbjct: 414 VVEYADNDEDKFKKLK--------------------------PIVAKYDPP----IIIFI 443

Query: 418 STRHHVEYVS-NLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDI 476
           + +   ++++    K+    V+ L+G+  Q  R   L  FR     I++ T+VAARG+DI
Sbjct: 444 NYKQTADWLAEKFQKETNMKVTILHGSKSQEQREHSLQLFRTNKVQIMIATNVAARGLDI 503

Query: 477 PLLANVVNMSLPASSKIFVHRVGRTARAGNKGWAYT 512
           P ++ VVN  +      ++HR+GRT RA N+G A +
Sbjct: 504 PNVSLVVNFQISKKMDDYIHRIGRTGRAANEGTAVS 539

>KNAG0M00660 Chr13 complement(107772..110426) [2655 bp, 884 aa] {ON}
           Anc_6.148 YBR237W
          Length = 884

 Score =  180 bits (457), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 111/383 (28%), Positives = 201/383 (52%), Gaps = 51/383 (13%)

Query: 140 FRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLK----MHSAKIGARAMI 195
           F   TPIQ + +P I+  RD++G+++TGSGKT +++LPL+  +K    +   + G  A+I
Sbjct: 325 FDSLTPIQAQALPAIMSGRDVIGISKTGSGKTISYLLPLLRHIKAQRPLSKNETGPLALI 384

Query: 196 LSPSRELAMQTHKVFKEFAKGS-NLRSVLLTGGDGLEDQFSMMMSNPDVIIATPGRFLHL 254
           ++P+RELA+Q ++    F     +LR++  TGG  L+ Q + +    ++++ATPGRF+ L
Sbjct: 385 IAPTRELALQIYQETLRFLDSDKSLRAICCTGGSQLKTQINDLKRGTEIVVATPGRFIDL 444

Query: 255 KVEMN----LDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSATLPSSLV 310
            + MN    +    I +VV DEADRLF+MGF+ Q+ +++ ++   +Q +LFSAT P+ L 
Sbjct: 445 -LTMNSGKLISSKKISFVVLDEADRLFDMGFEPQVTQIMKTIRPDKQCVLFSATFPNKLR 503

Query: 311 DFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVATEEQLQ 370
           +FA   L +P+ + +++ T V+EN+        N+  + ++L  L E  +  + + EQ +
Sbjct: 504 NFAMRVLKSPLSITINSNTMVNENVTQKVELCNNELDKFDILLSLLEKHQAKLVSPEQDE 563

Query: 371 RFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYVSNLL 430
           +                                          IIFV+++   + +   L
Sbjct: 564 KV-----------------------------------------IIFVASQQICDTLYAKL 582

Query: 431 KDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSLPAS 490
           ++  Y +  ++       R   L+ F+    +IL+ T+V +RG+++P ++ VV  +   +
Sbjct: 583 ENYDYDLFAIHAGKSYQERITNLNKFKETANSILICTEVLSRGLNVPEVSLVVIFNAIKT 642

Query: 491 SKIFVHRVGRTARAGNKGWAYTI 513
              +VH  GRTAR  N G A T+
Sbjct: 643 FAQYVHTTGRTARGNNHGDAITL 665

>CAGL0K07029g Chr11 complement(690501..692951) [2451 bp, 816 aa]
           {ON} similar to uniprot|P21372 Saccharomyces cerevisiae
           YBR237w Pre-mRNA processing RNA helicase PRP5
          Length = 816

 Score =  179 bits (455), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 114/384 (29%), Positives = 198/384 (51%), Gaps = 56/384 (14%)

Query: 139 GFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLK----MHSAKIGARAM 194
            ++  TPIQ +TIP I+  RD++G+++TGSGKT +++LP+I  +K    + + + G  A+
Sbjct: 271 SYKSLTPIQTQTIPAIMSGRDVIGISKTGSGKTISYLLPMIRHVKAQKKLRNGETGPIAV 330

Query: 195 ILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIATPGRFLHL 254
           I +P+RELA+Q ++  ++     ++ S+  TGG  L+ Q   + +  ++ IATPGRF+ L
Sbjct: 331 IFAPTRELAVQINEEVQKLISDLDISSICCTGGSDLKKQIDKLKTGVEIAIATPGRFIDL 390

Query: 255 KVEMNLDLHS---IEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSATLPSSLVD 311
                 +L S   I +VV DEADRLF+ GF+ Q+  +L ++   RQ +LFSAT PS + +
Sbjct: 391 LSLNGGNLVSTLRISFVVMDEADRLFDFGFEPQIASVLRTVRPDRQCVLFSATFPSKVSN 450

Query: 312 FAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDERE--ANLLYLLQEVIKIPVATEEQL 369
           FA   L +P+ + ++ E  V+E +   F ++ +DE +    LL LL+      V   E +
Sbjct: 451 FASRFLDSPLQITVNAEGMVNERINQKF-TICSDESDKFKELLSLLK------VFNSETV 503

Query: 370 QRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYVSNL 429
                                                      TIIFVS++   + +   
Sbjct: 504 DE----------------------------------------KTIIFVSSQQICDIIEKR 523

Query: 430 LKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSLPA 489
           L D    +  ++     + RRQ L  F+    +IL+ T+V +RG+++P ++ V+  +   
Sbjct: 524 LTDYSEKLYSIHAGRPYNERRQNLELFKKTSNSILLCTEVMSRGLNVPEVSRVILYNSAK 583

Query: 490 SSKIFVHRVGRTARAGNKGWAYTI 513
           +   +VH  GRTAR   +G + ++
Sbjct: 584 TFAQYVHSTGRTARGTREGTSISL 607

>SAKL0G11748g Chr7 complement(998525..1000816) [2292 bp, 763 aa]
           {ON} highly similar to uniprot|P20448 Saccharomyces
           cerevisiae YJL033W HCA4 Putative nucleolar DEAD box RNA
           helicase high-copy number suppression of a U14 snoRNA
           processing mutant suggests an involvement in 18S rRNA
           synthesis
          Length = 763

 Score =  179 bits (453), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 121/387 (31%), Positives = 194/387 (50%), Gaps = 50/387 (12%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKL--KM 184
           +S   L  +    F + T IQ+ +IP+ L+  D++G A+TGSGKT AF++P+IEKL  + 
Sbjct: 48  ISGNTLKGLKESAFIKMTEIQKNSIPVSLKGHDLLGAAKTGSGKTLAFLIPVIEKLYREK 107

Query: 185 HSAKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVI 244
            +   G  A+I+SP+RELAMQT++V  +  + ++  + L+ GG  ++ +   + S  +V+
Sbjct: 108 WTEHDGLGALIISPTRELAMQTYEVLVKIGRHTSFSAGLVIGGKDVKFELERI-SKINVL 166

Query: 245 IATPGRFL-HLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSA 303
           I TPGR L H+   + L+   ++ +V DEADR  +MGF+  L+ ++ +LP  RQTLLFSA
Sbjct: 167 IGTPGRILQHMDQAIGLNTSGLQMLVLDEADRCLDMGFKRTLDAIVSNLPPTRQTLLFSA 226

Query: 304 TLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPV 363
           T   SL D A+  L         T+ K    +++L  +    +  A    L Q  I++P+
Sbjct: 227 TQSQSLADLARLSL---------TDYKSVGTMDVLNPA----DTPATPETLQQSYIQVPL 273

Query: 364 ATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHV 423
           A +  +                               L S       +  I+F+S+   V
Sbjct: 274 ADKLDV-------------------------------LFSFIKTHLKSKMIVFLSSSKQV 302

Query: 424 EYVSNLLKDC--GYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLAN 481
            +V    +    G  + +L+G   Q AR + L  F       L  TDV ARG+D P +  
Sbjct: 303 HFVYETFRKLQPGISLMHLHGRQKQTARTETLDKFSRAQQVCLFATDVVARGIDFPAVDW 362

Query: 482 VVNMSLPASSKIFVHRVGRTARAGNKG 508
           VV +  P     ++HR GR+AR G +G
Sbjct: 363 VVQVDCPEDVDTYIHRAGRSARYGKQG 389

>Ecym_4755 Chr4 complement(1469426..1470622) [1197 bp, 398 aa] {ON}
           similar to Ashbya gossypii AER408W
          Length = 398

 Score =  171 bits (433), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 107/382 (28%), Positives = 188/382 (49%), Gaps = 53/382 (13%)

Query: 131 ILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHSAKIG 190
           +L  I   GF  P+ IQ + I  I++ +D++  A++G+GKTA F + +++ + M S    
Sbjct: 34  LLRGIYSYGFEAPSAIQSRAITQIIKGKDVIAQAQSGTGKTATFTIAMLQIIDMKSKD-- 91

Query: 191 ARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIATPGR 250
            +A++LSP+RELA+Q  +V        N+ +   TGG  L+   +       V+  TPGR
Sbjct: 92  CQALVLSPTRELAVQISQVVTNLGGYMNVVAHACTGGKALQQDINKFNKGCHVVSGTPGR 151

Query: 251 FLHLKVEMNLDLHSIEYVVFDEADRLF--EMGFQEQLNELLGSLPTARQTLLFSATLPSS 308
            L       L+   I+ +V DEAD L    +GF++Q+ ++   LPT+ Q +L SAT+   
Sbjct: 152 VLDTIKRRALNTRHIKMLVLDEADELLSDSLGFKQQIYDIFTKLPTSVQVVLISATISKD 211

Query: 309 LVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVATEEQ 368
           +++  K  +T+PV                  L VK D+   +++       +  V  E++
Sbjct: 212 VLEVVKKLMTDPVK-----------------LLVKRDQISLDVIK------QYHVNVEKE 248

Query: 369 LQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYVSN 428
             +F                            L    D  + N  +IF +T+  V+++S 
Sbjct: 249 EWKF--------------------------DTLCDLYDSLTINQCVIFCNTKKKVDWLSR 282

Query: 429 LLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSLP 488
            L    + VS ++G + Q  R + +++FR G + +L+ TDV ARG+D+  ++ V+N  +P
Sbjct: 283 KLLQTNFAVSSIHGDMQQDEREKVMNDFRSGSSRLLISTDVWARGIDVQQISLVINYDIP 342

Query: 489 ASSKIFVHRVGRTARAGNKGWA 510
              + ++HR+GR+ R G KG A
Sbjct: 343 ELLENYIHRIGRSGRFGRKGIA 364

>TPHA0H01160 Chr8 (257728..259029) [1302 bp, 433 aa] {ON} Anc_5.69
           YHR169W
          Length = 433

 Score =  172 bits (436), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 126/398 (31%), Positives = 179/398 (44%), Gaps = 62/398 (15%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHS 186
           LSK+++  ++      PT IQ   IP IL  RD +G A+TGSGKT AF  P++ K     
Sbjct: 11  LSKWLVEALNAMRISTPTAIQSNCIPAILNGRDCIGGAKTGSGKTVAFAAPMLTKWSEDP 70

Query: 187 AKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIA 246
           +  G   +IL+P+RELAMQ  + F       N+R  L+ GG+ +  Q   +   P  IIA
Sbjct: 71  S--GMFGVILTPTRELAMQIAEQFTALGASMNIRICLVVGGESIVKQALELQKKPHFIIA 128

Query: 247 TPGRFLHLKVEMNLD----LHSIEYVVFDEADRLFEMGFQEQLNELLGSLPT--ARQTLL 300
           TPGR  H  +    D    L   +++V DEAD L    F + L   +  LP    RQTLL
Sbjct: 129 TPGRLAHHIMASGEDTVGGLIRTKFLVLDEADILLTSTFSKDLAVCIQKLPAKDKRQTLL 188

Query: 301 FSATLPSSLVDFAKAGLT--NPVLVRLDTET----KVSENLEMLFLSVKNDEREANLLYL 354
           F+AT+   +     A      P L   +  T     +   L++ +L V +  +EA L  L
Sbjct: 189 FTATITDQVRALQNAPTQEYKPPLYCYEVGTVDTVAIPSTLKVEYLLVPDYVKEAYLYQL 248

Query: 355 LQEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTI 414
           L                                               + KD    +S I
Sbjct: 249 LT--------------------------------------------CETYKD----SSAI 260

Query: 415 IFVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGV 474
           +FV+     E +   L++    V+ L+  L Q  R   L  FR     +L+ TDVAARG+
Sbjct: 261 VFVNRTATAEVLRRTLRELEIRVTSLHSQLPQQERTNSLQRFRANAARVLIATDVAARGL 320

Query: 475 DIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWAYT 512
           DIP++  V+N  +P     F+HR GRTARAG KG A +
Sbjct: 321 DIPIVELVINYDIPQDPDTFIHRSGRTARAGRKGDAIS 358

>KLLA0A10659g Chr1 complement(927059..928255) [1197 bp, 398 aa] {ON}
           highly similar to uniprot|Q12099 Saccharomyces
           cerevisiae YDR021W FAL1 Nucleolar protein required for
           maturation of 18S rRNA member of the eIF4A subfamily of
           DEAD-box ATP-dependent RNA helicases
          Length = 398

 Score =  171 bits (433), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 101/382 (26%), Positives = 188/382 (49%), Gaps = 53/382 (13%)

Query: 131 ILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHSAKIG 190
           +L  I   GF  P+ IQ + I  I+  +D++  A++G+GKTA F + L++ +   S ++ 
Sbjct: 34  LLRGIYFYGFEYPSSIQSRAISQIISGKDVIAQAQSGTGKTATFTIGLLQAIDSKSKEL- 92

Query: 191 ARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIATPGR 250
            +A++LSP+RELA Q+  V        N+ +   TGG  L+     +  N  V+  TPGR
Sbjct: 93  -QALVLSPTRELASQSESVISNLGDYLNVTAHACTGGKALQQDIKKVSKNCQVVSGTPGR 151

Query: 251 FLHLKVEMNLDLHSIEYVVFDEADRLF--EMGFQEQLNELLGSLPTARQTLLFSATLPSS 308
            L +     L++ + + +V DEAD L    +GF++Q+ ++   LP   Q ++ SAT+   
Sbjct: 152 VLDMIKRQVLNVRNCKILVLDEADELLGETLGFKQQIYDIFTKLPPTIQVVVVSATMSKD 211

Query: 309 LVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVATEEQ 368
           +++  K  +++PV + +  +    + ++  ++ V+ +E + + L  L + + I       
Sbjct: 212 ILEITKKFMSDPVKILVKRDEISLDVIKQYYVDVEKEEWKFDTLCDLYDSLTI------- 264

Query: 369 LQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYVSN 428
                                                        +IF +TR  V+++S 
Sbjct: 265 ------------------------------------------TQCVIFCNTRKKVDWLSR 282

Query: 429 LLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSLP 488
            L    + VS ++G + Q  R Q +++FR G   +L+ TDV ARG+D+  ++ V+N  +P
Sbjct: 283 KLTQTNFSVSSMHGDMKQEERDQVMNDFRSGKARVLISTDVWARGIDVQQISLVINYDIP 342

Query: 489 ASSKIFVHRVGRTARAGNKGWA 510
            + + ++HR+GR+ R G KG A
Sbjct: 343 DNLENYIHRIGRSGRFGRKGVA 364

>NCAS0H01280 Chr8 complement(243749..246412) [2664 bp, 887 aa] {ON}
           Anc_6.148
          Length = 887

 Score =  179 bits (454), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 109/379 (28%), Positives = 194/379 (51%), Gaps = 39/379 (10%)

Query: 144 TPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLK----MHSAKIGARAMILSPS 199
           TPIQ + IP I+  RD++G+++TGSGKT +++LPL+  +K    +   + G   +IL+P+
Sbjct: 315 TPIQSQAIPAIMSGRDVIGISKTGSGKTISYLLPLLRHIKAQRPLSKNETGPLGLILAPT 374

Query: 200 RELAMQTHKVFKEF-AKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIATPGRFLHLKVEM 258
           RELA+Q H   + F     N+RS+  TGG  L+ Q + +     +++ATPGRF+ L + +
Sbjct: 375 RELALQIHDEIERFIVHDENIRSICCTGGSELKKQINDLKRGVQIVVATPGRFIDL-LTL 433

Query: 259 N----LDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSATLPSSLVDFAK 314
           N    +    I +V+ DEADRLF++GF+ Q+ +++ ++   +Q +LFSAT P+ L +FA 
Sbjct: 434 NTGKLVSTERITFVIMDEADRLFDLGFEPQITQIMKTIRPDKQCVLFSATFPNKLRNFAM 493

Query: 315 AGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVATEEQLQRFRX 374
             L +P+ + +++   V+EN+E      + D  +       QE++ I     +Q  +   
Sbjct: 494 RILNSPLSITINSNNLVNENVEQKVAICETDSAK------FQELLTILQNQNKQQDQCEN 547

Query: 375 XXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYVSNLLKDCG 434
                                                 TIIFV+++   + + + L + G
Sbjct: 548 DEDEEREDETTLDK-----------------------KTIIFVASQQICDLLYSQLVNFG 584

Query: 435 YLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSLPASSKIF 494
           Y +  ++       R   L  F+    +IL+ T+V +RG+++P ++ V+  +   +   +
Sbjct: 585 YSLFAIHAGKPYQERITNLEGFKNTKNSILICTEVLSRGLNVPEVSLVIIYNAVKTFAQY 644

Query: 495 VHRVGRTARAGNKGWAYTI 513
           VH  GRTAR    G A T+
Sbjct: 645 VHTTGRTARGNLHGIAITL 663

>NCAS0A10430 Chr1 (2073293..2074492) [1200 bp, 399 aa] {ON}
           Anc_3.249
          Length = 399

 Score =  171 bits (432), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 101/383 (26%), Positives = 192/383 (50%), Gaps = 54/383 (14%)

Query: 131 ILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHSAKIG 190
           +L  I   GF  P+ IQ + I  I+   DI+  A++G+GKTA F + +++ + +    + 
Sbjct: 34  LLRGIYSYGFETPSSIQSRAITRIISGSDIIAQAQSGTGKTATFAIGMLQIIDLKKKDL- 92

Query: 191 ARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQF-SMMMSNPDVIIATPG 249
            +A+ILSP+RELA+Q ++V        N++S+ +TGG  ++D    +  S   V+  TPG
Sbjct: 93  -QALILSPTRELAVQINQVVSNLGDYMNVKSLAMTGGKMMKDDLKKVSKSGCQVVSGTPG 151

Query: 250 RFLHLKVEMNLDLHSIEYVVFDEADRLF--EMGFQEQLNELLGSLPTARQTLLFSATLPS 307
           R L +     L + +I+ +V DEAD L    +GF++Q+ ++   LP + Q ++ SAT+  
Sbjct: 152 RVLDMIKRQLLAIRNIQMLVLDEADELLGESLGFKQQIYDIFAKLPKSCQVVVVSATMSK 211

Query: 308 SLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVATEE 367
            +++  K  +++PV + +  +    E ++  ++ V  +E + + L  + + + I      
Sbjct: 212 DIIEVTKKFMSDPVKILVKQDEISLEGIKQYYVDVGKEEWKFDTLCDIYDSLTI------ 265

Query: 368 QLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYVS 427
                                                         +IF +T+  V+++S
Sbjct: 266 -------------------------------------------TQCVIFCNTKKKVDWLS 282

Query: 428 NLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSL 487
             L    + V  ++G + Q  R + +++FR G + +L+ TDV ARG+D+  ++ V+N  L
Sbjct: 283 AKLTQSNFAVVSMHGDMKQEERDKVMNDFRTGHSRVLISTDVWARGIDVQQVSLVINYDL 342

Query: 488 PASSKIFVHRVGRTARAGNKGWA 510
           P + + ++HR+GR+ R G KG A
Sbjct: 343 PENMENYIHRIGRSGRFGRKGIA 365

>Kpol_1062.5 s1062 complement(10370..11665) [1296 bp, 431 aa] {ON}
           complement(10370..11665) [1296 nt, 432 aa]
          Length = 431

 Score =  171 bits (432), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 121/398 (30%), Positives = 183/398 (45%), Gaps = 62/398 (15%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHS 186
           LS++++ +++      PT IQ+  IP IL+ RD +G A+TGSGKT AF  P++ +     
Sbjct: 9   LSRWLVESLNAMRITHPTAIQKHCIPEILKGRDCIGGAKTGSGKTIAFAGPMLSQWSDDP 68

Query: 187 AKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIA 246
           +  G   ++L+P+RELA+Q  + F       N+R  L+ GG+ +  Q   +   P  IIA
Sbjct: 69  S--GMFGVVLTPTRELAIQIAEQFTALGSSMNIRVCLVVGGESIVKQALELQKKPHFIIA 126

Query: 247 TPGRFLHLKV----EMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLP--TARQTLL 300
           TPGR  H  +    E+   L  ++Y+V DEAD +    F   L+  +  LP    RQTLL
Sbjct: 127 TPGRLAHHILSSGEEVVGGLSRVKYLVLDEADLILTQTFAADLSTCIAKLPPKQKRQTLL 186

Query: 301 FSATLPSSL--VDFAKAGLTNPVLVRLDTE----TKVSENLEMLFLSVKNDEREANLLYL 354
           F+AT+   +  +  A A  + P L   + E      V   L++ +L V    +EA L  L
Sbjct: 187 FTATITDQVRALQNAPAQDSKPPLFAYEVENVDNVAVPSTLKLEYLLVPEHVKEAYLYQL 246

Query: 355 LQEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTI 414
           L                                               + +D    +S I
Sbjct: 247 L-----------------------------------------------TCEDYKD-SSVI 258

Query: 415 IFVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGV 474
           +FV+     E +   L+     V+ L+  + Q  R   L  FR     +L+ TDVAARG+
Sbjct: 259 VFVNRTTAAEVLRRTLRSLEVRVASLHSQMPQSERINSLQRFRANAARVLIATDVAARGL 318

Query: 475 DIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWAYT 512
           DIP +  V+N  +P     F+HR GRTARAG  G A +
Sbjct: 319 DIPTVELVINYDIPQDPDTFIHRSGRTARAGRSGDAIS 356

>TPHA0M00900 Chr13 (175733..176935) [1203 bp, 400 aa] {ON} Anc_3.249
           YDR021W
          Length = 400

 Score =  169 bits (429), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 97/381 (25%), Positives = 189/381 (49%), Gaps = 54/381 (14%)

Query: 131 ILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHSAKIG 190
           +L  +   GF  P+ IQ + I  I+   D++  A++G+GKTA F + +++ + +    + 
Sbjct: 35  LLKGVYLYGFEAPSAIQSRAITQIISGTDVIAQAQSGTGKTATFTIGMLQVIDLKRKDL- 93

Query: 191 ARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMM-MSNPDVIIATPG 249
            +A+ILSP+RELA Q ++V        N++S  +TGG  ++D    M  S   V+  TPG
Sbjct: 94  -QALILSPTRELATQINQVVTNLGDYMNVQSYAMTGGKTMKDDLKKMNKSGCQVVSGTPG 152

Query: 250 RFLHLKVEMNLDLHSIEYVVFDEADRLF--EMGFQEQLNELLGSLPTARQTLLFSATLPS 307
           R L +     +   +++ ++ DEAD L    +GF++Q+ E+   LP+A Q ++ SAT+  
Sbjct: 153 RVLDMIKRQLISTRNVQMLILDEADELLGEHLGFKQQIYEIFAKLPSACQVVVVSATMSK 212

Query: 308 SLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVATEE 367
            +++  K  +++P  + +  +    E ++  +++V  ++ + + L  L + + I      
Sbjct: 213 DIIEVTKKFMSDPTKILVKRDEISLEGIKQFYVNVSKEDWKFDTLCDLYDSLTI------ 266

Query: 368 QLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYVS 427
                                                         +IF +T+  V+++S
Sbjct: 267 -------------------------------------------TQCVIFCNTKKKVDWLS 283

Query: 428 NLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSL 487
             L    + V  ++G + Q  R + +++FR G + +L+ TDV ARG+D+  ++ V+N  L
Sbjct: 284 QKLTRSNFSVIAMHGDMKQEDRDKVMNDFRTGTSRVLISTDVWARGIDVQQVSLVINYDL 343

Query: 488 PASSKIFVHRVGRTARAGNKG 508
           P + + ++HR+GR+ R G KG
Sbjct: 344 PENMENYIHRIGRSGRFGRKG 364

>KLLA0D09504g Chr4 complement(801783..804095) [2313 bp, 770 aa] {ON}
           highly similar to uniprot|P20448 Saccharomyces
           cerevisiae YJL033W HCA4 Putative nucleolar DEAD box RNA
           helicase high-copy number suppression of a U14 snoRNA
           processing mutant suggests an involvement in 18S rRNA
           synthesis
          Length = 770

 Score =  176 bits (446), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 123/394 (31%), Positives = 192/394 (48%), Gaps = 64/394 (16%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKL--KM 184
           +S+  L  +    F + T IQR++IPL L+  D++G A+TGSGKT AF++P+IEKL  + 
Sbjct: 48  ISEQTLKGLKEAAFIKLTEIQRESIPLSLKGHDVLGAAKTGSGKTLAFLIPVIEKLYREK 107

Query: 185 HSAKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVI 244
            +   G  A+I+SP+RELAMQ ++V  +  K +   + L+ GG  +  +    +S  +++
Sbjct: 108 WTDMDGLGALIISPTRELAMQIYEVLSKIGKHTTFSAGLVIGGKDVTFE-KERISRINIL 166

Query: 245 IATPGRFL-HLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSA 303
           I TPGR L H+   +  +  +++ +V DEADR  +MGF+  L+ ++ +LP +RQTLLFSA
Sbjct: 167 IGTPGRILQHMDQAVGFNTSNLQLLVLDEADRCLDMGFKRTLDAIINNLPASRQTLLFSA 226

Query: 304 TLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPV 363
           T   SL D A+  L         T+ K    +E+L  +  +                   
Sbjct: 227 TQSQSLDDLARLSL---------TDYKQVGTMEVLNANSSS------------------- 258

Query: 364 ATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDM-------PSPNSTIIF 416
           AT E LQ+                            PLP   D+          +  I+F
Sbjct: 259 ATPESLQQ-----------------------SYIEVPLPDKLDILFSFIKSHLKSKLIVF 295

Query: 417 VSTRHHVEYVSNLLKDC--GYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGV 474
           +S+   V +V    +    G  + +L+G   Q AR + L  F       L  TDV ARG+
Sbjct: 296 LSSSKQVHFVYETFRKLQPGISLMHLHGRQKQTARTETLDKFSRAQHVCLFSTDVVARGI 355

Query: 475 DIPLLANVVNMSLPASSKIFVHRVGRTARAGNKG 508
           D P +  V+ +  P     ++HRVGR AR G +G
Sbjct: 356 DFPSVDWVIQVDCPEDVDTYIHRVGRAARFGKEG 389

>ZYRO0A03476g Chr1 complement(277585..278784) [1200 bp, 399 aa] {ON}
           highly similar to uniprot|Q12099 Saccharomyces
           cerevisiae YDR021W FAL1 Nucleolar protein required for
           maturation of 18S rRNA member of the eIF4A subfamily of
           DEAD-box ATP-dependent RNA helicases
          Length = 399

 Score =  169 bits (427), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 101/383 (26%), Positives = 189/383 (49%), Gaps = 54/383 (14%)

Query: 131 ILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHSAKIG 190
           +L  I   GF  P+ IQ + I  I+  +D++  A++G+GKTA F + +++ L++    + 
Sbjct: 34  LLRGIYSYGFEAPSSIQSRAITQIISGKDVIAQAQSGTGKTATFTIGMLQVLELKRKDL- 92

Query: 191 ARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSN-PDVIIATPG 249
            +A++LSP+RELA Q+ +V        N+++  LTGG  L+D    + S+   V+  TPG
Sbjct: 93  -QALVLSPTRELASQSCQVVSNLGDYLNVKAFALTGGKALKDDLKRIQSSGCHVVSGTPG 151

Query: 250 RFLHLKVEMNLDLHSIEYVVFDEADRLFE--MGFQEQLNELLGSLPTARQTLLFSATLPS 307
           R L L     +   +++ +V DEAD L    +GF++Q+ ++   LP   Q ++ SAT+  
Sbjct: 152 RVLDLIKRQVVQTRNVQVLVLDEADELLSETLGFKQQIYDIFARLPPGCQVVVVSATMSR 211

Query: 308 SLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVATEE 367
            +++  K  +++PV + +  +    E +   ++ V  +E + + L  L + + I      
Sbjct: 212 DILEVTKKFMSDPVKILVKRDEISLEGISQYYVDVSKEEWKFDTLCDLYDSLTI------ 265

Query: 368 QLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYVS 427
                                                         +IF +TR  V+++S
Sbjct: 266 -------------------------------------------TQCVIFCNTRKKVDWLS 282

Query: 428 NLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSL 487
             L    + V  ++G + Q  R + +++FR G + +L+ TDV ARG+D+  ++ V+N  +
Sbjct: 283 KKLIQSNFAVVSMHGDMKQEDRDKVMNDFRTGHSRVLISTDVWARGIDVQQISLVINYDM 342

Query: 488 PASSKIFVHRVGRTARAGNKGWA 510
           P   + ++HR+GR+ R G KG A
Sbjct: 343 PEIMENYIHRIGRSGRFGRKGVA 365

>AER301C Chr5 complement(1188485..1189792) [1308 bp, 435 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR169W
           (DBP8)
          Length = 435

 Score =  169 bits (429), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 124/398 (31%), Positives = 180/398 (45%), Gaps = 62/398 (15%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHS 186
           ++K++   ++     QPT IQ+  IP IL  RD +G A+TGSGKT AF  P++ K    +
Sbjct: 13  VAKWLAEALNSMKITQPTTIQKACIPEILAGRDCIGGAKTGSGKTIAFAAPMLTKWS--A 70

Query: 187 AKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIA 246
              G   ++L+P+RELAMQ  + F       N+R  L+ GG+ +  Q   +   P  IIA
Sbjct: 71  DPCGMFGIVLTPTRELAMQIAEQFTALGSVMNIRVALVVGGEDIVSQALELQRKPHFIIA 130

Query: 247 TPGRFLHLKVEMNLD----LHSIEYVVFDEADRLFEMGFQEQLNELLGSLPT--ARQTLL 300
           TPGR  H  +    D    L  + Y+V DEAD L    F + L   +  LP    RQ LL
Sbjct: 131 TPGRLAHHIMHSGEDTIGGLKRVRYLVLDEADILLTDTFSDALATCVQILPPKEKRQNLL 190

Query: 301 FSATLPSSLVDFAKAGLTN--PVLVRLDTET----KVSENLEMLFLSVKNDEREANLLYL 354
           F+AT+   ++    A  T+  P L     E      V  +L+  +L V    +EA   YL
Sbjct: 191 FTATMTDQVLALKDAPPTSGKPPLFSFHVENLDDLAVPASLQTTYLLVPEHVKEA---YL 247

Query: 355 LQEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTI 414
            Q      V + E+ +                                         S I
Sbjct: 248 YQ------VLSSEEYKS---------------------------------------KSAI 262

Query: 415 IFVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGV 474
           +FV+     E +  +L      V+ L+  + Q  R   L  FR     +L+ TDVA+RG+
Sbjct: 263 VFVNRTISAEILRRMLMQLEIRVTSLHSQMPQRERTNSLQRFRANAARVLIATDVASRGL 322

Query: 475 DIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWAYT 512
           DIP +  VVN  +PA+   ++HR GRTARAG  G A +
Sbjct: 323 DIPAVQLVVNYDIPANPDTYIHRAGRTARAGRGGEALS 360

>TBLA0D03400 Chr4 (844529..846856) [2328 bp, 775 aa] {ON} Anc_5.241
           YJL033W
          Length = 775

 Score =  175 bits (444), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 125/390 (32%), Positives = 196/390 (50%), Gaps = 54/390 (13%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHS 186
           +S   L  +    F + T IQ+ +IP+ L+  D++G A+TGSGKT AF++P++EKL   +
Sbjct: 49  ISNATLRGLKEASFVKLTEIQKNSIPISLKGYDVLGAAKTGSGKTLAFLIPVLEKLYREN 108

Query: 187 AK--IGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVI 244
                G  A+I+SP+RELA+Q ++V  +    ++  + L+ GG  ++ + S  +S  +++
Sbjct: 109 WTEFDGLGALIISPTRELAIQIYEVLLKIGSRTSFSAGLVIGGKDVKFE-SERISRINIL 167

Query: 245 IATPGRFL-HLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSA 303
           I TPGR L H+   + L+L++++ +V DEADR  +MGF++ L+ ++ +LP +RQTLLFSA
Sbjct: 168 IGTPGRILQHMDQAVGLNLNNLQMLVLDEADRCLDMGFKKTLDAIVNNLPISRQTLLFSA 227

Query: 304 TLPSSLVDFAKAGLTNPVLVRLD-TETKVSENLEMLFLSVKNDEREANLL--YLLQEVIK 360
           T   SL D          L RL  T+ K    L++    VK +E  A+     L Q  I 
Sbjct: 228 TQSQSLDD----------LARLSLTDYKSIGTLDI----VKENETGASATPETLQQSYID 273

Query: 361 IPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTR 420
           +P+  +                                  L S       N  IIF+S+ 
Sbjct: 274 VPLQDK-------------------------------LDTLFSFIKTHLKNKMIIFLSSS 302

Query: 421 HHVEYVSNLLKDC--GYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPL 478
             V +V    +    G  + +L+G   Q AR + L  F       L  TDV ARG+D P 
Sbjct: 303 KQVHFVYETFRKLQPGISLMHLHGRQKQKARTETLDKFSRAQQVCLFATDVVARGIDFPS 362

Query: 479 LANVVNMSLPASSKIFVHRVGRTARAGNKG 508
           +  VV +  P     ++HRVGR AR G +G
Sbjct: 363 VDWVVQVDCPEDVDTYIHRVGRCARYGKQG 392

>NDAI0C06300 Chr3 complement(1459510..1461354) [1845 bp, 614 aa]
           {ON} Anc_8.87
          Length = 614

 Score =  172 bits (437), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 166/577 (28%), Positives = 256/577 (44%), Gaps = 102/577 (17%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHS 186
           +  +I   I   GF Q TP+Q  TIP+  Q +D+V  + TGSGKT AFV+P++E++    
Sbjct: 15  IQPWIRTAIDVMGFDQMTPVQASTIPMFSQNKDVVVESVTGSGKTVAFVIPVLERIISEG 74

Query: 187 A------KIGARAMILSPSRELAMQTHKVFKEFAKGSN-----LRSVLLTGGD--GLEDQ 233
           A      K    ++I+SP+RELA QT  V  EF K        +++ LL G +   + D 
Sbjct: 75  ANKKSFKKGHFHSLIISPTRELAKQTKIVIDEFLKQYPDDMYPIKAQLLVGTNENTVRDD 134

Query: 234 FSMMMSN-PDVIIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSL 292
            +  + N P +++ TPGR L      ++   S   V+ DEADRL ++ F + + ++L  L
Sbjct: 135 VNDFLENKPQILVGTPGRLLDFLQMTSVKTSSCGMVIIDEADRLLDISFVKDVEKILSVL 194

Query: 293 PTARQTLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLL 352
           P  R+T LFSAT+ S+     K GL NPV ++++++      L++ ++ V  + +   LL
Sbjct: 195 PKQRRTGLFSATISSAGDSIFKTGLRNPVKIKVNSKNVAPSLLKLNYVVVDPELKFQYLL 254

Query: 353 YLLQEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNS 412
            LL               RF+                                  P+  S
Sbjct: 255 NLLNNY------------RFKKCIVY----------------------------FPTCIS 274

Query: 413 TIIFVSTRHHVEYVSNLLKDCGY-------LVSYLYGTLDQHARRQQLHNFRCGLTN-IL 464
              F S    ++Y+ N  K+  +        +  L+G L   +R + L +F   LTN +L
Sbjct: 275 VTYFYS---FMQYLQNEFKNSKHPFLNEDLQIFSLHGKLQTASRMKTLDSFTETLTNAVL 331

Query: 465 VVTDVAARGVDIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWAYTIXXXXXXXXXXX 524
           + TDVAARG+DIP +  VV +  P  S IF+HR GRT RA   G A T            
Sbjct: 332 LTTDVAARGIDIPDVDLVVQLDPPTDSDIFLHRCGRTGRANRIGQAITF----------- 380

Query: 525 XXXXXGKKVLLTPMYEATCDLLKKKWISEGNEGALFQPPKISY--VNRLILGSAPRLD-- 580
                G++       +     +K   + E N   L  P +  Y    + IL    R D  
Sbjct: 381 --LNKGREEDFVTFMQ-----VKNVELEEINNLELINPCENFYDIFKKWILQDRARFDHS 433

Query: 581 ---LEAMGDLFKNLVESN-FELQNLKAVSI-KAEKLYLRTRQPASAESIKRAKE---VIA 632
                A    + N   S+ F LQ+L  V+I K   L+   R P   + +K   E   V A
Sbjct: 434 IKAFVAFIRYYSNHSASSIFRLQSLNYVAICKMHGLFRLPRMPEITKYLKDDPENPVVFA 493

Query: 633 AGW------DEQNVRFG-KNIEKEKLEFLAKLQNRHN 662
            GW      +  N  +  K  EK++L+ L + Q+ H+
Sbjct: 494 DGWLVNPPINLDNFAYADKKREKKRLDELKRTQDIHD 530

>SAKL0D03960g Chr4 complement(321960..323156) [1197 bp, 398 aa] {ON}
           highly similar to uniprot|Q12099 Saccharomyces
           cerevisiae YDR021W FAL1 Nucleolar protein required for
           maturation of 18S rRNA member of the eIF4A subfamily of
           DEAD-box ATP-dependent RNA helicases
          Length = 398

 Score =  167 bits (424), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 99/382 (25%), Positives = 190/382 (49%), Gaps = 53/382 (13%)

Query: 131 ILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHSAKIG 190
           +L  I   GF  P+ IQ + I  I+  RD++  A++G+GKTA F + +++ + + S  + 
Sbjct: 34  LLRGIYSYGFEAPSAIQSRAITQIISGRDVIAQAQSGTGKTATFTIGMLQAIDVKSKDL- 92

Query: 191 ARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIATPGR 250
            ++++LSP+RELA Q  +V        ++ +   TGG  L+     +  +  V+  TPGR
Sbjct: 93  -QSLVLSPTRELATQISQVVSNLGDYMSISAHACTGGKTLQADIKKLSKSCQVVSGTPGR 151

Query: 251 FLHLKVEMNLDLHSIEYVVFDEADRLFE--MGFQEQLNELLGSLPTARQTLLFSATLPSS 308
            L +     L+  +++ +V DEAD L    +GF++Q+ ++   LPT+ Q ++ SAT+   
Sbjct: 152 VLDMIKRRLLNTRNVKMLVLDEADELLSETLGFKQQIYDIFTKLPTSVQVVVVSATMNKD 211

Query: 309 LVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVATEEQ 368
           +++  K  +++PV + +  +    E ++   ++V  +E + + L  L + + I       
Sbjct: 212 ILEITKKFMSDPVKILVKRDEISLEGIKQYHVNVDKEEWKFDTLCDLYDSLTI------- 264

Query: 369 LQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYVSN 428
                                                        +IF +T+  V+++S+
Sbjct: 265 ------------------------------------------TQCVIFCNTKKKVDWLSH 282

Query: 429 LLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSLP 488
            L    + VS ++G + Q  R + +++FR G + +L+ TDV ARG+D+  ++ V+N  LP
Sbjct: 283 KLAQANFAVSAMHGDMKQEERDKVMNDFRNGTSRVLISTDVWARGIDVQQVSLVINYDLP 342

Query: 489 ASSKIFVHRVGRTARAGNKGWA 510
              + ++HR+GR+ R G KG A
Sbjct: 343 EILESYIHRIGRSGRFGRKGVA 364

>AGR333C Chr7 complement(1353154..1354668) [1515 bp, 504 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR290C
           (HAS1)
          Length = 504

 Score =  170 bits (431), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 122/392 (31%), Positives = 194/392 (49%), Gaps = 64/392 (16%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHS 186
           LS   L  I + GF + T +Q +TIP ++  RD++G A+TGSGKT AF+LP IE L  HS
Sbjct: 46  LSSQTLKAIGKMGFTKMTQVQARTIPPLMAGRDVLGAAKTGSGKTLAFLLPAIEML--HS 103

Query: 187 AKI----GARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPD 242
            K     G   ++++P+RELA+Q   V +E  +  +    ++ GG     +   +    +
Sbjct: 104 LKFKPRNGTGVIVITPTRELALQIFGVARELMEFHSQTFGIVIGGANRRQEAEKLAKGVN 163

Query: 243 VIIATPGRFL-HLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTA-RQTLL 300
           ++IATPGR L HL+        +++ +V DEADR+ E+GF++++ +++  LP   RQ++L
Sbjct: 164 LLIATPGRLLDHLQNTKGFVFKNLKALVIDEADRILEIGFEDEMKQIIKILPNEDRQSML 223

Query: 301 FSATLPSSLVDFAKAGL-TNPVLVRLDT--ETKVSENLEMLFLSVKNDEREANLLYLLQE 357
           FSAT  + + D A+  L   P+ + +D+  ET  ++ LE  ++   +D+R   L      
Sbjct: 224 FSATQTTKVEDLARISLRPGPLFINVDSEKETSTADGLEQGYVVCDSDKRFLLLFTF--- 280

Query: 358 VIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTII-F 416
                      L++F+                                     N  II F
Sbjct: 281 -----------LKKFQ-------------------------------------NKKIIVF 292

Query: 417 VSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDI 476
           +S+ + V+Y + LL      V  L+G   Q  R      F      ILV TDVAARG+DI
Sbjct: 293 LSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILVCTDVAARGLDI 352

Query: 477 PLLANVVNMSLPASSKIFVHRVGRTARAGNKG 508
           P +  ++    P   + ++HRVGRTA+ G KG
Sbjct: 353 PAVDWIIQFDPPDDPRDYIHRVGRTAK-GTKG 383

>ZYRO0C11660g Chr3 (912287..913594) [1308 bp, 435 aa] {ON} highly
           similar to uniprot|P38719 Saccharomyces cerevisiae
           YHR169W DBP8 Putative ATP-dependent RNA helicase of the
           DEAD-box family involved in biogenesis of the 40S
           ribosomal subunit
          Length = 435

 Score =  168 bits (425), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 123/393 (31%), Positives = 184/393 (46%), Gaps = 53/393 (13%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHS 186
           +SK+++  ++     QPT IQ   IP IL+ RD +G A+TGSGKT AF  P++ K     
Sbjct: 14  VSKWLVETLNAMKISQPTTIQSACIPEILKGRDCIGGAKTGSGKTIAFGAPMLTKWSEDP 73

Query: 187 AKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIA 246
              G   ++L+P+RELAMQ  + F       N+R  ++ GG+ +  Q   +   P  IIA
Sbjct: 74  C--GMFGVVLTPTRELAMQIAEQFTALGSNMNIRVSIIVGGEDIVKQGLELQRKPHFIIA 131

Query: 247 TPGRFLHLKVEMNLD----LHSIEYVVFDEADRLFEMGFQEQLNELLGSLP--TARQTLL 300
           TPGR  H  +    D    L   +++V DEAD L    F + L   +G+LP    RQTLL
Sbjct: 132 TPGRLAHHILNSGDDTVGGLIRTKFLVLDEADSLLTGTFAKDLAICIGALPPKNKRQTLL 191

Query: 301 FSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLF-LSVKNDEREANLLYLLQEVI 359
           F+    +++ D  +A            E   SE    LF   V + ++ A    L  E I
Sbjct: 192 FT----ATVTDQVRA-----------LENAPSEGKPPLFTYEVASMDKVAIPSSLKTEYI 236

Query: 360 KIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVST 419
            +P   +E                                 L + +D    ++ ++FV+ 
Sbjct: 237 LVPEYVKEAY----------------------------LYQLLTCEDYKD-STAMVFVNR 267

Query: 420 RHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLL 479
               E +   L   G  V+ L+  + Q  R   LH FR     +L+ TDVA+RG+DIP +
Sbjct: 268 TMAAEILRRTLYAMGVRVTSLHSQMPQQERTNSLHRFRANAARVLIATDVASRGLDIPTV 327

Query: 480 ANVVNMSLPASSKIFVHRVGRTARAGNKGWAYT 512
             VVN  +P+   +F+HR GRTARAG +G A +
Sbjct: 328 QLVVNYDIPSDPDVFIHRSGRTARAGRRGDAIS 360

>SAKL0H11968g Chr8 (1022452..1024152) [1701 bp, 566 aa] {ON} similar
           to uniprot|P23394 Saccharomyces cerevisiae YDR243C PRP28
           RNA helicase in the DEAD-box family involved in RNA
           isomerization at the 5' splice site
          Length = 566

 Score =  171 bits (432), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 115/394 (29%), Positives = 198/394 (50%), Gaps = 71/394 (18%)

Query: 135 ISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLK-----MHSAKI 189
           I +  + +PTPIQR TIP +   RD +G+A TGSGKT AF++P+I KL          K+
Sbjct: 179 IRKLHYTEPTPIQRVTIPNVDNGRDFLGVAVTGSGKTLAFLIPIIIKLNTLPPLTEITKL 238

Query: 190 -GARAMILSPSRELAMQ----THKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVI 244
            G  ++IL+P+RELA Q      K+ + +++  N+ S++  GG  +E+    +    +++
Sbjct: 239 NGPYSLILAPTRELAQQIEAEARKLTQYWSRPCNVVSIV--GGHAIEEISYNLSRGCEIL 296

Query: 245 IATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTA--RQTLLFS 302
           +ATPGR +       L L  +  +V DEADR+ + GF++QL  +L    ++  RQT++F+
Sbjct: 297 VATPGRLIDCLENHVLVLEQVNILVLDEADRMIDYGFEDQLTTILSKTSSSNKRQTMMFT 356

Query: 303 ATLPSSLVDFAKAGLTNPVLVRL---DTETKVSENLEMLFLSVKNDEREANLLYLLQEVI 359
           AT+  ++   A   L  P  V +   +T+ ++++ LE L         E   L L +++ 
Sbjct: 357 ATMSPTIEKIADGYLNKPAYVTIGGEETKPQITQILEYL------PSEEKRFLKLSKDI- 409

Query: 360 KIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVST 419
                                                    LP     P+P   IIF++ 
Sbjct: 410 -----------------------------------------LPH---YPAP--IIIFINY 423

Query: 420 RHHVEYVSNLLKD-CGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPL 478
           +   ++++   +D   Y  + L+G+  Q  R   L+  R G  +I++ T+VA RG+DIP 
Sbjct: 424 KRTADWLAKKFQDETKYRTTTLHGSKSQEQRENSLNLLRSGKADIMIATNVAGRGIDIPN 483

Query: 479 LANVVNMSLPASSKIFVHRVGRTARAGNKGWAYT 512
           ++ VVN  +    + ++HR+GRT RAG +G++ T
Sbjct: 484 VSLVVNFQMATKLEDYIHRIGRTGRAGKEGYSIT 517

>Kpol_1036.3 s1036 complement(10496..11695) [1200 bp, 399 aa] {ON}
           complement(10496..11695) [1200 nt, 400 aa]
          Length = 399

 Score =  166 bits (421), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 98/383 (25%), Positives = 191/383 (49%), Gaps = 54/383 (14%)

Query: 131 ILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHSAKIG 190
           +L  I   GF  P+ IQ + I  I+   D++  A++G+GKTA F + +++ + +    + 
Sbjct: 34  LLRGIYGYGFEAPSAIQSRAITQIISGTDVIAQAQSGTGKTATFTIGMLQAIDLKRKDL- 92

Query: 191 ARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSN-PDVIIATPG 249
            +A++LSP+RELA Q ++V        N++S  +TGG  ++D  + M  N   V+  TPG
Sbjct: 93  -QALVLSPTRELASQINQVVSNLGDYMNVQSYAMTGGKTMKDDLNRMQKNGCQVVSGTPG 151

Query: 250 RFLHLKVEMNLDLHSIEYVVFDEADRLF--EMGFQEQLNELLGSLPTARQTLLFSATLPS 307
           R L +     L+  +++ ++ DEAD L    +GF++Q+ ++   LP A Q ++ SAT+  
Sbjct: 152 RVLDMFKRHLLNTRNVQMLILDEADELLGESLGFKQQIYDIFTKLPAACQVVVVSATMSK 211

Query: 308 SLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVATEE 367
            +++  K  +++PV + +  +    E ++  +++V+ ++ + + L  L + + I      
Sbjct: 212 DILEVTKKFMSDPVKILVKRDEISLEGIKQYYVNVEKEDWKFDTLCDLYDSLTI------ 265

Query: 368 QLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYVS 427
                                                         +IF +T+  V+++S
Sbjct: 266 -------------------------------------------TQCVIFCNTKKKVDWLS 282

Query: 428 NLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSL 487
             L    + V  ++G + Q  R + + +FR G + +L+ TDV ARG+D+  ++ V+N  +
Sbjct: 283 AKLTQSNFAVVSMHGDMKQEDRNKVMSDFRSGHSRVLISTDVWARGIDVQQVSLVINYDI 342

Query: 488 PASSKIFVHRVGRTARAGNKGWA 510
           P   + ++HR+GR+ R G KG A
Sbjct: 343 PEIMENYIHRIGRSGRFGRKGVA 365

>YJL033W Chr10 (383837..386149) [2313 bp, 770 aa] {ON}  HCA4Putative
           nucleolar DEAD box RNA helicase; high-copy number
           suppression of a U14 snoRNA processing mutant suggests
           an involvement in 18S rRNA synthesis
          Length = 770

 Score =  172 bits (437), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 122/388 (31%), Positives = 194/388 (50%), Gaps = 50/388 (12%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKL--KM 184
           +S   L  +    F + T IQ  +IP+ LQ  D++  A+TGSGKT AF++P+IEKL  + 
Sbjct: 48  ISDPTLKGLRESSFIKLTEIQADSIPVSLQGHDVLAAAKTGSGKTLAFLVPVIEKLYREK 107

Query: 185 HSAKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVI 244
            +   G  A+I+SP+RELAMQ ++V  +    ++  + L+ GG  ++ +   + S  +++
Sbjct: 108 WTEFDGLGALIISPTRELAMQIYEVLTKIGSHTSFSAGLVIGGKDVKFELERI-SRINIL 166

Query: 245 IATPGRFL-HLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSA 303
           I TPGR L HL   + L+  +++ +V DEADR  +MGF++ L+ ++ +L  +RQTLLFSA
Sbjct: 167 IGTPGRILQHLDQAVGLNTSNLQMLVLDEADRCLDMGFKKTLDAIVSTLSPSRQTLLFSA 226

Query: 304 TLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEV-IKIP 362
           T   S+ D A+  L         T+ K     +++  SV    +EA+    LQ+  I++P
Sbjct: 227 TQSQSVADLARLSL---------TDYKTVGTHDVMDGSVN---KEASTPETLQQFYIEVP 274

Query: 363 VATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHH 422
           +A +  +                               L S          I+F+S+   
Sbjct: 275 LADKLDI-------------------------------LFSFIKSHLKCKMIVFLSSSKQ 303

Query: 423 VEYVSNLLKDC--GYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLA 480
           V +V    +    G  + +L+G   Q AR + L  F       L  TDV ARG+D P + 
Sbjct: 304 VHFVYETFRKMQPGISLMHLHGRQKQRARTETLDKFNRAQQVCLFATDVVARGIDFPAVD 363

Query: 481 NVVNMSLPASSKIFVHRVGRTARAGNKG 508
            VV +  P     ++HRVGR AR G KG
Sbjct: 364 WVVQVDCPEDVDTYIHRVGRCARYGKKG 391

>TBLA0I01860 Chr9 (418583..419746) [1164 bp, 387 aa] {ON} Anc_3.249
           YDR021W
          Length = 387

 Score =  165 bits (417), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 99/383 (25%), Positives = 191/383 (49%), Gaps = 54/383 (14%)

Query: 131 ILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHSAKIG 190
           +L  I   GF  P+ IQ + I  I+  +D++  A++G+GKTA F + +++ + + +  + 
Sbjct: 34  LLRGIYSYGFEAPSAIQSRAITQIISGKDVIAQAQSGTGKTATFTIGMLQAIDLKNKDL- 92

Query: 191 ARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSN-PDVIIATPG 249
            +A+ILSP+RELA Q H+V        N++S  +TGG  ++D    +  N   V+  TPG
Sbjct: 93  -QALILSPTRELASQIHQVVSNLGDYMNVQSFAITGGKTMKDDIKKIQRNGCQVVSGTPG 151

Query: 250 RFLHLKVEMNLDLHSIEYVVFDEADRLFE--MGFQEQLNELLGSLPTARQTLLFSATLPS 307
           R L +     L   +I+ ++ DEAD L    +GF++Q+ ++   LP + Q ++ SAT+  
Sbjct: 152 RVLDMFKRQMLKSRNIKMLILDEADELLSETLGFKQQIYDIFTKLPPSCQVVVVSATMNK 211

Query: 308 SLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVATEE 367
            +++  K  + +PV + +  +    E ++  +++V+ +E + + L  L + + I      
Sbjct: 212 DILEITKKFMNDPVKILVKRDEISLEGIKQYYVNVEREEWKFDTLCDLYDSLTIT----- 266

Query: 368 QLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYVS 427
                                                         +IF +++  V+++S
Sbjct: 267 --------------------------------------------QCVIFCNSKKKVDWLS 282

Query: 428 NLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSL 487
             L    + +  ++G ++Q  R + ++ FR G + +LV TDV ARG+D+  ++ V+N  L
Sbjct: 283 QKLIQNNFAIVSMHGDMEQDERDRVMNEFRTGQSRVLVSTDVWARGIDVQQVSLVINYDL 342

Query: 488 PASSKIFVHRVGRTARAGNKGWA 510
             + + ++HR+GR+ R G KG A
Sbjct: 343 CENLENYIHRIGRSGRFGRKGIA 365

>TDEL0D03760 Chr4 complement(689455..690651) [1197 bp, 398 aa] {ON}
           Anc_3.249 YDR021W
          Length = 398

 Score =  165 bits (417), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 96/383 (25%), Positives = 189/383 (49%), Gaps = 54/383 (14%)

Query: 131 ILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHSAKIG 190
           +L  I   GF  P+ IQ + I  I+  +D++  A++G+GKTA F + +++ +++    + 
Sbjct: 34  LLRGIYSYGFEAPSAIQSRAITQIISGKDVIAQAQSGTGKTATFTIGILQAIELKRKDL- 92

Query: 191 ARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMM-SNPDVIIATPG 249
            +A++LSP+RELA Q  +V        N+++  +TGG  L+D    +  S   ++  TPG
Sbjct: 93  -QALVLSPTRELATQISQVVSNLGDYMNVKTYAITGGKTLKDDIKKIQGSGCHIVSGTPG 151

Query: 250 RFLHLKVEMNLDLHSIEYVVFDEADRLFE--MGFQEQLNELLGSLPTARQTLLFSATLPS 307
           R L +     L   S++ ++ DEAD L    +GF+ Q+ ++   LP A Q ++ SAT+  
Sbjct: 152 RVLDMIKRQILKTRSVQMLILDEADELLSERLGFKNQIYDIFTKLPPACQVVVVSATMNK 211

Query: 308 SLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVATEE 367
            +++  K  +++PV + +  +    E ++   ++V  ++ + + L  L + + I      
Sbjct: 212 DILEITKKFMSDPVKILVKKDEISLEGIKQYMVNVDKEDWKFDTLCDLYDSLTI------ 265

Query: 368 QLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYVS 427
                                                         +IF +T+  V++++
Sbjct: 266 -------------------------------------------TQCVIFCNTKKKVDWLA 282

Query: 428 NLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSL 487
             +    + VS ++G + Q  R + +++FR G + +L+ TDV ARG+D+  ++ V+N  +
Sbjct: 283 QKMSQSNFAVSSMHGDMKQEDRDRVMNDFRTGHSRVLISTDVWARGIDVQQISLVINYDI 342

Query: 488 PASSKIFVHRVGRTARAGNKGWA 510
           P   + ++HR+GR+ R G KG A
Sbjct: 343 PEILENYIHRIGRSGRFGRKGVA 365

>CAGL0M06567g Chr13 complement(679126..680325) [1200 bp, 399 aa]
           {ON} highly similar to uniprot|Q12099 Saccharomyces
           cerevisiae YDR021w FAL1 involved in maturation of 18S
           rRNA
          Length = 399

 Score =  165 bits (417), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 98/387 (25%), Positives = 191/387 (49%), Gaps = 54/387 (13%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHS 186
           L + +L  I   GF  P+ IQ + I  I+  +D++  A++G+GKTA F + +++ + +  
Sbjct: 30  LKEGLLRGIYSYGFEAPSAIQSRAITQIISGKDVIAQAQSGTGKTATFTIGMLQAIDLKK 89

Query: 187 AKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSN-PDVII 245
             +  +A++LSP+RELA Q  KV        N+++  +TGG  ++D    +  +   VI 
Sbjct: 90  HDL--QALVLSPTRELAAQIGKVVTNLGDYMNVKAYAMTGGKTMKDDLKKIQKHGCQVIS 147

Query: 246 ATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFE--MGFQEQLNELLGSLPTARQTLLFSA 303
            TPGR L +     ++   ++ +V DEAD L    +GF+ Q+ ++   LP   Q ++ SA
Sbjct: 148 GTPGRVLDMIKRRLIETRHVQILVLDEADELLSDTLGFKHQIYDIFTKLPRTSQVVVVSA 207

Query: 304 TLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPV 363
           T+   +++  K  + +PV + +  +    E ++  +++V+ +E + + L  + + + I  
Sbjct: 208 TMSPEILEITKKFMNDPVKILVKRDEITLEGIKQYYVNVEKEEWKFDTLCDIYDSLTI-- 265

Query: 364 ATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHV 423
                                                             +IF +++  V
Sbjct: 266 -----------------------------------------------TQCVIFCNSKKKV 278

Query: 424 EYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVV 483
           +++++ LK   + V  ++G + Q  R + ++ FR G + +L+ TDV ARG+D+  ++ V+
Sbjct: 279 DWLAHKLKQSNFAVISMHGDMKQDERDRVMNEFRTGQSRVLISTDVWARGIDVQQVSLVI 338

Query: 484 NMSLPASSKIFVHRVGRTARAGNKGWA 510
           N  LP  ++ +VHR+GR+ R G KG A
Sbjct: 339 NYDLPEITENYVHRIGRSGRFGRKGVA 365

>Skud_4.505 Chr4 complement(903103..904917) [1815 bp, 604 aa] {ON}
           YDR243C (REAL)
          Length = 604

 Score =  169 bits (428), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 113/397 (28%), Positives = 193/397 (48%), Gaps = 73/397 (18%)

Query: 140 FRQPTPIQRKTIPLIL---QQRDIVGMARTGSGKTAAFVLPLIEKLKMHSAKI------- 189
           F  PTPIQR TIP +    Q RD +G+A TGSGKT AF++P++ ++   S +        
Sbjct: 210 FPLPTPIQRITIPNVCNAKQYRDFLGVASTGSGKTLAFIIPVLIRMSRSSPRPTSLKIMD 269

Query: 190 GARAMILSPSRELAMQTH----KVFKEFAKGSN--LRSVLLTGGDGLEDQFSMMMSNPDV 243
           G +A+IL+P+REL  Q      KV K +++ SN   R V + GG  LE+    +    D+
Sbjct: 270 GPKALILAPTRELVQQIQVEAEKVTKIWSRESNYDCRVVSIVGGHSLEEISYSLSEGCDI 329

Query: 244 IIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSL------PTARQ 297
           ++ATPGR +       L +  +E +V DEAD++ ++GF++Q+  +L  +       T RQ
Sbjct: 330 LVATPGRLIDSLENHLLVMKQVETLVLDEADKMIDLGFEDQVTTILTKVDVSADSATNRQ 389

Query: 298 TLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQE 357
           TL+F+AT+   +   A   +  PV   +  +T                        L+Q+
Sbjct: 390 TLMFTATMTPVIEKIAAGYMRKPVYATIGVDTGSEP--------------------LIQQ 429

Query: 358 VIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFV 417
           +++     E++ ++ +                           + +  + P     IIF+
Sbjct: 430 IVEYADNEEQKFKKLKS--------------------------IVTKYEPP----IIIFI 459

Query: 418 STRHHVEYVSNLL-KDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDI 476
           + +   ++++    K+    V+ L+G+  Q  R   L  FR G   +++ T+VAARG+DI
Sbjct: 460 NYKQTADWLAERFQKETNMRVTILHGSKSQEQREHSLQLFRSGRVQVMIATNVAARGLDI 519

Query: 477 PLLANVVNMSLPASSKIFVHRVGRTARAGNKGWAYTI 513
           P ++ VVN  +      ++HR+GRT RA  KG A ++
Sbjct: 520 PNVSLVVNFQISKKIDDYIHRIGRTGRAAKKGTAISL 556

>Skud_10.189 Chr10 (351797..354109) [2313 bp, 770 aa] {ON} YJL033W
           (REAL)
          Length = 770

 Score =  171 bits (434), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 120/387 (31%), Positives = 189/387 (48%), Gaps = 48/387 (12%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKL--KM 184
           +S   L  +    F + T IQ  +IP+ LQ  D++  A+TGSGKT AF++P+IEKL  + 
Sbjct: 48  ISDPTLKGLRESSFIKLTEIQADSIPVSLQGHDVLAAAKTGSGKTLAFLVPVIEKLYREK 107

Query: 185 HSAKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVI 244
            +   G  A+I+SP+RELAMQ ++V  +    ++  + L+ GG  ++ +   + S  +++
Sbjct: 108 WTEFDGLGALIISPTRELAMQIYEVLTKIGSRTSFSAGLVIGGKDVKFELERI-SRINIL 166

Query: 245 IATPGRFL-HLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSA 303
           I TPGR L HL   + L+  +++ +V DEADR  +MGF++ L+ ++ +L  +RQTLLFSA
Sbjct: 167 IGTPGRILQHLDQAVGLNTSNLQMLVLDEADRCLDMGFKKTLDAIVDTLSPSRQTLLFSA 226

Query: 304 TLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPV 363
           T   S+ D A+  L         T+ K     +++  SV         L   Q  I++P+
Sbjct: 227 TQSQSVADLARLSL---------TDYKTVGTYDVMDGSVNKGPSTPETLQ--QSYIEVPL 275

Query: 364 ATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHV 423
           A +  +                               L S          I+F+S+   V
Sbjct: 276 ADKLDI-------------------------------LFSFIKSHLKCKMIVFLSSSKQV 304

Query: 424 EYVSNLLKDC--GYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLAN 481
            +V    +    G  + +L+G   Q AR + L  F       L  TDV ARG+D P +  
Sbjct: 305 HFVYETFRKMQPGISLMHLHGRQKQRARTETLDKFNRAQQVCLFATDVVARGIDFPAVDW 364

Query: 482 VVNMSLPASSKIFVHRVGRTARAGNKG 508
           VV +  P     ++HRVGR AR G KG
Sbjct: 365 VVQVDCPEDVDTYIHRVGRCARYGKKG 391

>KLTH0A02244g Chr1 (190077..191873) [1797 bp, 598 aa] {ON} similar
           to uniprot|P25808 Saccharomyces cerevisiae YFL002C SPB4
           involved in the maturation of 25S ribosomal RNA
           ATP-dependent RNA helicase
          Length = 598

 Score =  169 bits (427), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 122/401 (30%), Positives = 192/401 (47%), Gaps = 57/401 (14%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEK----- 181
           L  +I   I   GF   TP+Q  TIP+    +D+V  + TGSGKT AF +P++EK     
Sbjct: 14  LQPWIRTAIDAMGFEIMTPVQASTIPMFSGNKDVVVESVTGSGKTIAFTIPILEKVVKEV 73

Query: 182 LKMHSAKIGA-RAMILSPSRELAMQTHKVFKEF-----AKGSNLRSVLLTGGDG--LEDQ 233
           L     K G   ++I+SP+REL+ Q   V + F     ++   ++S L+ G     + D 
Sbjct: 74  LSGSPLKRGHFYSLIISPTRELSKQIQDVVEAFLAYYPSESCPIKSQLIVGTSSCSVRDD 133

Query: 234 FSMMMSN-PDVIIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSL 292
            S  + N P ++I TPGR L       +   S   VV DEADRL ++ F++ +  +LG L
Sbjct: 134 VSKFLENAPQILIGTPGRVLDFMKASTVKTSSCGVVVLDEADRLLDVSFEKDVESILGML 193

Query: 293 PTARQTLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLL 352
           P  R+T LFSAT+ S+     + G+ NPV + + ++ +  E+L++ ++ VK +E+  +LL
Sbjct: 194 PKQRRTGLFSATISSAGNQIYRTGMRNPVKIAVKSKVQNPESLQINYIVVKPEEKLHHLL 253

Query: 353 YLLQEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNS 412
            ++  +            R+R                                  P+  +
Sbjct: 254 NIINNM------------RYRKCIVY----------------------------FPTCQA 273

Query: 413 TIIFVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLT-NILVVTDVAA 471
              F S   H+  +S    D    V  L+G L  ++R   L  F   L   +L+ TDVAA
Sbjct: 274 VTYFYSFLKHLSDISKTRDDLE--VYSLHGKLQTNSRIGTLAKFSTSLNIAVLLTTDVAA 331

Query: 472 RGVDIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWAYT 512
           RG+DIP +  V+    P ++++F+HR GRT RA   G A T
Sbjct: 332 RGIDIPEVDLVLQFDPPTNAEMFLHRCGRTGRANRAGKAIT 372

>ZYRO0A10802g Chr1 complement(869465..871780) [2316 bp, 771 aa] {ON}
           similar to uniprot|P20448 Saccharomyces cerevisiae
           YJL033W HCA4 Putative nucleolar DEAD box RNA helicase
           high- copy number suppression of a U14 snoRNA processing
           mutant suggests an involvement in 18S rRNA synthesis
          Length = 771

 Score =  171 bits (433), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 115/395 (29%), Positives = 194/395 (49%), Gaps = 67/395 (16%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKL--KM 184
           LS  +L  +    + + T IQR +IP+ L+  D++G A+TGSGKT AF++P++EKL  + 
Sbjct: 46  LSNAVLRGLKDASYVKLTDIQRDSIPVSLKGNDVLGAAKTGSGKTLAFLIPVLEKLYRER 105

Query: 185 HSAKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVI 244
            +   G  A+I+SP+RELAMQ ++V  +     +  + L+ GG  ++ + +  +S  +++
Sbjct: 106 WTEYDGVGALIISPTRELAMQIYEVLIKIGTHCSFSAGLVIGGKDVKFE-AERISKINIL 164

Query: 245 IATPGRFL-HLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSA 303
           I TPGR L HL   + L++ +++ +V DEADR  +MGF++ L+ ++ +LP  RQTLLFSA
Sbjct: 165 IGTPGRLLQHLDQSVGLNIDNLQMLVLDEADRCLDMGFKKTLDAIVSNLPPIRQTLLFSA 224

Query: 304 TLPSS--------LVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLL 355
           T   S        L D+   G   P  V   ++ +  E L+  ++ V+  ++   L   +
Sbjct: 225 TQSQSLNDLARLSLTDYKTVG--TPANVS-GSQPETPETLQQHYIVVELADKLDTLFSFI 281

Query: 356 QEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTII 415
           +  +K  +                                                  I+
Sbjct: 282 KTHLKCKM--------------------------------------------------IV 291

Query: 416 FVSTRHHVEYVSNLLKDC--GYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARG 473
           F S+   V +V    +    G  + +L+G   Q AR + L  F       L+ TDV +RG
Sbjct: 292 FFSSSKQVHFVYETFRKLQPGISLMHLHGRQKQRARTETLDKFSRAQQVCLIATDVVSRG 351

Query: 474 VDIPLLANVVNMSLPASSKIFVHRVGRTARAGNKG 508
           +D P +  VV +  P +   ++HRVGR+AR G +G
Sbjct: 352 IDFPAVDWVVQVDCPENVDTYIHRVGRSARYGKQG 386

>KAFR0B01520 Chr2 (286962..288452) [1491 bp, 496 aa] {ON} Anc_5.40
           YMR290C
          Length = 496

 Score =  166 bits (421), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 121/391 (30%), Positives = 195/391 (49%), Gaps = 62/391 (15%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHS 186
           LS+  L  I + GF + TP+Q +TIP ++  RD++G A+TGSGKT AF+LP IE L  HS
Sbjct: 41  LSQPTLKAIDKMGFTKMTPVQARTIPPLMAGRDVLGAAKTGSGKTLAFLLPAIEML--HS 98

Query: 187 AKI----GARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPD 242
            K     G   ++++P+RELA+Q   V +E  +  +    ++ GG     +   +M   +
Sbjct: 99  LKFKPRNGTGVIVITPTRELALQIFGVVRELMEFHSQTFGIVIGGANRRQEAEKLMKGVN 158

Query: 243 VIIATPGRFL-HLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTA-RQTLL 300
           ++IATPGR L HL+        +++ +V DEADR+ E+GF++++ +++  LP   RQ++L
Sbjct: 159 ILIATPGRLLDHLQNTKGFVFKNLKALVIDEADRILEIGFEDEMRQIIKILPNEDRQSML 218

Query: 301 FSATLPSSLVDFAKAGL-TNPVLVRLDTE--TKVSENLEMLFLSVKNDEREANLLYLLQE 357
           FSAT  + + D A+  L   P+ + + +E  +  ++ LE  ++  ++D+R   L   L+ 
Sbjct: 219 FSATQTTKVEDLARISLRKGPLFINVVSEKDSSTADGLEQGYVVCESDKRFLLLFSFLKR 278

Query: 358 VIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFV 417
                   ++++  F                                  + S NS     
Sbjct: 279 ------NQKKKIIVF----------------------------------LSSCNS----- 293

Query: 418 STRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIP 477
             ++H E    LL      V  L+G   Q  R      F      ILV TDVAARG+DIP
Sbjct: 294 -VKYHAE----LLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILVCTDVAARGLDIP 348

Query: 478 LLANVVNMSLPASSKIFVHRVGRTARAGNKG 508
            +  ++    P   + ++HRVGRTAR G KG
Sbjct: 349 AVDWIIQFDPPDDPRDYIHRVGRTAR-GTKG 378

>Ecym_7324 Chr7 complement(689228..691021) [1794 bp, 597 aa] {ON}
           similar to Ashbya gossypii AGL004C
          Length = 597

 Score =  168 bits (426), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 118/390 (30%), Positives = 187/390 (47%), Gaps = 57/390 (14%)

Query: 139 GFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHSAKIGA------R 192
           GF   TP+Q  TIPL    +D+V  + TGSGKT AFV+P++EK+    A   A       
Sbjct: 26  GFEAMTPVQASTIPLFAGNKDVVVESVTGSGKTVAFVIPILEKIIKDGANSAAFRKGHFH 85

Query: 193 AMILSPSRELAMQTHKVFKEFAK-----GSNLRSVLLTGGDGL---EDQFSMMMSNPDVI 244
           ++I+SP+RELA Q   V + F          +RS ++ G + +   +D    M + P ++
Sbjct: 86  SLIVSPTRELASQIQLVVQSFLNYYPDNCYPIRSQIIVGTNQVTVRDDVAEFMQNRPQIL 145

Query: 245 IATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSAT 304
           I TPGR L     + +   S   VV DEAD+L +  F + ++ +L  LP  R+T LFSAT
Sbjct: 146 IGTPGRLLDFLKMVGVKTTSCGIVVLDEADKLLDYNFGKDVDNILKFLPKQRRTGLFSAT 205

Query: 305 LPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVA 364
           + S+  +  K G+ NPV + + +  K  ++L+M ++ V+ +++   LL +L         
Sbjct: 206 ISSAGDEVFKTGMRNPVKISVKSHKKAPQSLKMNYVVVEPEKKFELLLSIL--------- 256

Query: 365 TEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVE 424
                 RF+                                 +P+  S   F +   H+ 
Sbjct: 257 ---NYYRFKKCIVY----------------------------LPTCISVTYFYAIIQHLT 285

Query: 425 YVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLT-NILVVTDVAARGVDIPLLANVV 483
            +  + +D    +  L+G L   +R + L  F   L  ++L+ TDVAARG+DIP +  V+
Sbjct: 286 KLGQMDEDLK--IYSLHGKLQTTSRMKTLEKFTQDLNKSVLLTTDVAARGIDIPNIDLVL 343

Query: 484 NMSLPASSKIFVHRVGRTARAGNKGWAYTI 513
            M  P  + IF+HR GRT RA   G A  +
Sbjct: 344 QMDPPTDTDIFLHRCGRTGRANRVGKAIVL 373

>NDAI0A05860 Chr1 complement(1331381..1332580) [1200 bp, 399 aa]
           {ON} Anc_3.249
          Length = 399

 Score =  164 bits (414), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 104/383 (27%), Positives = 191/383 (49%), Gaps = 54/383 (14%)

Query: 131 ILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHSAKIG 190
           +L  I   GF  P+ IQ + I  I+   D++  A++G+GKTA F + +++ +   S K  
Sbjct: 34  LLKGIYSYGFESPSSIQSRAITRIIAGNDVIAQAQSGTGKTATFTIGMLQII--DSDKKQ 91

Query: 191 ARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNP-DVIIATPG 249
            + +ILSP+RELA+Q ++V        N++S+ + GG  +++    +  N   VI  TPG
Sbjct: 92  LQGLILSPTRELAVQINQVVGNLGDYMNVKSMAMIGGKMMKEDLKKINKNSCHVISGTPG 151

Query: 250 RFLHLKVEMNLDLHSIEYVVFDEADRLFE--MGFQEQLNELLGSLPTARQTLLFSATLPS 307
           R L +     L++ +I+ +V DEAD L    +GF++Q+ ++   LP + Q ++ SAT+  
Sbjct: 152 RILDMIKRQLLNVRNIQILVLDEADELLSEILGFKQQIYDIFAKLPKSCQVVVVSATMDK 211

Query: 308 SLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVATEE 367
           ++++  K  + +PV +                  VK DE        L+ + +  V  ++
Sbjct: 212 NILEITKKFMNDPVKIL-----------------VKQDEIS------LEGIKQYIVNVDK 248

Query: 368 QLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYVS 427
           +  +F                            L    D  +    +IF +T+  V+++S
Sbjct: 249 EDWKF--------------------------DTLCDIYDSLTITQCVIFCNTKKKVDWLS 282

Query: 428 NLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSL 487
             L    + V  ++G + Q  R + +++FR G + +L+ TDV ARG+D+  ++ V+N  L
Sbjct: 283 AKLAQANFAVVSMHGDMKQEDRDKVMNDFRTGHSRVLISTDVWARGIDVQQVSLVINYDL 342

Query: 488 PASSKIFVHRVGRTARAGNKGWA 510
           P + + ++HR+GR+ R G KG A
Sbjct: 343 PENMENYIHRIGRSGRFGRKGVA 365

>YDR021W Chr4 (486804..488003) [1200 bp, 399 aa] {ON}  FAL1Nucleolar
           protein required for maturation of 18S rRNA, member of
           the eIF4A subfamily of DEAD-box ATP-dependent RNA
           helicases
          Length = 399

 Score =  164 bits (414), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 103/383 (26%), Positives = 186/383 (48%), Gaps = 54/383 (14%)

Query: 131 ILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHSAKIG 190
           +L  I   GF  P+ IQ + I  I+  +D++  A++G+GKTA F + L++ + +    + 
Sbjct: 34  LLRGIYSYGFEAPSSIQSRAITQIISGKDVIAQAQSGTGKTATFTIGLLQAIDLRKKDL- 92

Query: 191 ARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSN-PDVIIATPG 249
            +A+ILSP+RELA Q  +V K      N+ +  +TGG  L+D    M  +    +  TPG
Sbjct: 93  -QALILSPTRELASQIGQVVKNLGDYMNVNAFAITGGKTLKDDLKKMQKHGCQAVSGTPG 151

Query: 250 RFLHLKVEMNLDLHSIEYVVFDEADRLFE--MGFQEQLNELLGSLPTARQTLLFSATLPS 307
           R L +  +  L   +++ +V DEAD L    +GF++Q+ ++   LP   Q ++ SAT+  
Sbjct: 152 RVLDMIKKQMLQTRNVQMLVLDEADELLSETLGFKQQIYDIFAKLPKNCQVVVVSATMNK 211

Query: 308 SLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVATEE 367
            +++  +  + +PV +                  VK DE        L+ + +  V  ++
Sbjct: 212 DILEVTRKFMNDPVKIL-----------------VKRDEIS------LEGIKQYVVNVDK 248

Query: 368 QLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYVS 427
           +  +F                            L    D  +    +IF +T+  V+++S
Sbjct: 249 EEWKF--------------------------DTLCDIYDSLTITQCVIFCNTKKKVDWLS 282

Query: 428 NLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSL 487
             L    + V  ++G + Q  R + +++FR G + +L+ TDV ARG+D+  ++ V+N  L
Sbjct: 283 QRLIQSNFAVVSMHGDMKQEERDKVMNDFRTGHSRVLISTDVWARGIDVQQVSLVINYDL 342

Query: 488 PASSKIFVHRVGRTARAGNKGWA 510
           P   + ++HR+GR+ R G KG A
Sbjct: 343 PEIIENYIHRIGRSGRFGRKGVA 365

>Skud_4.273 Chr4 (477488..478687) [1200 bp, 399 aa] {ON} YDR021W
           (REAL)
          Length = 399

 Score =  163 bits (413), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 104/383 (27%), Positives = 185/383 (48%), Gaps = 54/383 (14%)

Query: 131 ILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHSAKIG 190
           +L  I   GF  P+ IQ + I  I+  +D++  A++G+GKTA F + L++ + +   ++ 
Sbjct: 34  LLRGIYSYGFEAPSSIQSRAITQIISGKDVIAQAQSGTGKTATFTIGLLQAIDLK--RMD 91

Query: 191 ARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSN-PDVIIATPG 249
            +A+ILSP+RELA Q  +V        N+ +  +TGG  L+D    +  N   VI  TPG
Sbjct: 92  LQALILSPTRELASQIGQVVTNLGDYMNVNAFAMTGGKTLKDDLKKIQKNGCQVISGTPG 151

Query: 250 RFLHLKVEMNLDLHSIEYVVFDEADRLFE--MGFQEQLNELLGSLPTARQTLLFSATLPS 307
           R L +     L   ++  ++ DEAD L    +GF++Q+ ++   LP   Q ++ SAT+  
Sbjct: 152 RVLDMIKRQMLQTRNVRMLILDEADELLSETLGFKQQIYDIFTKLPKNCQVVVVSATMNK 211

Query: 308 SLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVATEE 367
            +++  +  L +PV +                  VK DE        L+ + +  V  ++
Sbjct: 212 DILEVTRKFLNDPVKIL-----------------VKRDEIS------LEGIKQYIVNVDK 248

Query: 368 QLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYVS 427
           +  +F                            L    D  +    +IF +T+  V+++S
Sbjct: 249 EDWKF--------------------------DTLCDIYDSLTITQCVIFCNTKKKVDWLS 282

Query: 428 NLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSL 487
             L    + V  ++G + Q  R + +++FR G + +L+ TDV ARG+D+  ++ V+N  L
Sbjct: 283 QRLTQSNFAVVSMHGDMKQEERDKVMNDFRTGHSRVLISTDVWARGIDVQQVSLVINYDL 342

Query: 488 PASSKIFVHRVGRTARAGNKGWA 510
           P   + ++HR+GR+ R G KG A
Sbjct: 343 PEIIENYIHRIGRSGRFGRKGVA 365

>CAGL0L08976g Chr12 complement(981008..982861) [1854 bp, 617 aa]
           {ON} highly similar to uniprot|P25808 Saccharomyces
           cerevisiae YFL002c SPB4
          Length = 617

 Score =  168 bits (426), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 122/400 (30%), Positives = 199/400 (49%), Gaps = 57/400 (14%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKL---K 183
           L  +I   I+  GF   TP+Q  TIP+  + +D+V  + TGSGKT AFV+P++EK+    
Sbjct: 14  LQPWIKKAINVSGFDSMTPVQASTIPMFAKNKDVVVESVTGSGKTIAFVIPILEKIISEG 73

Query: 184 MHSAKIGA---RAMILSPSRELAMQTHKVFKEFAKGSN-----LRSVLLTGGDG---LED 232
           ++++K       ++IL+P+REL+MQ   V   F +        +RS L+ G +     +D
Sbjct: 74  INNSKFKKGHFYSLILAPTRELSMQIQNVVSSFLEHYPEDQYPIRSQLVVGTNEKSVRDD 133

Query: 233 QFSMMMSNPDVIIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSL 292
             +++   P ++I TPGR L      ++   S   VV DEADRL ++ F + + ++L  L
Sbjct: 134 VNTLLDERPQILIGTPGRVLDFLQSPSVKTSSCGMVVLDEADRLLDVSFFKDVEKILNVL 193

Query: 293 PTARQTLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSV-KNDEREANL 351
           P  R+T LFSAT+ S+     K GL NPV + ++++ K +     LF SV K +E+  NL
Sbjct: 194 PKQRRTGLFSATISSAGTLIFKTGLRNPVKITVNSQGKNAPTTLNLFYSVMKPEEKLQNL 253

Query: 352 LYLLQEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPN 411
           ++++  +            RF+                                   +  
Sbjct: 254 IHIMNNI------------RFKKCIVY----------------------------FSTCV 273

Query: 412 STIIFVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTN-ILVVTDVA 470
           S   F     +++     L++   ++S ++G L   +RR+ L  F   L++ IL+ TDVA
Sbjct: 274 SVTFFYQYLKYLQQTDKTLREDLQVIS-IHGKLTTQSRRKALSTFTESLSDCILLTTDVA 332

Query: 471 ARGVDIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWA 510
           ARG+DIP +  V+ +  P  + IF+HR GRT RA   G A
Sbjct: 333 ARGIDIPDVDLVLQIDPPTDADIFLHRCGRTGRANKIGRA 372

>Kpol_1058.43 s1058 complement(121252..123075) [1824 bp, 607 aa]
           {ON} complement(121252..123075) [1824 nt, 608 aa]
          Length = 607

 Score =  168 bits (425), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 125/409 (30%), Positives = 195/409 (47%), Gaps = 79/409 (19%)

Query: 130 FILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHSA-- 187
           +I   +   GF   TP+Q  TIPL  + +D+V  + TGSGKT +FV+P+ EK+    A  
Sbjct: 17  WIRSAVDVMGFENMTPVQAATIPLFARNKDVVVDSVTGSGKTVSFVIPIFEKIVQEEANT 76

Query: 188 ----KIGARAMILSPSRELAMQTHKVFKEFAKG--SNL---RSVLLTGGD--GLEDQFSM 236
               K    ++I+SP++ELA Q H VF+ F +    NL   RS LL G +   + D  S 
Sbjct: 77  TKMKKGHFHSLIVSPTKELAKQIHSVFESFLEHYPENLYPIRSQLLVGTNVKTVRDDVSD 136

Query: 237 MMSN-PDVIIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTA 295
            M N P ++I TPGR L      ++       V+ DEADRL ++ F + +  ++  LP  
Sbjct: 137 FMENKPQILIGTPGRILDFLKIPSVKTSMCSMVILDEADRLLDVSFLKDMENIMNILPKQ 196

Query: 296 RQTLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLL 355
           R+T LFSAT+ S+  +  K GL NPV V ++++++   +L++    V+ D++       L
Sbjct: 197 RRTGLFSATITSAGDNIFKTGLRNPVKVTVNSKSQAPSSLKIDCAVVETDKK-------L 249

Query: 356 QEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTII 415
           ++VI I       +  ++                                        I 
Sbjct: 250 EQVISI-------INNYKF------------------------------------KKCIA 266

Query: 416 FVSTRHHVEYVSNLLKDCGYL-----------VSYLYGTLDQHARRQQLHNFRCGLTN-I 463
           +  T H V Y  + ++   YL           +  L+G L   AR + L  F   ++N +
Sbjct: 267 YFPTCHSVTYFYSFMQ---YLLKKGIIKEEIQIYSLHGKLQTSARIKTLETFTETISNAV 323

Query: 464 LVVTDVAARGVDIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWAYT 512
           L+ TDVAARG+DIP +  V+ +  P   ++F+HR GRT RA   G A T
Sbjct: 324 LLTTDVAARGIDIPDVDLVLQLDPPTDPEVFLHRCGRTGRANKLGKAIT 372

>Suva_2.171 Chr2 (297542..298741) [1200 bp, 399 aa] {ON} YDR021W
           (REAL)
          Length = 399

 Score =  163 bits (412), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 102/383 (26%), Positives = 185/383 (48%), Gaps = 54/383 (14%)

Query: 131 ILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHSAKIG 190
           +L  I   GF  P+ IQ + I  I+  +D++  A++G+GKTA F + L++ + +    + 
Sbjct: 34  LLRGIYSYGFEAPSSIQSRAITQIISGKDVIAQAQSGTGKTATFTIGLLQAIDLKKKDL- 92

Query: 191 ARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSN-PDVIIATPG 249
            +A+ILSP+RELA Q  +V        N+ +  +TGG  L+D    +  N   V+  TPG
Sbjct: 93  -QALILSPTRELANQIGQVVTNLGDYMNVNAFAMTGGKTLKDDLKKLQKNGCQVVSGTPG 151

Query: 250 RFLHLKVEMNLDLHSIEYVVFDEADRLFE--MGFQEQLNELLGSLPTARQTLLFSATLPS 307
           R L +     L   +++ ++ DEAD L    +GF++Q+ ++   LP   Q ++ SAT+  
Sbjct: 152 RVLDMIKRQMLQTRNVQVLILDEADELLSETLGFKQQIYDIFAKLPKNCQVVVVSATMNK 211

Query: 308 SLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVATEE 367
            +++  +  + +PV +                  VK DE        L+ + +  V  ++
Sbjct: 212 DILEVTRKFMNDPVKIL-----------------VKRDEIS------LEGIKQYVVNVDK 248

Query: 368 QLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYVS 427
           +  +F                            L    D  +    +IF +T+  V+++S
Sbjct: 249 EDWKF--------------------------DTLCDIYDSLTITQCVIFCNTKKKVDWLS 282

Query: 428 NLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSL 487
             L    + V  ++G + Q  R + +++FR G + +L+ TDV ARG+D+  ++ V+N  L
Sbjct: 283 QRLTQSNFAVVSMHGDMKQEERDKVMNDFRTGHSRVLISTDVWARGIDVQQVSLVINYDL 342

Query: 488 PASSKIFVHRVGRTARAGNKGWA 510
           P   + ++HR+GR+ R G KG A
Sbjct: 343 PEIIENYIHRIGRSGRFGRKGVA 365

>TPHA0C01860 Chr3 (425216..427039) [1824 bp, 607 aa] {ON} Anc_8.469
           YDR243C
          Length = 607

 Score =  167 bits (424), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 112/395 (28%), Positives = 191/395 (48%), Gaps = 74/395 (18%)

Query: 140 FRQPTPIQRKTIPLIL------QQRDIVGMARTGSGKTAAFVLPLIEKLK------MHSA 187
           F  PTPIQR  IP I        + D +G+A TGSGKT +FVLP++ KL       M   
Sbjct: 195 FETPTPIQRIAIPNICGKVGHSTKNDFMGIAETGSGKTFSFVLPILIKLSRSEFRPMSIK 254

Query: 188 KI-GARAMILSPSRELAMQTHKVFKEF-----AKGSNLRSVLLTGGDGLEDQFSMMMSNP 241
           K+ G +A+IL+P+RELA Q     + F      K     SV + GG  +E+    +    
Sbjct: 255 KMDGPKALILAPTRELAQQIQSEIEHFIQYWGGKSLEYTSVSIVGGYSIEELTFKISKGM 314

Query: 242 DVIIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTAR----- 296
           D+++ATPGR +       + L+ IE +V DEAD++ ++GF+EQL+ +L  + + +     
Sbjct: 315 DILVATPGRLIDCLESKLIVLNDIETLVLDEADKMIDLGFEEQLSTILSYVASYKSKDTV 374

Query: 297 QTLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQ 356
           QT++FSAT+   +     + L  P+  ++ +     E +E +   V+  E E +    ++
Sbjct: 375 QTIMFSATMSPDIEKLTTSYLHKPIFAKVGSPKSAIERIEQI---VRYSETEESTFDKIK 431

Query: 357 EVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIF 416
           E++                                              D P     IIF
Sbjct: 432 ELL-------------------------------------------YGFDSP----IIIF 444

Query: 417 VSTRHHVEYV-SNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVD 475
           ++ +   +++   + ++  +  + L+G+  Q  R   +   + G   +++ T+VAARG+D
Sbjct: 445 INYKRTADWLYKKIQEETSFHATILHGSKSQDQREHSVKLLKSGKVQVMIATNVAARGID 504

Query: 476 IPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWA 510
           IP ++ V+N  +P+S + ++HR+GRT RAGN G A
Sbjct: 505 IPNVSLVINFQIPSSFEDYIHRIGRTGRAGNSGTA 539

>Suva_2.409 Chr2 complement(727948..729717) [1770 bp, 589 aa] {ON}
           YDR243C (REAL)
          Length = 589

 Score =  167 bits (422), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 112/396 (28%), Positives = 194/396 (48%), Gaps = 73/396 (18%)

Query: 140 FRQPTPIQRKTIPLIL---QQRDIVGMARTGSGKTAAFVLPLIEKL-----KMHSAKI-- 189
           F  PTPIQR TIP +    Q RD +G+A TGSGKT AF++P++ ++     +  S KI  
Sbjct: 195 FHLPTPIQRITIPNVCRKKQYRDFLGVASTGSGKTLAFIVPILIRMSRSSPRPRSLKIMD 254

Query: 190 GARAMILSPSRELAMQTH----KVFKEFAKGSN--LRSVLLTGGDGLEDQFSMMMSNPDV 243
           G +A+IL+P+REL  Q      KV K+++  +N   + V + GG  LE+    +    D+
Sbjct: 255 GPKALILAPTRELVQQIQAEAEKVTKKWSIENNYDCKVVSIVGGHSLEEISFSLSEGCDI 314

Query: 244 IIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTA------RQ 297
           ++ATPGR +       L +  +E +V DEAD++ ++GF++Q+  +L  +  +      RQ
Sbjct: 315 LVATPGRLIDSLDNHLLVMKQVETLVLDEADKMIDLGFEDQVTNILTKVDVSADSSINRQ 374

Query: 298 TLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQE 357
           T++F+AT+ S +   A   +  PV   +  +T                        L+Q+
Sbjct: 375 TMMFTATMTSVIEKIAAGYMKKPVYATIGVDTGSEP--------------------LIQQ 414

Query: 358 VIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFV 417
           +++     +++ ++ R                         +P             I+F+
Sbjct: 415 IVEYSDNDDQKFKKLR-------------------SVVTKYEP-----------PIIVFI 444

Query: 418 STRHHVEYVSNLLKD-CGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDI 476
           + +   ++++   ++     V+ L+G+  Q  R   L  FR G   I+V T+VAARG+DI
Sbjct: 445 NYKQTADWLAEKFQNETNMKVTILHGSKSQEQREHSLKLFRSGKVQIMVATNVAARGLDI 504

Query: 477 PLLANVVNMSLPASSKIFVHRVGRTARAGNKGWAYT 512
           P ++ VVN  +P     ++HR+GRT RA  +G A +
Sbjct: 505 PNVSLVVNFQIPKKIDDYIHRIGRTGRAAKEGTAIS 540

>KLTH0G07766g Chr7 complement(626094..628388) [2295 bp, 764 aa] {ON}
           highly similar to uniprot|P20448 Saccharomyces
           cerevisiae YJL033W HCA4 Putative nucleolar DEAD box RNA
           helicase high-copy number suppression of a U14 snoRNA
           processing mutant suggests an involvement in 18S rRNA
           synthesis
          Length = 764

 Score =  169 bits (428), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 131/475 (27%), Positives = 217/475 (45%), Gaps = 107/475 (22%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKL--KM 184
           LS   L  +    F + T IQ+ +IP+ L+  D++  A+TGSGKT AF++P+IEKL  + 
Sbjct: 48  LSHQTLKGLRDSAFIKMTEIQKMSIPVSLKGHDLLAAAKTGSGKTLAFLIPVIEKLYREK 107

Query: 185 HSAKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSM-MMSNPDV 243
            +   G  A+I+SP+RELAMQT++V  +  + ++  + L+ GG   E +F +  +S  ++
Sbjct: 108 WTEFDGLGALIISPTRELAMQTYEVLTKIGRYTSFSAGLVIGGK--EVKFELDRISKINI 165

Query: 244 IIATPGRFL-HLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFS 302
           ++ TPGR L H+   + L+  +++ +V DEADR  +MGF++ L+ ++ +LP  RQTLLFS
Sbjct: 166 LVGTPGRILQHMDQAVGLNTSNLQVLVLDEADRCLDMGFKKTLDAIVMNLPPVRQTLLFS 225

Query: 303 ATLPSS--------LVDFAKAGLTNPVLVRLDTETKVS-ENLEMLFLSVKNDEREANLLY 353
           AT   S        L D+   G      V+ D+ +  + + L+  ++SV+  ++   L  
Sbjct: 226 ATQSQSLADLARLSLTDYKSVGTAE---VKDDSNSSATPDTLQQSYISVELPDKLDILFS 282

Query: 354 LLQEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNST 413
            ++  +K  +                                                  
Sbjct: 283 FIKTHLKCKM-------------------------------------------------- 292

Query: 414 IIFVSTRHHVEYVSNLLKDC--GYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAA 471
           I+F+S+   V +V    +    G  + +L+G   Q AR + L  F       L  TDV A
Sbjct: 293 IVFLSSSKQVHFVYETFRKLQPGISLMHLHGRQKQTARTETLDKFSRAQHTCLFATDVVA 352

Query: 472 RGVDIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWAYTIXXXXXXXXXXXXXXXXGK 531
           RG+D P +  VV    P +   ++HRVGR+AR G +G +                     
Sbjct: 353 RGIDFPAVDWVVQADCPENVDTYIHRVGRSARYGKQGKSL-------------------- 392

Query: 532 KVLLTPMYEA----------------TCDLLKKKWISEGNEGALFQPPKISYVNR 570
            V+LTP  E                 T    +KK I    +  LFQ P++ Y+ +
Sbjct: 393 -VMLTPQEEEGFLKRLKQRHIEPNKLTIKQSRKKSIKPQLQSLLFQDPELKYLGQ 446

>KAFR0E01160 Chr5 (232985..234202) [1218 bp, 405 aa] {ON} Anc_3.249
           YDR021W
          Length = 405

 Score =  162 bits (411), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 102/393 (25%), Positives = 195/393 (49%), Gaps = 60/393 (15%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHS 186
           L+  +L  I   GF  P+ IQ + I  I+  RD++  A++G+GKTA F + +++     S
Sbjct: 30  LNPLLLQGIYSNGFEAPSAIQSRAITQIISGRDVIAQAQSGTGKTATFTIGMLQVCNFKS 89

Query: 187 AKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGL------EDQFSMMMSN 240
           +++  + +ILSP+RELA Q ++V        N++S+ + GG         ++  +++ +N
Sbjct: 90  SEL--QCLILSPTRELASQINQVVCNIGDYLNVKSMAVVGGKTSASSSKNKNDLNLLRNN 147

Query: 241 PDVIIA-TPGRFLHLKVEMNLDLHSIEYVVFDEADRLF--EMGFQEQLNELLGSLPTARQ 297
              I++ TPGR L L     ++   ++ +V DEAD L    +GF++Q+ ++   LP   Q
Sbjct: 148 KCHIVSGTPGRVLDLIKRQVINTKKVKILVLDEADELLAESLGFKQQIYDIFTKLPKTCQ 207

Query: 298 TLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQE 357
            ++ SAT+   +++  K  L +PV + +  +    E ++   ++V  +E + + L  L +
Sbjct: 208 VVVVSATMNKDIIEVTKKFLNDPVKILVKQDQISLEGIKQYHVNVDKEEWKFDTLCDLYD 267

Query: 358 VIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFV 417
            + I                                                 N  +IF 
Sbjct: 268 SLTI-------------------------------------------------NQCVIFC 278

Query: 418 STRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIP 477
           +T+  V+++S+ L    + V  ++G + Q  R + +++FR G + +L+ TDV ARG+D+ 
Sbjct: 279 NTKKKVDWLSSKLLQANFSVVSMHGDMKQEERDKIMNDFRSGHSRVLISTDVWARGIDVQ 338

Query: 478 LLANVVNMSLPASSKIFVHRVGRTARAGNKGWA 510
            ++ V+N  LP + + ++HR+GR+ R G KG A
Sbjct: 339 QVSLVINYDLPENMENYIHRIGRSGRFGRKGVA 371

>KNAG0H01370 Chr8 complement(243799..244995) [1197 bp, 398 aa] {ON}
           Anc_3.249 YDR021W
          Length = 398

 Score =  162 bits (410), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 104/388 (26%), Positives = 185/388 (47%), Gaps = 55/388 (14%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHS 186
           L + +L  I   GF  P+ IQ + I  I+  +D++  A++G+GKTA F + +++      
Sbjct: 28  LDRKLLQGIYAYGFEAPSAIQSRAITQIISGKDVIAQAQSGTGKTATFTIGMLQACSFGQ 87

Query: 187 AKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPD--VI 244
             +  + +ILSP+RELA Q + V        N++SV L GG+ +  Q S  + N    V+
Sbjct: 88  NDL--QCLILSPTRELAGQINSVVGNLGSFLNVKSVALVGGNKMAKQDSQKLQNGQVHVV 145

Query: 245 IATPGRFLHLKVEMNLDLHSIEYVVFDEADRLF--EMGFQEQLNELLGSLPTARQTLLFS 302
             TPGR L L     L +   + +V DEAD L    +GF++Q+ ++   LP   Q ++ S
Sbjct: 146 SGTPGRVLDLIKRHVLVVKKCKMLVLDEADELLGESLGFKQQIYDIFTKLPKNCQVVVVS 205

Query: 303 ATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIP 362
           AT+   +++  K  +T PV + +  E    E ++  ++ V  ++ + + L  L + + I 
Sbjct: 206 ATMSKDIIEVTKKFMTTPVKILVKQEEISLEKIKQYYVDVDKEDWKFDTLCDLYDSLTI- 264

Query: 363 VATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHH 422
                                                              +IF +T+  
Sbjct: 265 ------------------------------------------------TQCVIFCNTKRK 276

Query: 423 VEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANV 482
           V++++  L    + V+ ++G + Q  R + + +FR G + +L+ TDV ARG+D+  ++ V
Sbjct: 277 VDWLAIKLTQSNFSVASMHGDMKQEERDKVMSDFRSGKSRVLISTDVWARGIDVQQVSLV 336

Query: 483 VNMSLPASSKIFVHRVGRTARAGNKGWA 510
           VN  LP   + ++HR+GR+ R G KG A
Sbjct: 337 VNYDLPDIMENYIHRIGRSGRFGRKGIA 364

>Smik_4.490 Chr4 complement(893394..895157) [1764 bp, 587 aa] {ON}
           YDR243C (REAL)
          Length = 587

 Score =  166 bits (421), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 115/396 (29%), Positives = 193/396 (48%), Gaps = 73/396 (18%)

Query: 140 FRQPTPIQRKTIPLIL---QQRDIVGMARTGSGKTAAFVLPLIEKL-----KMHSAKI-- 189
           F  PTPIQR TIP +    Q RD +G+A TGSGKT AF++P++ ++     +  S KI  
Sbjct: 193 FFSPTPIQRITIPNVCNAKQHRDFLGVASTGSGKTLAFIIPILIRMSRSPPRPSSLKIMD 252

Query: 190 GARAMILSPSRELAMQ----THKVFKEFAKGSN--LRSVLLTGGDGLEDQFSMMMSNPDV 243
           G +A+IL+P+REL  Q    T KV K +++ +N   R + + GG   E+    +    D+
Sbjct: 253 GPKALILAPTRELVQQIQAETEKVTKIWSRENNYDCRVISIVGGHSFEEISFSLSEGCDI 312

Query: 244 IIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSL------PTARQ 297
           ++ATPGR +       L +  +E +V DEAD++ ++GF++Q+  +L  +       T RQ
Sbjct: 313 LVATPGRLIDSLDNHLLVMKQVETLVLDEADKMIDLGFEDQVTNILTKVDVNVDSATNRQ 372

Query: 298 TLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQE 357
           TL+F+AT+   +   A   +  PV   +  +T                        L+++
Sbjct: 373 TLMFTATMTPVIEKIAAGYMRKPVYATIGLDTGSEP--------------------LIRQ 412

Query: 358 VIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFV 417
           V++     EE+ ++ +                                   SP   IIF+
Sbjct: 413 VVEYADNEEEKFKKLKSVVIKYE----------------------------SP--IIIFI 442

Query: 418 STRHHVEYVSNLLK-DCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDI 476
           + +   ++++   + +    V+ L+G+  Q  R   L  FR G   I++ T+VAARG+DI
Sbjct: 443 NYKQTADWLAERFQTETNMKVTILHGSKSQEQREHSLQLFRTGKVQIMIATNVAARGLDI 502

Query: 477 PLLANVVNMSLPASSKIFVHRVGRTARAGNKGWAYT 512
           P ++ VVN  +      +VHR+GRT RA  +G A++
Sbjct: 503 PNVSLVVNFQISKKIDDYVHRIGRTGRAQREGTAFS 538

>TDEL0B01670 Chr2 (297786..299525) [1740 bp, 579 aa] {ON} 
          Length = 579

 Score =  166 bits (420), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 115/398 (28%), Positives = 191/398 (47%), Gaps = 78/398 (19%)

Query: 140 FRQPTPIQRKTIPLILQQ--RDIVGMARTGSGKTAAFVLPLIEKLKMHSAKI-------- 189
           +++PTPIQR  IP I ++  RD +G+A TGSGKT AFV+P++  +KM S++         
Sbjct: 186 YKEPTPIQRIAIPNICKRGSRDFLGVASTGSGKTLAFVIPIL--IKMISSEPRPPALKSI 243

Query: 190 -GARAMILSPSRELAMQTHKVFKEFAKGSNL-------RSVLLTGGDGLEDQFSMMMSNP 241
            G +A+IL+P+RELA Q     ++  K  N+       R V + GG  LE+    +    
Sbjct: 244 EGPKALILAPTRELAQQIQAESEKITKLWNVKNPEYSCRVVSVVGGHSLEETTYNLQKGC 303

Query: 242 DVIIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTAR----- 296
           D+++ATPGR +       L +  +E +V DEADR+ ++GF+EQ+ ++   L +       
Sbjct: 304 DILVATPGRLIDSLESHILTIKQVETLVLDEADRMIDLGFEEQVTKIFNILESTSEQGKI 363

Query: 297 QTLLFSATLPSSLVDFAKAGLTNPVLVRLD-TETKVSENLEMLFLSVKNDEREANLLYLL 355
           Q L+F+AT+  S+   A   L  P    +   E  + +  ++++ S   + R   +  LL
Sbjct: 364 QKLMFTATMSGSIERIANGYLQKPSYATIGRGEGSIPQIQQLVYYSGSEERRFRRVKSLL 423

Query: 356 QEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTII 415
           ++                                                 MP     I+
Sbjct: 424 EQY------------------------------------------------MP---PIIV 432

Query: 416 FVSTRHHVEY-VSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGV 474
           FV+ +   ++ V    ++  + V+ L+G+  Q  R   L   R G   +++ T+VAARG+
Sbjct: 433 FVTYKKTADWLVQKFNQETSFRVTVLHGSKSQDQREHSLQLLRSGKAQVMIATNVAARGL 492

Query: 475 DIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWAYT 512
           DIP ++ VVN  +    + ++HR+GRT RAG KG A T
Sbjct: 493 DIPNVSLVVNFQISKQFEDYIHRIGRTGRAGMKGTAIT 530

>Ecym_4775 Chr4 (1507889..1509391) [1503 bp, 500 aa] {ON} similar to
           Ashbya gossypii AGR333C
          Length = 500

 Score =  164 bits (415), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 124/393 (31%), Positives = 192/393 (48%), Gaps = 66/393 (16%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHS 186
           LSK  L  I + GF   T +Q KTIP ++  RD++G A+TGSGKT AF++P IE L  HS
Sbjct: 43  LSKQTLKAIEKMGFTTMTQVQAKTIPPLMAGRDVLGAAKTGSGKTLAFLIPAIEML--HS 100

Query: 187 AKI----GARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPD 242
            K     G   ++++P+RELA+Q   V +E  +  +    ++ GG     +   +    +
Sbjct: 101 LKFKPRNGTGVIVITPTRELALQIFGVARELMEFHSQTFGIVIGGANRRQEAEKLSKGVN 160

Query: 243 VIIATPGRFL-HLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTA-RQTLL 300
           +IIATPGR L HL+        +++ ++ DEADR+ E+GF++++ +++  LP   RQ++L
Sbjct: 161 LIIATPGRLLDHLQNTKGFIFKNLKALIIDEADRILEIGFEDEMKQIIKILPNEDRQSML 220

Query: 301 FSATLPSSLVDFAKAGL-TNPVLVRLDTETKVS--ENLEMLFLSVKNDEREANLLYLLQ- 356
           FSAT  + + D A+  L   P+ + +D+E + S  + LE  ++  ++D+R   L   L+ 
Sbjct: 221 FSATQTTKVEDLARISLRPGPLFINVDSEKETSTVDGLEQGYVVCESDKRFLLLFTFLKK 280

Query: 357 -EVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTII 415
            +  KI V                                           + S NS   
Sbjct: 281 FQTKKIIVF------------------------------------------LSSCNS--- 295

Query: 416 FVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVD 475
               R++ E    LL      V  L+G   Q  R      F      ILV TDVAARG+D
Sbjct: 296 ---VRYYAE----LLNYIDLPVLELHGKQKQQKRTNTFFEFCNAQRGILVCTDVAARGLD 348

Query: 476 IPLLANVVNMSLPASSKIFVHRVGRTARAGNKG 508
           IP +  ++    P   + ++HRVGRTAR G KG
Sbjct: 349 IPAVDWIIQFDPPDDPRDYIHRVGRTAR-GTKG 380

>Smik_4.255 Chr4 (467483..468682) [1200 bp, 399 aa] {ON} YDR021W
           (REAL)
          Length = 399

 Score =  161 bits (408), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 103/383 (26%), Positives = 185/383 (48%), Gaps = 54/383 (14%)

Query: 131 ILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHSAKIG 190
           +L  I   GF  P+ IQ + I  I+  +D++  A++G+GKTA F + L++ + +    + 
Sbjct: 34  LLRGIYSYGFDAPSSIQSRAITQIISGKDVIAQAQSGTGKTATFTIGLLQAIDLRKRDL- 92

Query: 191 ARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSN-PDVIIATPG 249
            +A+ILSP+RELA Q  +V K      N+ +  +TGG  L+D    +  +   V+  TPG
Sbjct: 93  -QALILSPTRELASQIGQVVKNLGDYMNVNAFAMTGGKTLKDDLKKVQKHGCQVVSGTPG 151

Query: 250 RFLHLKVEMNLDLHSIEYVVFDEADRLFE--MGFQEQLNELLGSLPTARQTLLFSATLPS 307
           R L +     L   +++ +V DEAD L    +GF++Q+ ++   LP   Q ++ SAT+  
Sbjct: 152 RVLDMIKRQMLQTRNVQMLVLDEADELLSETLGFKQQIYDIFAKLPKNCQVVVVSATMNK 211

Query: 308 SLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVATEE 367
            +++  +  + +PV +                  VK DE        L+ + +  V  ++
Sbjct: 212 DILEVTRKFMNDPVKIL-----------------VKRDEIS------LEGIKQYVVNVDK 248

Query: 368 QLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYVS 427
           +  +F                            L    D  +    +IF +T+  V+++S
Sbjct: 249 EDWKF--------------------------DTLCDIYDSLTITQCVIFCNTKKKVDWLS 282

Query: 428 NLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSL 487
             L    + V  ++G + Q  R + ++ FR G + +L+ TDV ARG+D+  ++ V+N  L
Sbjct: 283 QRLSQSNFAVVSMHGDMKQEERDKVMNEFRTGHSRVLISTDVWARGIDVQQVSLVINYDL 342

Query: 488 PASSKIFVHRVGRTARAGNKGWA 510
           P   + ++HR+GR+ R G KG A
Sbjct: 343 PEIIENYIHRIGRSGRFGRKGVA 365

>KAFR0D01120 Chr4 complement(222704..224536) [1833 bp, 610 aa] {ON}
           Anc_8.87 YFL002C
          Length = 610

 Score =  166 bits (420), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 152/532 (28%), Positives = 224/532 (42%), Gaps = 81/532 (15%)

Query: 130 FILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKL---KMHS 186
           +I   I   G+ Q TP+Q  TIP+ +  +D+V  + TGSGKT AFV+P++EK+     H 
Sbjct: 17  WIKNAIEVMGYDQMTPVQASTIPMFVGNKDVVVDSVTGSGKTVAFVIPILEKIVKEATHL 76

Query: 187 AKIGARAMILSPSRELAMQTHKVFKEF------AKGSNLRSVLLTGGDG---LEDQFSMM 237
            K    ++I+SP+REL+ Q   V   F      ++   ++S LL G D     +D  S +
Sbjct: 77  KKGHFHSLIISPTRELSRQIQTVINSFLQHYPDSETKPIKSQLLVGTDTKTIRDDVASFL 136

Query: 238 MSNPDVIIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQ 297
              P +++ TPGR L      ++       VV DEADRL ++ F + + ++L  LP  R+
Sbjct: 137 EERPSILVGTPGRVLDFLQIASVKAQLCSMVVLDEADRLLDISFSKDIEKILSFLPKQRR 196

Query: 298 TLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQE 357
           T LFSAT+ S+  +  K GL NPV ++++++     +L + +  V   ++          
Sbjct: 197 TGLFSATITSAGSNIFKTGLRNPVKIKVNSKNNSPTSLSLNYCVVDTHDK---------- 246

Query: 358 VIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFV 417
              I +       RF+                                  P+  S   F 
Sbjct: 247 --LIHLLNLLNNYRFKKCIVY----------------------------FPTCISVTFFY 276

Query: 418 STRHHVEYVSN--LLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTN-ILVVTDVAARGV 474
               +++  +N  L  D       L+G L   +R + L  F   L N +L  TDVAARG+
Sbjct: 277 GFIQYLQKQNNSVLTIDESLQFYSLHGKLQTSSRIKTLEAFTEDLNNSVLFTTDVAARGI 336

Query: 475 DIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWAYTIXXXXXXXXXXXXXXXXGKKVL 534
           DIP +  V+ +  P  S IF+HR GRT RA   G A T                  K V 
Sbjct: 337 DIPDVDLVIQLDPPTDSDIFMHRCGRTGRANKIGKAITFINSGREEDFIPFMEV--KNVT 394

Query: 535 LTPMYEATCDLLKKKWISEGNEGALFQPPKISYVNRLILGSAPRLDLE-----AMGDLFK 589
           L PM E        K ISE      +   K     + IL    R DL      A    + 
Sbjct: 395 LEPMNEVL------KEISEETSNNFYDLFK-----KWILQDRARFDLSIKSYVAFIRHYS 443

Query: 590 NLVESN-FELQNLKAVSIKAEKLYLRTRQPASAESIKRAK-----EVIAAGW 635
           N   S+ F LQN     +   K+Y   R P   E  K  +     EV   GW
Sbjct: 444 NHTASSIFRLQNFSYTGL--AKMYGLIRIPRMPEVTKYLQKSDVLEVYDDGW 493

>Kpol_165.1 s165 complement(441..1766) [1326 bp, 441 aa] {ON}
           complement(441..1766) [1326 nt, 442 aa]
          Length = 441

 Score =  162 bits (411), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 102/349 (29%), Positives = 170/349 (48%), Gaps = 51/349 (14%)

Query: 130 FILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMH---S 186
           ++L  +  +GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I  +      S
Sbjct: 123 YVLEEVKAEGFEKPTGIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIVHINAQPLLS 182

Query: 187 AKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIA 246
              G   ++L+P+RELA+Q  K   +F   S +R+  + GG     Q   +    +++IA
Sbjct: 183 PGDGPIVLVLAPTRELAVQIQKECSKFGSSSRIRNSCVYGGVPRGQQIRELSRGAEIVIA 242

Query: 247 TPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSATLP 306
           TPGR + +      +L  + Y+V DEADR+ +MGF+ Q+ +++  +   RQTL++SAT P
Sbjct: 243 TPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWP 302

Query: 307 SSLVDFAKAGLTNPVLVRLDT-ETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVAT 365
             +   A   L +P+ V++ + E   S N+  L   V + E+   LL  L+       A+
Sbjct: 303 KEVKQLAHDYLNDPIQVQIGSLELSASHNITQLVEVVSDFEKRDRLLKHLE------TAS 356

Query: 366 EEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEY 425
           E++  +                                          ++F ST+   + 
Sbjct: 357 EDKDSKI-----------------------------------------LVFASTKRTCDE 375

Query: 426 VSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGV 474
           V+  L++ G+    ++G  DQ  R   L  FR G + I+V TDVAARG+
Sbjct: 376 VTKYLREDGWPALAIHGDKDQRERDWVLQEFREGRSPIMVATDVAARGI 424

>KLTH0C07964g Chr3 complement(679877..681073) [1197 bp, 398 aa] {ON}
           highly similar to uniprot|Q12099 Saccharomyces
           cerevisiae YDR021W FAL1 Nucleolar protein required for
           maturation of 18S rRNA member of the eIF4A subfamily of
           DEAD-box ATP-dependent RNA helicases
          Length = 398

 Score =  160 bits (406), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 95/382 (24%), Positives = 188/382 (49%), Gaps = 53/382 (13%)

Query: 131 ILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHSAKIG 190
           +L  +   GF  P+ IQ + I  I+  RD++  A++G+GKTA F + +++ +   S ++ 
Sbjct: 34  LLRGVYAYGFEAPSAIQSRAITQIISGRDVIAQAQSGTGKTATFTIGMLQVIDFKSREL- 92

Query: 191 ARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIATPGR 250
            ++++LSP+RELA Q  +V        N+ +   TGG  ++     +     V+  TPGR
Sbjct: 93  -QSLVLSPTRELAKQISQVVGNLGDYMNISAHACTGGKAMQTDTKKLTHGCHVVSGTPGR 151

Query: 251 FLHLKVEMNLDLHSIEYVVFDEADRLFE--MGFQEQLNELLGSLPTARQTLLFSATLPSS 308
            L +     L+   ++ ++ DEAD L    +GF++Q+ ++   LP + Q ++ SAT+   
Sbjct: 152 VLDMIKRRILNTRHLKMLILDEADELLSETLGFKQQIYDIFAKLPKSVQVVVVSATMSKD 211

Query: 309 LVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVATEEQ 368
           +++  K  +++PV + +  +    E ++   ++V  +E + + L  L + + I       
Sbjct: 212 ILEITKKFMSDPVKILVKRDEISLEGIKQYHVNVDREEWKFDTLCDLYDSLTI------- 264

Query: 369 LQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYVSN 428
                                                        +IF +T+  V+++S+
Sbjct: 265 ------------------------------------------TQCVIFCNTKKVVDWLSS 282

Query: 429 LLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSLP 488
            L    + V+ ++G + Q  R + +++FR G + +L+ TDV ARG+D+  ++ V+N  LP
Sbjct: 283 KLLQANFAVASMHGDMKQEDRDRVMNDFRSGTSRVLISTDVWARGIDVQQVSLVINYDLP 342

Query: 489 ASSKIFVHRVGRTARAGNKGWA 510
            + + ++HR+GR+ R G KG A
Sbjct: 343 DNLENYIHRIGRSGRFGRKGVA 364

>Smik_6.81 Chr6 complement(152467..154287) [1821 bp, 606 aa] {ON}
           YFL002C (REAL)
          Length = 606

 Score =  165 bits (418), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 125/389 (32%), Positives = 187/389 (48%), Gaps = 57/389 (14%)

Query: 139 GFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHSA------KIGAR 192
           GF   TP+Q  TIP++   +D+V  + TGSGKTAAFV+P++EK+    A      K    
Sbjct: 26  GFETMTPVQASTIPMLAGNKDVVVDSVTGSGKTAAFVIPILEKIVKEEANSSKFKKAQFH 85

Query: 193 AMILSPSRELAMQTHKVFKEFAKG--SNL---RSVLLTGGD--GLEDQFSMMMSN-PDVI 244
           ++I++P+REL+ Q   V   F +   S+L   R  LL G +   + D  S  + N P ++
Sbjct: 86  SLIVAPTRELSRQIESVVLSFLEHYPSDLFPIRCQLLIGTNEATVRDDVSDFLRNRPQIL 145

Query: 245 IATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSAT 304
           I TPGR L       +   +   VV DEADRL ++ F + +  +L  LP  R+T LFSAT
Sbjct: 146 IGTPGRVLDFLQMPAVKTSACSMVVLDEADRLLDVSFIKDIERILRLLPKQRRTGLFSAT 205

Query: 305 LPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVA 364
           + S+  D  K GL NPV + ++++ +   +L+M +  V   E+   L+ +L         
Sbjct: 206 MRSAGSDIFKTGLRNPVRITVNSKNQAPSSLKMNYCVVNPVEKLQLLVSILNN------- 258

Query: 365 TEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVE 424
                 +F+                             S    P+  S   F S   H+ 
Sbjct: 259 -----YKFKK----------------------------SIVYFPTCVSVSYFYSFVQHLA 285

Query: 425 YVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTN-ILVVTDVAARGVDIPLLANVV 483
               L+ +    V  L+G L   AR + L  F   L+N +L  TDVAARG+DIP +  V+
Sbjct: 286 KRKTLINEVE--VFSLHGKLQTSARTKTLAAFTNSLSNSVLFTTDVAARGIDIPQVDLVI 343

Query: 484 NMSLPASSKIFVHRVGRTARAGNKGWAYT 512
            +  P +S +F+HR GRT RA   G A T
Sbjct: 344 QLDPPTNSDMFMHRCGRTGRANRVGKAIT 372

>Kwal_26.8470 s26 complement(798445..799722) [1278 bp, 425 aa] {ON}
           YBR237W (PRP5) - RNA helicase homolog [contig 61] FULL
          Length = 425

 Score =  160 bits (405), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 103/354 (29%), Positives = 173/354 (48%), Gaps = 51/354 (14%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMH- 185
             +++L  +  +GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I  +    
Sbjct: 119 FPEYVLSEVKAEGFEKPTGIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIVHINAQP 178

Query: 186 --SAKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDV 243
             S   G   ++LSP+RELA+Q      +F K S +R+  + GG     Q   +    ++
Sbjct: 179 LLSPGDGPIVLVLSPTRELAVQIQTECSKFGKSSRIRNTCVYGGVPRGHQIRELSRGAEI 238

Query: 244 IIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSA 303
           +IATPGR + +      +L  + Y+V DEADR+ +MGF+ Q+ +++  +   RQTL++SA
Sbjct: 239 VIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSA 298

Query: 304 TLPSSLVDFAKAGLTNPVLVRLDT-ETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIP 362
           T P  +   A+  L +P+ V + + E   S N++ +   V   ++   LL  L+      
Sbjct: 299 TWPKEVQQLARDYLHDPIQVNVGSLELAASHNIKQVVEVVSEMDKRDRLLKHLE------ 352

Query: 363 VATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHH 422
            A+E+                                     KD    +  +IF ST+  
Sbjct: 353 TASED-------------------------------------KD----SKILIFASTKRT 371

Query: 423 VEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDI 476
            + V+ +L+  G+    ++G   Q+ R   L  FR G + I+V TDVAARG+ +
Sbjct: 372 CDEVTRVLRQDGWPALAIHGDKAQNERDWVLQEFRSGNSPIMVATDVAARGIGM 425

>SAKL0A06204g Chr1 complement(560276..562807) [2532 bp, 843 aa] {ON}
           similar to uniprot|P21372 Saccharomyces cerevisiae
           YBR237W PRP5 RNA helicase in the DEAD-box family
          Length = 843

 Score =  166 bits (421), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 86/227 (37%), Positives = 149/227 (65%), Gaps = 11/227 (4%)

Query: 140 FRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLK----MHSAKIGARAMI 195
           F  PTPIQ + IP I+  RD+VG+++TGSGKT +F+LPL+ ++K    +   + G   +I
Sbjct: 271 FVTPTPIQAQAIPAIMSGRDVVGISKTGSGKTVSFLLPLLRQIKAQRPLSKTETGPMGLI 330

Query: 196 LSPSRELAMQTHKVFKEFAKGS-NLRSVLLTGGDGLEDQFSMMMSNPDVIIATPGRFLHL 254
           L+P+RELA+Q ++   +F  GS ++RS+  TGG  L+ Q + +    +V++ATPGRF+ L
Sbjct: 331 LAPTRELAVQIYEEVVKFTTGSGSIRSICCTGGSELKQQINDLKKGVEVVVATPGRFIDL 390

Query: 255 KVEMN----LDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSATLPSSLV 310
            + +N    L    I +VV DEADRLF++GF+ Q+ +++ ++   +Q +LFSAT P+ L 
Sbjct: 391 -LTLNSGRLLSTERITFVVMDEADRLFDLGFEPQITQIMKAVRPDKQCVLFSATFPNKLK 449

Query: 311 DFAKAGLTNPVLVRLDTETKVSENLEM-LFLSVKNDEREANLLYLLQ 356
           +FA   L  P+ + +++++ ++EN+E  L +   ++E+ A +L +L+
Sbjct: 450 NFALKILQKPISITINSKSLINENIEQRLKIFQTDNEKFAAMLEVLE 496

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 56/101 (55%)

Query: 413 TIIFVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAAR 472
           TI+FVS++   + + N L + GY+   ++     + R   L  F+     IL+ T+V +R
Sbjct: 522 TIVFVSSQQICDLIYNRLLEHGYVTYAIHAGKPYNERASNLEKFKNTPNGILLCTEVLSR 581

Query: 473 GVDIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWAYTI 513
           G+++P ++ V+  +   +   +VH  GRTAR  NKG A T+
Sbjct: 582 GLNVPEVSLVIIYNAVKTFAQYVHTTGRTARGTNKGVALTM 622

>ZYRO0F04312g Chr6 complement(366863..368671) [1809 bp, 602 aa] {ON}
           highly similar to uniprot|P25808 Saccharomyces
           cerevisiae YFL002C SPB4 involved in the maturation of
           25S ribosomal RNA ATP-dependent RNA helicase
          Length = 602

 Score =  163 bits (413), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 116/399 (29%), Positives = 189/399 (47%), Gaps = 56/399 (14%)

Query: 130 FILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHSA-- 187
           +I   I   GF   TP+Q  TIP+  + +D+V  + TGSGKT AFV+P++EK+    A  
Sbjct: 17  WIKAAIDVMGFDTMTPVQTSTIPMFARNKDVVVESVTGSGKTVAFVIPILEKIIAEEANT 76

Query: 188 ----KIGARAMILSPSRELAMQTHKVFKEFAKG-----SNLRSVLLTGGD--GLEDQFSM 236
               K    ++I++P+REL+ Q   V + F +        +RS LL G +   + D  + 
Sbjct: 77  PNLKKGHFHSLIVTPTRELSNQIQSVIQSFLEHYPDDEHPIRSQLLVGTNQSSVRDDLAN 136

Query: 237 MMSN-PDVIIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTA 295
            + N P +++ TPGR L       +   S   +V DEADRL ++ F   + ++L +LP  
Sbjct: 137 FLQNRPQILVGTPGRVLDFLQMSAVQTKSCSVLVLDEADRLLDLSFFGDIEKILKTLPKQ 196

Query: 296 RQTLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLL 355
           R+T LFSAT+ S+     K GL NPV + + ++TK   +L + +  ++ + +   LL ++
Sbjct: 197 RRTGLFSATIGSAGSQIFKTGLRNPVKITVSSKTKAPTSLGLFYTVIEPEAKIQQLLSIM 256

Query: 356 QEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTII 415
                          +F+                                  P+  S   
Sbjct: 257 NNY------------KFKKCIVY----------------------------FPTCISVTY 276

Query: 416 FVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTN-ILVVTDVAARGV 474
           F S   +++    LL +     S L+G L   +R++ L +F       +L  TDVAARG+
Sbjct: 277 FYSFMQYLQRDKKLLDEEVEFFS-LHGKLQTSSRQKTLDSFGKSFGKAVLFTTDVAARGI 335

Query: 475 DIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWAYTI 513
           DIP +  V+ +  P+ + +F+HR GRT RA  +G A T 
Sbjct: 336 DIPDVDLVIQLDPPSDTTMFLHRCGRTGRANKEGRAITF 374

>TPHA0B02930 Chr2 (666924..668207) [1284 bp, 427 aa] {ON} Anc_6.148
           YBR237W
          Length = 427

 Score =  160 bits (404), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 101/349 (28%), Positives = 170/349 (48%), Gaps = 51/349 (14%)

Query: 130 FILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMH---S 186
           ++L  +  +GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I  +      S
Sbjct: 124 YVLEEVKAEGFDKPTAIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIVHINAQPLLS 183

Query: 187 AKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIA 246
              G   ++LSP+RELA+Q  K   +F + S +R+  + GG     Q   ++   +++IA
Sbjct: 184 PGDGPIVLVLSPTRELAVQIQKECSKFGQSSRIRNTCVYGGVPRGQQIRDLIRGAEIVIA 243

Query: 247 TPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSATLP 306
           TPGR + +      +L  + Y+V DEADR+ +MGF+ Q+ +++  +   RQTL++SAT P
Sbjct: 244 TPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWP 303

Query: 307 SSLVDFAKAGLTNPVLVRLDT-ETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVAT 365
             +   A+  L +P+ V++ + E   S  +  L   V + E+   L   L        A+
Sbjct: 304 KEVQQLARDYLNDPIQVQIGSLELSASHTITQLVEVVSDFEKRDRLNKHLV------TAS 357

Query: 366 EEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEY 425
           E++  +                                          +IF ST+   + 
Sbjct: 358 EDKESKI-----------------------------------------LIFASTKRTCDE 376

Query: 426 VSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGV 474
           ++  L++ G+    ++G  DQ  R   L  FR G + I+V TDVAARG+
Sbjct: 377 ITKYLREDGWPALAIHGDKDQRERDWVLQEFRDGRSPIMVATDVAARGI 425

>KAFR0D04630 Chr4 complement(909161..910624) [1464 bp, 487 aa] {ON}
           Anc_5.337 YHR065C
          Length = 487

 Score =  161 bits (407), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 90/220 (40%), Positives = 127/220 (57%), Gaps = 4/220 (1%)

Query: 140 FRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHSAKIGARAMILSPS 199
           + +PTPIQ K+IP  L  +DI+G+A+TGSGKTAAF +P++  L  H  ++   A ILSP+
Sbjct: 87  YEKPTPIQSKSIPPALNGKDIIGLAQTGSGKTAAFAIPILNSL-WHD-QLPYYACILSPT 144

Query: 200 RELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIATPGRFL-HLKVEM 258
           RELA Q  + F        +R+V + GG  + DQ   +M  P +IIATPGR + HL+   
Sbjct: 145 RELAQQIKETFDSLGSLMGVRTVCIVGGMNMMDQARDLMRKPHIIIATPGRLMDHLENTR 204

Query: 259 NLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPT-ARQTLLFSATLPSSLVDFAKAGL 317
              L  + Y+V DEADRL +M F   L+ +L  LPT  R T LFSAT+ S +    +A L
Sbjct: 205 GFSLRKLRYLVMDEADRLLDMEFGPVLDRILKILPTEGRTTYLFSATMTSKIDKLQRASL 264

Query: 318 TNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQE 357
           TNPV   +  + +  + L    + V    +   L+YLL E
Sbjct: 265 TNPVKCAVSNKYQTVDTLVQTLMVVPGGLKNTFLIYLLNE 304

 Score = 87.8 bits (216), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 63/100 (63%)

Query: 414 IIFVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARG 473
           IIF  T+ + E ++ L     +  + L+G L+Q+ R   L  F+ G  +ILV TDVAARG
Sbjct: 311 IIFTRTKANAERIAGLANLLEFNATALHGDLNQNQRTGALDLFKAGKRSILVATDVAARG 370

Query: 474 VDIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWAYTI 513
           +DIP +  V+N  +P  SK ++HRVGRTARAG  G + ++
Sbjct: 371 LDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISL 410

>YOR046C Chr15 complement(414459..415907) [1449 bp, 482 aa] {ON}
           DBP5Cytoplasmic ATP-dependent RNA helicase of the
           DEAD-box family; involved in mRNA export from the
           nucleus; involved in translation termination; ATP/ADP
           cycling is regulated by Gle1p and Nup159p
          Length = 482

 Score =  159 bits (403), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 116/395 (29%), Positives = 188/395 (47%), Gaps = 64/395 (16%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQ--RDIVGMARTGSGKTAAFVLPLIEKLKM 184
           L+  +L  I    F++P+ IQ + +PL+L    R+++  +++G+GKTAAF L ++ ++  
Sbjct: 99  LAPELLKGIYAMKFQKPSKIQERALPLLLHNPPRNMIAQSQSGTGKTAAFSLTMLTRVNP 158

Query: 185 HSAKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVI 244
             A    +A+ L+PSRELA QT +V +E  K + + S L+   D  E    +   N  VI
Sbjct: 159 EDA--SPQAICLAPSRELARQTLEVVQEMGKFTKITSQLIV-PDSFEKNKQI---NAQVI 212

Query: 245 IATPGRFLHLKVEMNLDLHSIEYVVFDEADRLF-EMGFQEQLNELLGSLPTARQTLLFSA 303
           + TPG  L L     + L  I+  V DEAD +  + G  +Q   +   LP   Q +LFSA
Sbjct: 213 VGTPGTVLDLMRRKLMQLQKIKIFVLDEADNMLDQQGLGDQCIRVKRFLPKDTQLVLFSA 272

Query: 304 TLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPV 363
           T   ++  +AK  + N   + L T     + ++ L++  KN+  + ++L  L  ++ I  
Sbjct: 273 TFADAVRQYAKKIVPNANTLELQTNEVNVDAIKQLYMDCKNEADKFDVLTELYGLMTI-- 330

Query: 364 ATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHV 423
                                                           S+IIFV+T+   
Sbjct: 331 -----------------------------------------------GSSIIFVATKKTA 343

Query: 424 EYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVV 483
             +   LK  G+ VS L+G L    R + + +FR G + +L+ T+V ARG+DIP ++ VV
Sbjct: 344 NVLYGKLKSEGHEVSILHGDLQTQERDRLIDDFREGRSKVLITTNVLARGIDIPTVSMVV 403

Query: 484 NMSLP------ASSKIFVHRVGRTARAGNKGWAYT 512
           N  LP      A    ++HR+GRT R G KG A +
Sbjct: 404 NYDLPTLANGQADPATYIHRIGRTGRFGRKGVAIS 438

>Smik_15.224 Chr15 complement(380539..381972) [1434 bp, 477 aa] {ON}
           YOR046C (REAL)
          Length = 477

 Score =  159 bits (401), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 115/395 (29%), Positives = 189/395 (47%), Gaps = 64/395 (16%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQ--RDIVGMARTGSGKTAAFVLPLIEKLKM 184
           L+  +L  I    F++P+ IQ + +PL+L    R+++  +++G+GKTAAF L ++ ++  
Sbjct: 94  LAPELLKGIYAMKFQKPSKIQERALPLLLHNPPRNMIAQSQSGTGKTAAFSLTMLTRVNP 153

Query: 185 HSAKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVI 244
             A    +A+ L+PSRELA QT +V +E  K + + S L+   D  E    +   N  +I
Sbjct: 154 EDA--SPQAICLAPSRELARQTLEVVQEMGKFTKITSQLIV-PDSFEKNKQI---NSQII 207

Query: 245 IATPGRFLHLKVEMNLDLHSIEYVVFDEADRLF-EMGFQEQLNELLGSLPTARQTLLFSA 303
           + TPG  L L     + L  I+  V DEAD +  + G  +Q   +   LP   Q +LFSA
Sbjct: 208 VGTPGTVLDLMRRKLMQLQKIKIFVLDEADNMLDQQGLGDQCIRVKRFLPKDTQLVLFSA 267

Query: 304 TLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPV 363
           T   ++  +AK  + N   + L T     + ++ L++  KN+  + ++L  L  ++ I  
Sbjct: 268 TFADAVRQYAKKIVPNANTLELQTNEVNVDAIKQLYMDCKNEADKFDVLTELYGLMTI-- 325

Query: 364 ATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHV 423
                                                           S+IIFV+T+   
Sbjct: 326 -----------------------------------------------GSSIIFVATKKTA 338

Query: 424 EYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVV 483
             +   LK+ G+ VS L+G L    R + + +FR G + +L+ T+V ARG+DIP ++ VV
Sbjct: 339 NVLYGKLKNEGHEVSILHGDLQTQERDRLIDDFREGRSKVLITTNVLARGIDIPTVSMVV 398

Query: 484 NMSLP------ASSKIFVHRVGRTARAGNKGWAYT 512
           N  LP      A    ++HR+GRT R G KG A +
Sbjct: 399 NYDLPTLANGKADPATYIHRIGRTGRFGRKGVAIS 433

>KNAG0A04130 Chr1 (559075..560904) [1830 bp, 609 aa] {ON} Anc_8.469
           YDR243C
          Length = 609

 Score =  161 bits (408), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 111/395 (28%), Positives = 196/395 (49%), Gaps = 72/395 (18%)

Query: 140 FRQPTPIQRKTIPLILQQ--RDIVGMARTGSGKTAAFVLPLIEKL----KMHSAKI--GA 191
           F +P+PIQR  IP I+ Q  +D++G++ TGSGKT AF +P++ K+    +  S K+  G 
Sbjct: 216 FVEPSPIQRIAIPNIVHQPYKDLIGVSSTGSGKTVAFAVPILIKMNGLIRPRSLKLMEGP 275

Query: 192 RAMILSPSRELAMQTHKVFK-----EFAKGSNLRSVL-LTGGDGLEDQFSMMMSNPDVII 245
           +A+IL+P+REL  Q     K     ++    N  +V+ + GG  LE+  + + +  D+++
Sbjct: 276 KALILAPTRELVQQIESQIKNVTTRDWTDDPNECTVVSIVGGHSLEELTNSLRNGCDILV 335

Query: 246 ATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTAR------QTL 299
           ATPGR +       L + +I+ +V DEAD++ ++GF++QL   L  +          QTL
Sbjct: 336 ATPGRLIDCLENHILTISNIDTLVLDEADKMIDLGFEDQLKLTLSKVNVETKHRAGFQTL 395

Query: 300 LFSATLPSSLVDFAKAGLTNPVLVRLDT-ETKVSENLEMLFLSVKNDEREANLLYLLQEV 358
           +F+ATL  ++   + + L +P+ + +D+ E    +  +++  S   D+R   L   +   
Sbjct: 396 MFTATLSPAIELISHSYLQSPIHILVDSGEGSQPQVKQIVRYSPNTDQRFVELKAKVLPQ 455

Query: 359 IKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVS 418
            K P+                                                  IIF++
Sbjct: 456 FKAPI--------------------------------------------------IIFIN 465

Query: 419 TRHHVEYVSN-LLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIP 477
            ++  ++++    ++  Y V+ L+G+  Q  R   L   R G   I++ T++AARG+DIP
Sbjct: 466 YKNTADWLAQKFQQETAYKVTILHGSKSQEQREHSLQLLRTGKAQIMIATNIAARGLDIP 525

Query: 478 LLANVVNMSLPASSKIFVHRVGRTARAGNKGWAYT 512
            ++ V+N  +  +   +VHR+GRT RAGN G A T
Sbjct: 526 NVSLVINFQMSKNFDDYVHRIGRTGRAGNSGTAIT 560

>Skud_6.72 Chr6 complement(140844..142664) [1821 bp, 606 aa] {ON}
           YFL002C (REAL)
          Length = 606

 Score =  160 bits (406), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 123/389 (31%), Positives = 188/389 (48%), Gaps = 57/389 (14%)

Query: 139 GFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHSA------KIGAR 192
           GF   TP+Q  TIP++   +D+V  + TGSGKTAAFV+P++EK+    A      K    
Sbjct: 26  GFETMTPVQASTIPMLAGNKDVVVDSVTGSGKTAAFVIPILEKIVKEEANTFKFKKAHFH 85

Query: 193 AMILSPSRELAMQTHKVFKEFAKG--SNLRSV---LLTGGD--GLEDQFSMMMSN-PDVI 244
           ++I++P+REL+ Q   V   F +   S+L  V   LL G +   + D  S+ + N P ++
Sbjct: 86  SLIIAPTRELSRQIETVVLSFLEHYPSDLFPVKCQLLVGTNEGSVRDDVSIFLENRPQIL 145

Query: 245 IATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSAT 304
           + TPGR L       +   +   V+ DEADRL +M F + +  +L  LP  R+T LFSAT
Sbjct: 146 VGTPGRVLDFLQMPAVKTSACSMVILDEADRLLDMSFIKDIERILRLLPKQRRTGLFSAT 205

Query: 305 LPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVA 364
           + S+  D  K GL NPV + ++++ +   +L++ +  V       N L  LQ ++ I   
Sbjct: 206 MRSAGSDIFKTGLRNPVRITVNSKHQAPSSLKLDYCVV-------NPLEKLQLLVSI--- 255

Query: 365 TEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVE 424
               L  ++                                  P+  S   F S    + 
Sbjct: 256 ----LNNYKFKKCIVY--------------------------FPTCVSVSYFYSFIQRLS 285

Query: 425 YVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTN-ILVVTDVAARGVDIPLLANVV 483
             + L+ +    V  L+G L   AR + L +F   L N +L  TDVAARG+DIP +  V+
Sbjct: 286 KKNILISELE--VFSLHGKLQTSARTKTLASFTESLNNSVLFTTDVAARGIDIPEVDLVI 343

Query: 484 NMSLPASSKIFVHRVGRTARAGNKGWAYT 512
            +  P +S +F+HR GRT RA   G A T
Sbjct: 344 QLDPPTNSDMFMHRCGRTGRANRIGKAIT 372

>Suva_8.98 Chr8 complement(177272..178720) [1449 bp, 482 aa] {ON}
           YOR046C (REAL)
          Length = 482

 Score =  158 bits (399), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 116/395 (29%), Positives = 188/395 (47%), Gaps = 64/395 (16%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQ--RDIVGMARTGSGKTAAFVLPLIEKLKM 184
           L+  +L  I    F++P+ IQ + +PL+L    R+++  +++G+GKTAAF L ++ ++  
Sbjct: 99  LAPELLKGIYAMKFQKPSKIQERALPLLLHNPARNMIAQSQSGTGKTAAFSLTMLTRVNP 158

Query: 185 HSAKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVI 244
             A    +A+ L+PSRELA QT +V +E  K + + S L+   D  E    +   N  VI
Sbjct: 159 EDA--SPQAICLAPSRELARQTLEVVQEMGKFTKITSQLIV-PDSFEKNKQI---NAQVI 212

Query: 245 IATPGRFLHLKVEMNLDLHSIEYVVFDEADRLF-EMGFQEQLNELLGSLPTARQTLLFSA 303
           + TPG  L L     + L  I+  V DEAD +  + G  +Q   +   LP   Q +LFSA
Sbjct: 213 VGTPGTVLDLMRRKLMQLQKIKIFVLDEADNMLDQQGLGDQCIRVKRFLPKDTQLVLFSA 272

Query: 304 TLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPV 363
           T   ++  +AK  + N   + L T     + ++ L++  KN+  +  +L  L  ++ I  
Sbjct: 273 TFADAVRQYAKKIVPNANTLELQTNEVNVDAIKQLYMDCKNEADKFEVLTELYGLMTI-- 330

Query: 364 ATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHV 423
                                                           S+IIFV+T+   
Sbjct: 331 -----------------------------------------------GSSIIFVATKKTA 343

Query: 424 EYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVV 483
             +   LK+ G+ VS L+G L    R + + +FR G + +L+ T+V ARG+DIP ++ VV
Sbjct: 344 NVLYGKLKNEGHEVSILHGDLQTQERDRLIDDFREGRSKVLITTNVLARGIDIPTVSMVV 403

Query: 484 NMSLP------ASSKIFVHRVGRTARAGNKGWAYT 512
           N  LP      A    ++HR+GRT R G KG A +
Sbjct: 404 NYDLPTLANGQADPATYIHRIGRTGRFGRKGVAIS 438

>AER408W Chr5 (1418694..1419890) [1197 bp, 398 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR021W (FAL1)
          Length = 398

 Score =  155 bits (393), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 100/386 (25%), Positives = 192/386 (49%), Gaps = 53/386 (13%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHS 186
           L + +L  I   GF  P+ IQ + I  I++ +D++  A++G+GKTA F + +++ +   S
Sbjct: 30  LQENLLRGIYGYGFEAPSAIQSRAITQIIRGKDVIAQAQSGTGKTATFTIGMLQVIDSSS 89

Query: 187 AKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIA 246
             +  +A++LSP+RELA Q  +V +      N+ ++  TGG  L+   S +     V+  
Sbjct: 90  KDL--QALVLSPTRELAAQISQVVRNLGDYMNVVALACTGGKALQQDISKVNKGCHVMSG 147

Query: 247 TPGRFLHLKVEMNLDLHSIEYVVFDEADRLFE--MGFQEQLNELLGSLPTARQTLLFSAT 304
           TPGR L +     ++   ++ +V DEAD L    +GF++QL ++   LP++ Q ++ SAT
Sbjct: 148 TPGRVLDMIKRRIINTRHVKMLVLDEADELLSETLGFKQQLYDIFTKLPSSVQVVVVSAT 207

Query: 305 LPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVA 364
           +   +++  K  +++PV + +  +    E ++   ++V  +E + + L  L + + I   
Sbjct: 208 MSKVVLEVTKKFMSDPVKILVKRDEVSLEGIKQYHINVDKEEWKFDTLCDLYDSLTI--- 264

Query: 365 TEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVE 424
                                                            +IF +T+  V+
Sbjct: 265 ----------------------------------------------TQCVIFCNTKKKVD 278

Query: 425 YVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVN 484
           ++S+ L    + V+ ++G + Q  R + + +FR G + +L+ TDV ARG+D+  ++ V+N
Sbjct: 279 WLSHKLIQNNFAVASIHGDMKQDDRDKVMSDFRSGSSRVLISTDVWARGIDVQQVSLVIN 338

Query: 485 MSLPASSKIFVHRVGRTARAGNKGWA 510
             LP   + ++HR+GR+ R G KG A
Sbjct: 339 YDLPELLENYIHRIGRSGRFGRKGVA 364

>Suva_6.59 Chr6 complement(110278..112098) [1821 bp, 606 aa] {ON}
           YFL002C (REAL)
          Length = 606

 Score =  160 bits (404), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 123/392 (31%), Positives = 189/392 (48%), Gaps = 61/392 (15%)

Query: 139 GFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHSA------KIGAR 192
           GF   TP+Q  TIP++   +D+V  + TGSGKTAAFV+P++EK+    A      K    
Sbjct: 26  GFESMTPVQASTIPMLAGNKDVVVDSVTGSGKTAAFVIPILEKIVQEEANSPKFKKAHFH 85

Query: 193 AMILSPSRELAMQTHKVFKEF-----AKGSNLRSVLLTGGDGL---EDQFSMMMSNPDVI 244
           ++I++P+REL+ Q   V   F     +   +++  LL G +     +D  S + + P ++
Sbjct: 86  SLIIAPTRELSRQIESVVLSFLEHYPSDSFSIKCQLLIGTNEATVRDDVSSFLQNRPQIL 145

Query: 245 IATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSAT 304
           I TPGR L       +   +   V+ DEADRL ++ F +   ++L  LP  R+T LFSAT
Sbjct: 146 IGTPGRVLDFLQMPAVKSSACSMVILDEADRLLDVSFIKDTEKILRLLPKQRRTGLFSAT 205

Query: 305 LPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVA 364
           + S+  D  K GL NPV + ++++ +   +L++ +  V       N L  LQ ++ I   
Sbjct: 206 MRSAGSDIFKTGLRNPVRITVNSKHQAPSSLKLNYCVV-------NPLEKLQLLVSI--- 255

Query: 365 TEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVE 424
               L  ++                                  P+  S   F S    V+
Sbjct: 256 ----LNNYKFKKCIVY--------------------------FPTCVSVSYFYS---FVQ 282

Query: 425 YVS--NLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTN-ILVVTDVAARGVDIPLLAN 481
           Y+S  N+L     + S L+G L   AR + L  F   L N +L  TDVAARG+DIP +  
Sbjct: 283 YLSKKNILTSELEVFS-LHGKLQTSARMKTLAAFTDSLNNAVLFTTDVAARGIDIPEVDL 341

Query: 482 VVNMSLPASSKIFVHRVGRTARAGNKGWAYTI 513
           V+ +  P +S +F+HR GRT RA   G A T 
Sbjct: 342 VIQLDPPTNSDMFMHRCGRTGRANRVGKAITF 373

>KNAG0L00410 Chr12 complement(57484..59325) [1842 bp, 613 aa] {ON}
           Anc_8.87 YFL002C
          Length = 613

 Score =  159 bits (403), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 126/403 (31%), Positives = 191/403 (47%), Gaps = 58/403 (14%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHS 186
           L  ++   I   GF + TP+Q  TIPL    +D+V  A TGSGKT AFV+P++EK+    
Sbjct: 15  LQPWVRSAIETLGFDKMTPVQASTIPLFAGNKDVVVDAETGSGKTVAFVVPILEKIVQEQ 74

Query: 187 A---KIGA-RAMILSPSRELAMQTHKVFKEF----AKGSN--LRSVLLTGGD--GLEDQF 234
           A   K G   ++IL+P+RELA Q   V + F     +G+   +   LL G +   + D  
Sbjct: 75  AFRLKRGHFHSLILTPTRELAKQIETVVQSFLVHYTEGTQQPIGCQLLVGTNEHSIRDDV 134

Query: 235 SMMMSN-PDVIIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLP 293
           + +  N P ++I TPGR L L     +   S   VV DEADRL +  F   + ++L  LP
Sbjct: 135 NALCENRPQLLIGTPGRVLDLLQSPKVKTQSCSLVVLDEADRLLDASFVGDIEKILKVLP 194

Query: 294 TARQTLLFSATLPSSLVDFAKAGLTNPVLVRLDTE--TKVSENLEMLFLSVKNDEREANL 351
             R+T LFSAT+ ++     K GL NPV ++++    +   E+L + + +VK   +    
Sbjct: 195 KQRRTGLFSATISAAGDTIFKTGLRNPVKIKVNGRAISAAPESLSINYCTVKPQLK---- 250

Query: 352 LYLLQEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPN 411
              LQ +I +       + RF+                                  P+  
Sbjct: 251 ---LQLLISL-------INRFKFKKCIVY--------------------------FPTCI 274

Query: 412 STIIFVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGL-TNILVVTDVA 470
           S   F S  +H+    ++ +D       L+G L   +R + L  F   L + +L+ TDVA
Sbjct: 275 SVTFFYSFMNHLLSRGDITQDVKLF--SLHGKLQTSSRIKTLDAFASHLGSAVLLTTDVA 332

Query: 471 ARGVDIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWAYTI 513
           ARG+DIP +  VV +  P  + +F+HR GRT RA   G A T 
Sbjct: 333 ARGIDIPDVELVVQLDPPTDTDLFLHRCGRTGRANRIGKAVTF 375

>Skud_15.210 Chr15 complement(374410..375858) [1449 bp, 482 aa] {ON}
           YOR046C (REAL)
          Length = 482

 Score =  157 bits (397), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 116/395 (29%), Positives = 187/395 (47%), Gaps = 64/395 (16%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQ--RDIVGMARTGSGKTAAFVLPLIEKLKM 184
           L+  +L  I    F++P+ IQ + +PL+L    R+++  +++G+GKTAAF L ++ ++  
Sbjct: 99  LAPELLKGIYAMKFQKPSKIQERALPLLLHNPPRNMIAQSQSGTGKTAAFSLTMLTRVNP 158

Query: 185 HSAKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVI 244
             A    +A+ L+PSRELA QT  V +E  K + + S L+   D  E    +   N  VI
Sbjct: 159 EDA--SPQAICLAPSRELARQTLDVIQEMGKFTEITSQLIV-PDSFEKNKQI---NAQVI 212

Query: 245 IATPGRFLHLKVEMNLDLHSIEYVVFDEADRLF-EMGFQEQLNELLGSLPTARQTLLFSA 303
           + TPG  L L     + L  I+  V DEAD +  + G  +Q   +   LP   Q +LFSA
Sbjct: 213 VGTPGTVLDLMRRKLVQLQKIKIFVLDEADNMLDQQGLGDQCIRVKRFLPKDAQLVLFSA 272

Query: 304 TLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPV 363
           T   ++  +AK  + N   + L T     + ++ L++  KN+  +  +L  L  ++ I  
Sbjct: 273 TFAEAVRQYAKKIVPNANTLELQTNEVNVDAIKQLYMDCKNEADKFEVLTELYGLMTI-- 330

Query: 364 ATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHV 423
                                                           S+IIFV+T+   
Sbjct: 331 -----------------------------------------------GSSIIFVATKKTA 343

Query: 424 EYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVV 483
             +   LK+ G+ VS L+G L    R + + +FR G + +L+ T+V ARG+DIP ++ VV
Sbjct: 344 NVLYGKLKNEGHEVSILHGDLQTQERDRLIDDFREGRSKVLITTNVLARGIDIPTVSMVV 403

Query: 484 NMSLP------ASSKIFVHRVGRTARAGNKGWAYT 512
           N  LP      A    ++HR+GRT R G KG A +
Sbjct: 404 NYDLPTLANGQADPATYIHRIGRTGRFGRKGVAIS 438

>Kpol_1007.10 s1007 complement(17289..19106) [1818 bp, 605 aa] {ON}
           complement(17289..19106) [1818 nt, 606 aa]
          Length = 605

 Score =  159 bits (403), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 110/397 (27%), Positives = 189/397 (47%), Gaps = 74/397 (18%)

Query: 140 FRQPTPIQRKTIPLILQQ------RDIVGMARTGSGKTAAFVLPLIEKL-----KMHSAK 188
           F  P+PIQR +IP I Q+      RD++G+A TGSGKT AFV+P++ KL     +  S K
Sbjct: 203 FISPSPIQRISIPNICQKNGHSTNRDLMGIASTGSGKTLAFVIPILIKLLGTAIRPLSLK 262

Query: 189 I--GARAMILSPSRELAMQTHKVFKEFAKGSN-----LRSVLLTGGDGLEDQFSMMMSNP 241
           +  G +A+IL+P+RELA Q     K+    S+     + S+ + GG  +E+    +    
Sbjct: 263 VIEGPKALILAPTRELAQQIQAEIKKILSLSSNELTKITSICIVGGHSIEEISYDLSKGC 322

Query: 242 DVIIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTAR----- 296
           D+++ATPGR +       + + ++  +V DEAD++ + GF++Q+  +L  L         
Sbjct: 323 DILVATPGRLIDCLESHLIVIDNVNTIVLDEADKMIDFGFEDQVTTILSKLQINEMKDNL 382

Query: 297 QTLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQ 356
           Q ++F+AT+  ++   A   L N   V +    +   ++  L     N+  +   L  + 
Sbjct: 383 QKIMFTATMTPTIERIANGYLRNASYVSIGNSEEFVPHINQLVYYSPNENSKFRKLKQVL 442

Query: 357 EVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIF 416
           E+   PV                                                  IIF
Sbjct: 443 ELYPPPV--------------------------------------------------IIF 452

Query: 417 VSTRHHVEYVSNLLK-DCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVD 475
           ++ +   ++++  L+ +  + V+ L+G+  Q  R   L+  R G   I++ T+VAARG+D
Sbjct: 453 INYKKTADWLATKLQEETNFKVTTLHGSKSQDQREYSLNLLRTGRVQIMIATNVAARGID 512

Query: 476 IPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWAYT 512
           IP +  VVN  +  S + ++HR+GRT RAG +G A +
Sbjct: 513 IPNVGLVVNYQISDSFEDYIHRIGRTGRAGKEGTAIS 549

>ZYRO0B05852g Chr2 (468295..470550) [2256 bp, 751 aa] {ON} similar
           to uniprot|P38112 Saccharomyces cerevisiae YBR142W MAK5
           Essential nucleolar protein putative DEAD-box RNA
           helicase required for maintenance of M1 dsRNA virus
           involved in biogenesis of large (60S) ribosomal subunits
          Length = 751

 Score =  161 bits (407), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 128/423 (30%), Positives = 204/423 (48%), Gaps = 73/423 (17%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKM-- 184
           LS  +L  +S++GF +PT IQ++ +PL L+  DI+G A TGSGKT A+ +PL+E L    
Sbjct: 192 LSFTVLNGLSQQGFTKPTDIQKEVLPLALKNEDIMGKAATGSGKTLAYGIPLLESLVHEP 251

Query: 185 -HSAKIGARAMILSPSRELAMQTHKVFKEFA----KGSNLRSVLLTGGDGLEDQFSMMM- 238
            HS  IG   +I +P+RELA Q  +  K+      + S    + LTGG  ++ Q  ++  
Sbjct: 252 DHSKSIG---LIFTPTRELAQQVTQHLKKLGQLIIQKSKFAILPLTGGLSIQKQERILKY 308

Query: 239 -SNPDVIIATPGRFLHLKVEMNLDL----HSIEYVVFDEADRLFEMGFQEQLNELLGSLP 293
            ++  +++ATPGRFL L +E N+DL      I  +V DEADRL + G  ++  ++L  L 
Sbjct: 309 ENSARIVVATPGRFLEL-IEKNIDLIPRFARINTLVLDEADRLLQDGHFDEFEKILKLLG 367

Query: 294 TAR--------QTLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKND 345
            AR        QT++FSAT   SL  F+K    +                   + S+K D
Sbjct: 368 GARKSFDKTGWQTMIFSATFSLSL--FSKLATAS-------------------WKSLKKD 406

Query: 346 EREANLLYLLQEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAK 405
           E E      +++V+K        +Q+ R                         +  P  +
Sbjct: 407 EDE------MEQVLK------HLMQKIRFKSKPVIVDTNSEEKIKSQIRESLIECGPMER 454

Query: 406 DMPS-------PNSTIIFVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQL----- 453
           D+ S       P +T+IF ++   V+ +     +       ++ ++ Q  R + L     
Sbjct: 455 DLYSYYFLAMYPGTTLIFCNSIDSVKKLCAYFNNLKIDAFQIHSSMTQKNRLRSLERYLQ 514

Query: 454 ---HNFRCGLTNILVVTDVAARGVDIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWA 510
               N       +LV +DVAARG+DIP + +VV+  LP ++  ++HR GRTARA N+G +
Sbjct: 515 KSAQNDSQNKATVLVASDVAARGLDIPGIKHVVHYHLPRTADTYIHRSGRTARADNEGVS 574

Query: 511 YTI 513
             I
Sbjct: 575 VMI 577

>Kwal_23.5125 s23 complement(1024642..1026438) [1797 bp, 598 aa]
           {ON} YFL002C (SPB4) - ATP-dependent RNA helicase [contig
           7] FULL
          Length = 598

 Score =  159 bits (401), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 119/406 (29%), Positives = 189/406 (46%), Gaps = 73/406 (17%)

Query: 130 FILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMH---- 185
           +I   I   G+   TP+Q  TIPL    +D+V  + TGSGKT AFV+P++EK+       
Sbjct: 17  WIRTAIDAMGYETMTPVQASTIPLFSGNKDVVVESVTGSGKTVAFVIPVLEKVMKDIING 76

Query: 186 -SAKIGA-RAMILSPSRELAMQTHKVFKEF-----AKGSNLRSVLLTG--GDGLEDQFSM 236
            S K G   ++I+SP+REL+ Q   VF  F     +    ++S LL G     + D  + 
Sbjct: 77  VSLKKGHFHSLIISPTRELSKQIQSVFDSFLEFYPSTPCPIKSQLLVGTSASSVRDDVNA 136

Query: 237 MMSN-PDVIIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTA 295
              N P +++ TPGR         +   S   V+ DEADRL ++ F++++  +L  LP  
Sbjct: 137 FTENKPQILVGTPGRTFEFLKSTAVKSTSCSVVILDEADRLLDVSFEKEVESILNLLPKQ 196

Query: 296 RQTLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLL 355
           R+T LFSAT+ S+     + G+ NPV + +  + +  E+L++ +L VK +++   LL +L
Sbjct: 197 RRTGLFSATISSAGDQIFRTGMRNPVKIAVRAKGQNPESLKINYLVVKPEDKLQQLLNIL 256

Query: 356 QEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTII 415
                          R+R                                        I+
Sbjct: 257 NNF------------RYR--------------------------------------KCIV 266

Query: 416 FVSTRHHVEYVSNLLKDCGYL--------VSYLYGTLDQHARRQQLHNFRCGL-TNILVV 466
           +  T   V Y  + +K    L        +  L+G L  ++R   L  F   L +++L+ 
Sbjct: 267 YFPTCQAVTYFYSFIKHLCELGIIGASLQIFSLHGKLQTNSRLGTLTKFSQSLDSSVLLT 326

Query: 467 TDVAARGVDIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWAYT 512
           TDVAARG+DIP +  V+    P ++++F+HR GRT RA   G A T
Sbjct: 327 TDVAARGIDIPEVDLVLQFDPPPNAEMFLHRCGRTGRANRVGKAVT 372

>ZYRO0E02530g Chr5 (197126..198796) [1671 bp, 556 aa] {ON} highly
           similar to uniprot|P45818 Saccharomyces cerevisiae
           YGL171W ROK1 ATP-dependent RNA helicase of the DEAD box
           family required for 18S rRNA synthesis
          Length = 556

 Score =  157 bits (397), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 119/400 (29%), Positives = 193/400 (48%), Gaps = 68/400 (17%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHS 186
             K +L N+    F +PTPIQ + IPL L  RD++  A TGSGKT AF++PL++++    
Sbjct: 127 FDKRLLNNLIDNDFTEPTPIQCEGIPLALHGRDLLSCAPTGSGKTLAFLIPLLQQIIDSK 186

Query: 187 AKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLE-----DQFSMMMSNP 241
              G + +I+SP++ELA QT   F E  K S  R + L     L+        S  + N 
Sbjct: 187 DVQGLKGLIISPTKELASQT---FVECVKLS--RKIFLDKKRPLQVAILSKSLSAKLRNK 241

Query: 242 -------DVIIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSL-- 292
                  D+II+TP R + L     LDL ++ ++VFDEAD+LF+  F EQ +++L +   
Sbjct: 242 VVSDKKYDIIISTPLRLIDLVKNEALDLSNVRHLVFDEADKLFDKTFVEQTDDILSACSD 301

Query: 293 PTARQTLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLL 352
           P  R+++ FSAT+PS++ + A++ +T+PV V +  +   + N++   +   N+  E  L+
Sbjct: 302 PRLRKSM-FSATIPSNVEEIAQSIMTDPVRVIIGHKEGANANIDQRLVYCGNE--EGKLI 358

Query: 353 YLLQEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNS 412
            + + V         Q   F+                                       
Sbjct: 359 AIRRMV---------QEGEFKP-------------------------------------P 372

Query: 413 TIIFVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAAR 472
            IIF+ +    + + + L   G  V  L+    Q  R + +  F+ G    L+ TDV AR
Sbjct: 373 VIIFLESITRAKALYHELMYDGLNVDVLHAERTQMQRDKIIERFKTGDLWCLICTDVLAR 432

Query: 473 GVDIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWAYT 512
           G+D   +  VVN  +P +++ +VHR+GRT R   +G A T
Sbjct: 433 GIDFKGINLVVNYDVPQTAQAYVHRIGRTGRNNRQGKAVT 472

>Kwal_23.4288 s23 (654900..656378) [1479 bp, 492 aa] {ON} YMR290C
           (HAS1) - Putative RNA-dependent helicase [contig 1] FULL
          Length = 492

 Score =  155 bits (393), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 119/391 (30%), Positives = 188/391 (48%), Gaps = 62/391 (15%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHS 186
           LS   +  + + GF   T +Q +TIP +L  RD++G A+TGSGKT AF+LP +E L  HS
Sbjct: 35  LSSPTIKAVEKLGFTTMTQVQSRTIPPLLAGRDVLGAAKTGSGKTLAFLLPAVEML--HS 92

Query: 187 AKI----GARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPD 242
            K     G   ++++P+RELA+Q   V K   +  +    ++ GG     +   +    +
Sbjct: 93  LKFKPRNGTGVVVITPTRELALQIFGVAKSLMEFHSQTFGIVIGGANRRQEADKLAKGVN 152

Query: 243 VIIATPGRFL-HLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTA-RQTLL 300
           ++IATPGR L HL+        +++ ++ DEADR+ E+GF++++ +++  LP   RQT+L
Sbjct: 153 LLIATPGRLLDHLQNTKGFVFKNLKALIIDEADRILEIGFEDEMRQIVKILPNEDRQTML 212

Query: 301 FSATLPSSLVDFAKAGL-TNPVLVRLDTETKVS--ENLEMLFLSVKNDEREANLLYLLQE 357
           FSAT  + + D A+  L   P+ + +D+E + S  + LE  ++  ++D+R   L   L+ 
Sbjct: 213 FSATQTTKVEDLARISLRPGPLFINVDSEKENSTVDGLEQGYVVCESDKRFLLLFSFLKR 272

Query: 358 VIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFV 417
             K  V                                           + S NS     
Sbjct: 273 NQKKKVIVF----------------------------------------LSSCNS----- 287

Query: 418 STRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIP 477
             R++ E    LL      V  L+G   Q  R      F       LV TDVAARG+DIP
Sbjct: 288 -VRYYAE----LLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGTLVCTDVAARGLDIP 342

Query: 478 LLANVVNMSLPASSKIFVHRVGRTARAGNKG 508
            +  ++    P   + ++HRVGRTAR G+KG
Sbjct: 343 AVDWIIQFDPPDDPRDYIHRVGRTAR-GSKG 372

>YFL002C Chr6 complement(145114..146934) [1821 bp, 606 aa] {ON}
           SPB4Putative ATP-dependent RNA helicase, nucleolar
           protein required for synthesis of 60S ribosomal subunits
           at a late step in the pathway; sediments with 66S
           pre-ribosomes in sucrose gradients
          Length = 606

 Score =  157 bits (398), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 123/391 (31%), Positives = 190/391 (48%), Gaps = 61/391 (15%)

Query: 139 GFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHSA------KIGAR 192
           GF   TP+Q  TIP++   +D+V  + TGSGKTAAFV+P++EK+    A      K    
Sbjct: 26  GFETMTPVQASTIPMLAGNKDVVVDSVTGSGKTAAFVIPVLEKVVKEEANTSKFKKAHFH 85

Query: 193 AMILSPSRELAMQTHKVFKEFAKG--SNL---RSVLLTGGD--GLEDQFSMMMSN-PDVI 244
           ++I++P+REL+ Q   V   F +   S+L   +  LL G +   + D  S  + N P ++
Sbjct: 86  SLIIAPTRELSRQIESVVLSFLEHYPSDLFPIKCQLLVGTNEATVRDDVSNFLRNRPQIL 145

Query: 245 IATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSAT 304
           I TPGR L       +   +   VV DEADRL +M F +   ++L  LP  R+T LFSAT
Sbjct: 146 IGTPGRVLDFLQMPAVKTSACSMVVMDEADRLLDMSFIKDTEKILRLLPKQRRTGLFSAT 205

Query: 305 LPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVA 364
           + S+  D  K GL NPV + ++++ +   +L++ +  V   E+   L+ +L         
Sbjct: 206 MRSAGSDIFKTGLRNPVRITVNSKNQAPSSLKLNYCVVNPAEKLQLLVSILNN------- 258

Query: 365 TEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVE 424
                 +F+                                  P+  S   F S    ++
Sbjct: 259 -----YKFKKCIVY----------------------------FPTCVSVSYFYS---FIQ 282

Query: 425 YVS--NLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTN-ILVVTDVAARGVDIPLLAN 481
           Y+   N+L +   + S L+G L   AR + L  F   L+N +L  TDVAARG+DIP +  
Sbjct: 283 YLGKRNILVNEVEIFS-LHGKLQTSARTKTLTAFTDSLSNSVLFTTDVAARGIDIPDVDL 341

Query: 482 VVNMSLPASSKIFVHRVGRTARAGNKGWAYT 512
           V+ +  P ++ +F+HR GRT RA   G A T
Sbjct: 342 VIQLDPPTNTDMFMHRCGRTGRANRVGKAIT 372

>Skud_14.219 Chr14 (403781..405088) [1308 bp, 435 aa] {ON} YNL112W
           (REAL)
          Length = 435

 Score =  154 bits (389), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 98/349 (28%), Positives = 166/349 (47%), Gaps = 51/349 (14%)

Query: 130 FILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMH---S 186
           ++L  +  +GF +PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP I  +      +
Sbjct: 123 YVLKEVKAEGFDKPTGIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIVHINAQPLLA 182

Query: 187 AKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIA 246
              G   ++LSP+RELA+Q      +F   S +R+  + GG     Q   +    +++IA
Sbjct: 183 PGDGPIVLVLSPTRELAVQIQTECSKFGHSSRIRNTCVYGGVPKSQQIRDLSRGSEIVIA 242

Query: 247 TPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSATLP 306
           TPGR + +      +L  + Y+V DEADR+ +MGF+ Q+ +++  +   RQTL++SAT P
Sbjct: 243 TPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWP 302

Query: 307 SSLVDFAKAGLTNPVLVRLDT-ETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVAT 365
             +   A   L +P+ V++ + E   S  +  +   V + E+   L   L+        T
Sbjct: 303 KEVKQLAADYLNDPIQVQVGSLELSASHTITQVVEVVSDFEKRDRLNKHLE--------T 354

Query: 366 EEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEY 425
             Q   ++                                       T++F ST+   + 
Sbjct: 355 ASQDDEYK---------------------------------------TLVFASTKRMCDD 375

Query: 426 VSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGV 474
           ++  L++ G+    ++G  DQ  R   L  FR G + ++V TDVAARG+
Sbjct: 376 ITKYLREDGWPALAIHGDKDQRERDWVLQEFRNGRSPVMVATDVAARGI 424

>TBLA0H03240 Chr8 complement(787863..790166) [2304 bp, 767 aa] {ON}
           Anc_8.402 YDR194C
          Length = 767

 Score =  158 bits (400), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 122/416 (29%), Positives = 201/416 (48%), Gaps = 46/416 (11%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQ--RDIVGMARTGSGKTAAFVLPLIEKLKM 184
           + K +   + R GF+  TP+Q+KTI  IL+    D++  A+TG+GKT AF+LPL +KL  
Sbjct: 170 IDKKLFTAVHRLGFKSLTPVQQKTIKPILKDSGNDVIARAKTGTGKTFAFLLPLFQKLIE 229

Query: 185 HSAKIGARAMILSPSRELAMQT-HKVFKEFAKGSNLR---SVLLTGGDGLEDQFS-MMMS 239
                  +++I++P+R+LA+Q   ++ K +   S LR    + + GG         +   
Sbjct: 230 SPNSAMVKSVIMAPTRDLALQIEQEILKLYKNNSALRQYNCLSIVGGTNYSYSLQRLHRE 289

Query: 240 NPDVIIATPGRFLHLKVEMNLDLHS-IEYVVFDEADRLFEMGFQEQLNELLGSLPTAR-- 296
            P++I+ATPGR L +  +      S +++ V DEADRL E+GF+E L  +  SL +    
Sbjct: 290 RPNIIVATPGRMLAVLSDFGDKFFSEVDFKVLDEADRLLEIGFKEDLVAISNSLDSVNSN 349

Query: 297 -----QTLLFSATLPSSLVDFAKAGLTNPVLVRLDT----ETKVSENLEMLFLSVKNDER 347
                +TLLFSATL   +   A   +     + LDT    E +  EN+      V +D  
Sbjct: 350 GADHIRTLLFSATLDDKVQTLANDIMNKEECLFLDTIDKNEPEAHENINQNL--VVSDAF 407

Query: 348 EANLLYLLQEV------IKIPVA---TEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXX 398
             ++  +++ +       ++P+A   TEE+ +                            
Sbjct: 408 SHSIYAVIEHIRSRLHPTELPIAEVTTEEETK------------VEAGVESVEETEVITK 455

Query: 399 QPLPSAKDMPSPNSTIIFVSTRHHVEYVSNLLKD----CGYLVSYLYGTLDQHARRQQLH 454
              P  K        I+F  T    +++S L+K      G  +   +G +DQ+ R + + 
Sbjct: 456 ATKPFDKHDTQNYKAILFTPTVKCTKFLSQLIKREFQIEGIPIYEFHGKIDQNRRTRIVE 515

Query: 455 NFRCGLTNILVVTDVAARGVDIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWA 510
            F+   + ILV TDV ARG+D P +  V+ + +P+    +VHR+GRTARAG KG +
Sbjct: 516 KFKRANSGILVCTDVGARGMDFPNVQEVLQLGVPSELSNYVHRIGRTARAGKKGIS 571

>TBLA0C00690 Chr3 complement(136694..138508) [1815 bp, 604 aa] {ON}
           Anc_8.87 YFL002C
          Length = 604

 Score =  156 bits (395), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 118/407 (28%), Positives = 185/407 (45%), Gaps = 73/407 (17%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHS 186
           L  +I   I   GF + TP+Q  TIP++   +D+V  + TGSGKT AFV+P++EK+    
Sbjct: 14  LQPWIRTAIDVMGFERMTPVQASTIPMLAGNKDVVVDSVTGSGKTIAFVIPVLEKIISEQ 73

Query: 187 A------KIGARAMILSPSRELAMQTHKVFKEFAKGSN-----LRSVLLTGGDG--LEDQ 233
           A      K     +I++P+REL+ Q   V   F          +RS LL G +   + D 
Sbjct: 74  ANNVKFKKGHFHTLIIAPTRELSKQIQAVIDSFLDHYPEGLYPIRSKLLVGTNTRTVRDD 133

Query: 234 FSMMMSN-PDVIIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSL 292
            +  + + P +++ TPGR L       +   S   V+ DEADRL +  F   +  +LG L
Sbjct: 134 VAQFLDDRPQILVGTPGRILDFLGNPTVKTSSCSMVILDEADRLLDGSFLGDVENILGIL 193

Query: 293 PTARQTLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLL 352
           P  R+T LFSAT+ S+  +  K GL NP+ + ++++    ++L + +  VK +++   LL
Sbjct: 194 PKQRRTGLFSATINSAGENIFKTGLRNPIKITVNSKQSAPQSLNIDYAVVKLEKKLEYLL 253

Query: 353 YLLQEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNS 412
            LL               +F+                                       
Sbjct: 254 TLLNNY------------KFK--------------------------------------K 263

Query: 413 TIIFVSTRHHVEYVSNLLK--------DCGYLVSYLYGTLDQHARRQQLHNFRCGLTN-I 463
            I++  T   V Y+ N  +        +    +  L+G L   +R + L +F     N I
Sbjct: 264 CIVYFPTCIFVNYIYNFFQHLQKSKVIESKLSIFSLHGKLQTSSRMKTLDSFTQTFDNAI 323

Query: 464 LVVTDVAARGVDIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWA 510
           L+ TDVAARG+DIP +  V+ +  P  S +F+HR GRT RA   G A
Sbjct: 324 LLTTDVAARGIDIPDVDLVIQVDPPTDSDVFLHRCGRTGRANRIGKA 370

>TDEL0C01160 Chr3 complement(198802..200613) [1812 bp, 603 aa] {ON}
           Anc_8.87 YFL002C
          Length = 603

 Score =  154 bits (390), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 152/550 (27%), Positives = 235/550 (42%), Gaps = 85/550 (15%)

Query: 139 GFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHSAKIGA------R 192
           GF   TP+Q  TIPL  + +D+V  + TGSGKT AFV+P++E++    A   A       
Sbjct: 26  GFDAMTPVQASTIPLFSRNKDVVVESVTGSGKTVAFVVPILERIISDGANSTAFKKGHFH 85

Query: 193 AMILSPSRELAMQTHKVFKEF-----AKGSNLRSVLLTGGDG---LEDQFSMMMSNPDVI 244
           ++I++P+REL+ Q   V + F          ++S LL G       +D    +   P ++
Sbjct: 86  SLIVTPTRELSNQIQSVIQSFLDHYPGDSYPIKSQLLVGTSQKTVRDDVTKFLEERPQIL 145

Query: 245 IATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSAT 304
           + TPGR L      ++   S   VV DEADRL +  F + + ++L +LP  R+T LFSAT
Sbjct: 146 VGTPGRVLDFLQMPSVKTLSCNMVVLDEADRLLDSDFFKDVEKILRTLPKQRRTGLFSAT 205

Query: 305 LPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVA 364
           +  +     K GL NPV V +++  K   +L + +  +   E+   L+ +L         
Sbjct: 206 ISEAGNQIFKTGLRNPVKVTVNSSKKGPASLGLFYTVIDPQEKLLQLINILNNY------ 259

Query: 365 TEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVE 424
                 +F+                                  P+  S   F S   +++
Sbjct: 260 ------KFKKCIAY----------------------------FPTCISVTFFYSFLQYLQ 285

Query: 425 YVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTN-ILVVTDVAARGVDIPLLANVV 483
               LL D   +V  L+G L   +R + L NF   +   +L+ TDVAARG+DI  +  VV
Sbjct: 286 REKKLLSD-EVMVYSLHGKLQTASRMKTLENFTDTVNKAVLLTTDVAARGIDISDVDLVV 344

Query: 484 NMSLPASSKIFVHRVGRTARAGNKGWAYTIXXXXXXXXXXXXXXXXGKKVLLTPMYEATC 543
            +  P  + + +HR GRT RA   G A T                 G++  L P  E   
Sbjct: 345 QLDPPTDTSVLLHRCGRTGRANRIGKAITF-------------INEGREEDLIPFLEVK- 390

Query: 544 DLLKKKWISEGNEGALFQPPKISYVNRLILGSAPRLDLEAMGDLF------KNLVESNFE 597
           D+  +K   + +E  L +          IL    R DL     +       K+   S F 
Sbjct: 391 DVHLQKMTLKKDE--LLKEGIYEVFKEWILQDRARFDLSVRSYVAFIKYYSKHSASSIFR 448

Query: 598 LQNLKAVSIKAEKLYLRTRQPASAESIKRAK-EVIAAGW-DEQNV---RFGKNIEKEKLE 652
           LQ+L  V +   K+Y   R P   E  K  K + I  GW  +Q +   RF    +K +  
Sbjct: 449 LQSLDYVGL--AKMYGLFRLPRMPEITKYFKSDTIKDGWLVDQPIDMDRFAYKDKKHEAA 506

Query: 653 FLAKLQNRHN 662
            L KL++  N
Sbjct: 507 RLEKLKDLEN 516

>ACR253C Chr3 complement(802236..803426) [1191 bp, 396 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL138C
           (TIF2) and YKR059W (TIF1)
          Length = 396

 Score =  150 bits (378), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 95/370 (25%), Positives = 173/370 (46%), Gaps = 51/370 (13%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHS 186
           L + +L  I   GF  P+ IQ++ I  I++  D++  A++G+GKT  F +  ++++   S
Sbjct: 29  LKEVLLRGIYGYGFVDPSAIQQRAILPIIEGHDVLAQAQSGTGKTGTFSIAALQRID-ES 87

Query: 187 AKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIA 246
            K   +A+IL+P+RELA+Q  KV    A   +++     GG    +    + +   +++ 
Sbjct: 88  IK-APQALILAPTRELALQIQKVVMALALHMDVKVHACIGGTDPREDAEALRAGAQIVVG 146

Query: 247 TPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSATLP 306
           TPGR   +    N     I+  + DEAD +   GF+EQ+ ++   LP   Q +L SAT+P
Sbjct: 147 TPGRVFDMIERRNFKTDHIKMFILDEADEMLSSGFKEQIYKIFTMLPPTTQVVLLSATMP 206

Query: 307 SSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVATE 366
             ++D     +  PV + +  +    E ++  +++V+++E + + L  L + I +  A  
Sbjct: 207 KEVLDVTDKFMNKPVRILVKKDALTLEGIQQYYINVESEEYKYDCLSDLYDSISVTQA-- 264

Query: 367 EQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYV 426
                                                          +IF +TR  VE +
Sbjct: 265 -----------------------------------------------VIFCNTRRKVEEL 277

Query: 427 SNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMS 486
           +  L D  + VS +Y  L Q  R   +  FR G + IL+ TD+ ARG+D+  ++ V+N  
Sbjct: 278 TKRLTDDSFTVSAIYSDLPQAQRDTIMKEFRTGSSRILISTDLLARGIDVQQVSLVINYD 337

Query: 487 LPASSKIFVH 496
           LP + + ++H
Sbjct: 338 LPNNKENYIH 347

>SAKL0B02794g Chr2 complement(266645..268441) [1797 bp, 598 aa] {ON}
           highly similar to gnl|GLV|KLLA0E14410g Kluyveromyces
           lactis KLLA0E14410g and similar to YFL002C
           uniprot|P25808 Saccharomyces cerevisiae YFL002C SPB4
           involved in the maturation of 25S ribosomal RNA ATP-
           dependent RNA helicase
          Length = 598

 Score =  153 bits (386), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 117/398 (29%), Positives = 189/398 (47%), Gaps = 57/398 (14%)

Query: 130 FILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKL---KMHS 186
           +I   I   GF   TP+Q  TIP+    +D+V  + TGSGKT +FV+P++EK+   + H+
Sbjct: 17  WIRTAIDTMGFETMTPVQASTIPMFSGNKDVVVESVTGSGKTVSFVIPILEKIIADEAHT 76

Query: 187 AKIGA---RAMILSPSRELAMQTHKVFKEF-----AKGSNLRSVLLTGGDG---LEDQFS 235
           AK+      ++I+SP+REL+ Q   V + F      +   + S LL G +     +D  S
Sbjct: 77  AKLKKGHFYSLIISPTRELSSQIQTVIESFLNHYPEENCPISSQLLIGTNKSTVRDDVNS 136

Query: 236 MMMSNPDVIIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTA 295
            M + P +++ TPGR L       +   S   VV DEAD+L +  F++ +  +L  LP  
Sbjct: 137 YMENRPQILVGTPGRILDFLNMPTVKSSSCGVVVLDEADKLLDASFEKDVETILKLLPKQ 196

Query: 296 RQTLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLL 355
           R+T LFSAT+ S+     K G+ NPV + + ++ +   +L++    VK + +   LL +L
Sbjct: 197 RRTGLFSATINSAGTQIFKTGMRNPVKISVKSKHQAPSSLKIKCAVVKPELKFQLLLTVL 256

Query: 356 QEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTII 415
                     ++ +  F                                   P+  S   
Sbjct: 257 NH-----YNYKKCIVYF-----------------------------------PTCVSVTY 276

Query: 416 FVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGL-TNILVVTDVAARGV 474
           F +   H+  +  + +D    +  L+G L  ++R + L  F   L T +L+ TDVAARG+
Sbjct: 277 FYAFMQHLLKLGLINEDLD--IFSLHGKLQTNSRMKTLERFTESLNTAVLLTTDVAARGI 334

Query: 475 DIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWAYT 512
           DIP +  V+    P  + +F+HR GRT RA   G A T
Sbjct: 335 DIPDVDLVLQFDPPTDADMFLHRCGRTGRASRVGRAIT 372

>Kpol_473.7 s473 complement(21177..22613) [1437 bp, 478 aa] {ON}
           complement(21177..22613) [1437 nt, 479 aa]
          Length = 478

 Score =  150 bits (379), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 109/382 (28%), Positives = 183/382 (47%), Gaps = 64/382 (16%)

Query: 140 FRQPTPIQRKTIPLILQQ--RDIVGMARTGSGKTAAFVLPLIEKLKMHSAKIGARAMILS 197
           F++P+ IQ + +PL+L    R+++  +++G+GKTAAF L ++ ++     K   +A+ L+
Sbjct: 108 FQKPSKIQERALPLLLSNPPRNMIAQSQSGTGKTAAFSLTMLTRV--DPTKDVTQAICLA 165

Query: 198 PSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIATPGRFLHLKVE 257
           PSRELA QT +V +E  K + + S L+   D  E    +     ++++ATPG  L L   
Sbjct: 166 PSRELARQTLEVIQEMGKFTKITSQLIV-PDSYERNKPV---TANIVVATPGTVLDLMRR 221

Query: 258 MNLDLHSIEYVVFDEADRLFE-MGFQEQLNELLGSLPTARQTLLFSATLPSSLVDFAKAG 316
             L ++ ++  V DEAD + +  G  +Q   +   LP   Q +LFSAT   ++ ++AK  
Sbjct: 222 KLLIVNHVKIYVLDEADNMLDKQGLGDQCIRVKKFLPKTAQLVLFSATFDDAVREYAKKV 281

Query: 317 LTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVATEEQLQRFRXXX 376
           + N   + L         ++ L++   N++ +  +L  L  ++ I               
Sbjct: 282 VPNANTLELQRNEVNVAAIKQLYMDCNNEDHKYEVLCELYGLLTI--------------- 326

Query: 377 XXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYVSNLLKDCGYL 436
                                              S+IIFVST+     +   LK  G+ 
Sbjct: 327 ----------------------------------GSSIIFVSTKKTANLLYAKLKQEGHQ 352

Query: 437 VSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSLPAS------ 490
           VS L+G L    R + + +FR G + +L+ T+V ARG+DIP ++ VVN  LP S      
Sbjct: 353 VSILHGDLQSTERDRLIDDFREGRSKVLITTNVLARGIDIPTVSMVVNYDLPTSLNGQAD 412

Query: 491 SKIFVHRVGRTARAGNKGWAYT 512
              ++HR+GRT R G KG A +
Sbjct: 413 PATYIHRIGRTGRFGRKGVAIS 434

>TPHA0J01230 Chr10 complement(289735..291210) [1476 bp, 491 aa] {ON}
           Anc_5.643 YOR046C
          Length = 491

 Score =  150 bits (379), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 111/383 (28%), Positives = 187/383 (48%), Gaps = 66/383 (17%)

Query: 140 FRQPTPIQRKTIPLILQQ--RDIVGMARTGSGKTAAFVLPLIEKLKMHSAKIGARAMILS 197
           F++P+ IQ + +PL+L    R+++  +++G+GKTAAF L ++ ++   + ++  +A+ L+
Sbjct: 121 FQKPSKIQERALPLLLSNPPRNMIAQSQSGTGKTAAFSLTMLSRVD-QTVEL-PQAICLA 178

Query: 198 PSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIATPGRFLHLKVE 257
           P+RELA QT +V +E  K + + S L+   D  E    +   N  +I+ TPG  L L   
Sbjct: 179 PARELARQTLEVIQEMGKFTKITSQLVVP-DSYEKNKGI---NAQIIVGTPGTVLDLMRR 234

Query: 258 MNLDLHSIEYVVFDEADRLFE-MGFQEQLNELLGSLPTARQTLLFSATLPSSLVDFAKAG 316
             L++  ++  V DEAD + +  G  +Q   +   LP   Q +LFSAT   ++ ++AK  
Sbjct: 235 KMLNVSRVKVYVLDEADNMLDKQGLGDQCIRVKKFLPKTAQLVLFSATFDEAVREYAKKV 294

Query: 317 LTNPVLVRLD-TETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVATEEQLQRFRXX 375
           + +   V L   E  VS  ++ L++   N+  +  +L  L  ++ I              
Sbjct: 295 VPSANTVELQRNEVNVSA-IKQLYMDCDNETHKYEVLTELYGLLTI-------------- 339

Query: 376 XXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYVSNLLKDCGY 435
                                               S+IIFVST+     +   LK  G+
Sbjct: 340 -----------------------------------GSSIIFVSTKKTANLLYGKLKQEGH 364

Query: 436 LVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSLP------A 489
            VS L+G L+   R + + +FR G + +L+ T+V ARG+DIP ++ VVN  LP      A
Sbjct: 365 QVSILHGDLNSSDRDRLIDDFREGRSKVLITTNVLARGIDIPSVSMVVNYDLPTTLNGEA 424

Query: 490 SSKIFVHRVGRTARAGNKGWAYT 512
               ++HR+GRT R G KG A +
Sbjct: 425 DPATYIHRIGRTGRFGRKGVAIS 447

>Kpol_340.2 s340 complement(3233..5245) [2013 bp, 670 aa] {ON}
           complement(3233..5245) [2013 nt, 671 aa]
          Length = 670

 Score =  153 bits (386), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 120/397 (30%), Positives = 193/397 (48%), Gaps = 62/397 (15%)

Query: 134 NISRKGFRQPTPIQRKTIPLILQQ--RDIVGMARTGSGKTAAFVLPLIEKL---KMHSAK 188
           +ISR GF   T +Q+KTI  IL+   RD++  A+TG+GKT AF++PL E L   +  S  
Sbjct: 129 SISRMGFPNLTAVQQKTIKPILENEDRDVIARAKTGTGKTFAFLIPLFEHLIRTRRESPD 188

Query: 189 IGARAMILSPSRELAMQ----THKVFKEFAKGSNLRSVLLTGGDGL-EDQFSMMMSNPDV 243
           +  +A++L+P+R+LA+Q     HK+            + + GG    +  F +  + P++
Sbjct: 189 M-VKAVVLAPTRDLALQIEQEVHKIHSNNYALKKFGCMSVVGGTKFGQSLFQLKKTRPNI 247

Query: 244 IIATPGRFLHLKVEMNLD-LHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTAR------ 296
           IIATPGRF+     +  +    +++ V DEADRL E+GF++ L  +  SL          
Sbjct: 248 IIATPGRFIATVEAVGAEYFKHVDFKVLDEADRLLEIGFKDDLEYISTSLNGLNDVGKDH 307

Query: 297 -QTLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLL 355
            +TLLFSATL   +   A   +     + LDT   V +N        ++ E+    L + 
Sbjct: 308 IRTLLFSATLDEKVQTLADDVMNKSECLFLDT---VDKN------EPESHEKIEQSLVVS 358

Query: 356 QEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTII 415
           Q   +   A  + L                               L   K++P+  + I+
Sbjct: 359 QNFAESTYAVIDHL-------------------------------LKQTKNVPNYKA-IL 386

Query: 416 FVSTRHHVEYVSNLLKDC--GYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARG 473
           F  T    +++SNLLK     Y V   +G +DQ  R + + +F+     +LV TDV ARG
Sbjct: 387 FTPTIKATKFLSNLLKKSLHRYPVYEFHGKIDQAKRTRIVGSFKGAPAGLLVCTDVGARG 446

Query: 474 VDIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWA 510
           +D P +  V+ + +P+    +VHR+GRTAR G +G +
Sbjct: 447 MDFPNVTEVLQLGVPSELSNYVHRIGRTARGGKEGAS 483

>NCAS0G00610 Chr7 (105992..107407) [1416 bp, 471 aa] {ON} Anc_5.643
          Length = 471

 Score =  149 bits (377), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 107/395 (27%), Positives = 188/395 (47%), Gaps = 64/395 (16%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQ--RDIVGMARTGSGKTAAFVLPLIEKLKM 184
           L   +L  +    F++P+ IQ K +PL+L    R+++  +++G+GKTAAF L ++ ++ +
Sbjct: 88  LDPALLKGVYAMKFQKPSKIQEKALPLLLHNPPRNMIAQSQSGTGKTAAFSLAMLSRVNV 147

Query: 185 HSAKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVI 244
                  +A+ L+PSRELA QT +V ++  K + + + L+   D  E    +   N  ++
Sbjct: 148 DEEI--PQAICLAPSRELARQTMEVVQDMGKFTKISTQLIVP-DSFERNTRI---NAQIV 201

Query: 245 IATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFE-MGFQEQLNELLGSLPTARQTLLFSA 303
           + TPG  L L     +D+  I+  V DEAD + +  G  +Q   +   +P   Q +LFSA
Sbjct: 202 VGTPGTVLDLMRRKLIDISKIKIFVLDEADNMLDKQGLGDQCVRVKRFIPKTAQLVLFSA 261

Query: 304 TLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPV 363
           T   ++ ++AK  + +   + L T       ++ L++  K++E +  +L  L  ++ I  
Sbjct: 262 TFADAVREYAKKVVPDANTLELQTNEVNVSAIKQLYMDCKSEEHKYEVLSELYGLLTI-- 319

Query: 364 ATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHV 423
                                                           S+IIFV+T++  
Sbjct: 320 -----------------------------------------------GSSIIFVATKNTA 332

Query: 424 EYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVV 483
             +   L+  G+ VS L+G L    R + + +FR G + +L+ T+V ARG+DIP ++ VV
Sbjct: 333 NLLYGQLRKDGHAVSILHGDLQSTERDRLIDDFREGKSKVLITTNVLARGIDIPTVSMVV 392

Query: 484 NMSLP------ASSKIFVHRVGRTARAGNKGWAYT 512
           N  LP      A    ++HR+GRT R G  G A +
Sbjct: 393 NYDLPTLRNGEADPATYIHRIGRTGRFGRTGVAIS 427

>ZYRO0B15576g Chr2 complement(1265375..1266850) [1476 bp, 491 aa]
           {ON} highly similar to uniprot|P20449 Saccharomyces
           cerevisiae YOR046C DBP5 Cytoplasmic ATP-dependent RNA
           helicase of the DEAD-box family involved in mRNA export
           from the nucleus
          Length = 491

 Score =  150 bits (378), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 113/401 (28%), Positives = 189/401 (47%), Gaps = 75/401 (18%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQ--RDIVGMARTGSGKTAAFVLPLIEKLKM 184
           LS  +L  +    F++P+ IQ   +PL+L    R+++  +++G+GKTAAF L ++ ++  
Sbjct: 107 LSPELLKGLYAMKFQKPSKIQEHALPLLLHNPPRNMIAQSQSGTGKTAAFSLAMLTRVNP 166

Query: 185 HSAKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLT-----GGDGLEDQFSMMMS 239
              +   +A+ L+PSRELA QT +V +E  K + + + L+       G  ++ Q      
Sbjct: 167 ELGE-ATQAICLAPSRELARQTLEVIQEMGKFAKISTQLIVPEAFEKGQQIKAQ------ 219

Query: 240 NPDVIIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFE-MGFQEQLNELLGSLPTARQT 298
              V++ TPG  L L     ++L  ++  V DEAD + +  G  +Q   +   LP + Q 
Sbjct: 220 ---VVVGTPGTVLDLIRRKLINLSQVKIFVLDEADNMLDKQGLGDQCIRVKKFLPKSTQL 276

Query: 299 LLFSATLPSSLVDFAKAGLTNPVLVRLD-TETKVSENLEMLFLSVKNDEREANLLYLLQE 357
           +LFSAT P  + ++AK  + +   + L   E  VS  ++ L++   ++  +  +L  L  
Sbjct: 277 VLFSATFPDQVKEYAKRVVPDANSLELQRNEVNVSA-IKQLYMDCNDESHKYEVLTELYG 335

Query: 358 VIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFV 417
           ++ I                                                  S+IIFV
Sbjct: 336 LLTI-------------------------------------------------GSSIIFV 346

Query: 418 STRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIP 477
           ST+     +   LK  G+ VS L+G L    R + + +FR G + +L+ T+V ARG+DIP
Sbjct: 347 STKKTANLLYARLKQEGHQVSILHGDLQSKERDRLIDDFREGRSKVLITTNVLARGIDIP 406

Query: 478 LLANVVNMSLPASS------KIFVHRVGRTARAGNKGWAYT 512
            ++ VVN  LP +         +VHRVGRT R G KG A +
Sbjct: 407 TVSMVVNYDLPTTQTGQPDPSTYVHRVGRTGRFGRKGVAIS 447

>TPHA0D00940 Chr4 complement(186966..188678) [1713 bp, 570 aa] {ON}
           Anc_8.124 YGL171W
          Length = 570

 Score =  151 bits (382), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 111/398 (27%), Positives = 191/398 (47%), Gaps = 64/398 (16%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHS 186
             K +L N+    F +PTP+Q + IPL L  RD++  A TGSGKT AF++PL++++    
Sbjct: 131 FDKRLLRNLLENHFTEPTPVQSECIPLALHTRDMLACAPTGSGKTLAFLIPLLQQVIEQK 190

Query: 187 AKIGARAMILSPSRELAMQTHKVFKEFAKGSNLR--------SVLLTGGDGLEDQFSMMM 238
            +IG + +I+SP++ELA Q   +F E  K +N           + L          + ++
Sbjct: 191 EEIGLKGLIISPTKELADQ---IFLECTKLANRLYLDKKRPLQIALLSKSLSSKLKNKVI 247

Query: 239 SNP--DVIIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSL--PT 294
           S+   D+II+TP R + +     LDL ++++++FDEAD+LF+  F EQ +++L S   P+
Sbjct: 248 SDKKYDIIISTPLRLIDVVKNEALDLSTVKHLIFDEADKLFDKTFVEQTDDILNSCSDPS 307

Query: 295 ARQTLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYL 354
            R+ + FSAT+PS++ + A+  + +P+ V +  +   + N+E   +   N+  E  L+ +
Sbjct: 308 LRKAM-FSATIPSNVEEIAQTIMMDPIRVIIGHKEAANANIEQKLIFCGNE--EGKLIAI 364

Query: 355 LQEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTI 414
            Q V         Q   FR                                        I
Sbjct: 365 KQLV---------QQGEFRP-------------------------------------PVI 378

Query: 415 IFVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGV 474
           IF+ +    + + + L      V  ++       R + +  F+ G    L+ TDV ARG+
Sbjct: 379 IFLESITRAKALYHELMYDNLNVDVIHAERTPIQRNKIIEKFKTGELWCLITTDVLARGI 438

Query: 475 DIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWAYT 512
           D   +  V+N  +P +++ +VHR+GRT R    G A T
Sbjct: 439 DFKGVNLVINYDVPRTAQAYVHRIGRTGRGNRSGKAVT 476

>KLLA0C11253g Chr3 complement(967067..969457) [2391 bp, 796 aa] {ON}
           similar to uniprot|P38112 Saccharomyces cerevisiae
           YBR142W MAK5 Essential nucleolar protein putative
           DEAD-box RNA helicase required for maintenance of M1
           dsRNA virus involved in biogenesis of large (60S)
           ribosomal subunits
          Length = 796

 Score =  154 bits (388), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 129/427 (30%), Positives = 204/427 (47%), Gaps = 71/427 (16%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHS 186
           LS  +L  +S  GF +PT IQ K+IPL L+  +I+G A TGSGKT A+ +P+IE+L   +
Sbjct: 226 LSFTVLKGLSGLGFTRPTEIQLKSIPLALKGHNIMGKASTGSGKTLAYGIPIIEQLIKDT 285

Query: 187 AKIGARAMILSPSRELAMQT----HKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPD 242
           +   +  +I +P+RELA Q      KV+ +  K +    + LTGG  ++ Q  ++  +  
Sbjct: 286 SNDRSIGLIFTPTRELAHQVTDHLQKVWTKMNKLNKYTILSLTGGLSIQKQERILKYDGS 345

Query: 243 --VIIATPGRFLHLKVEMNLDL----HSIEYVVFDEADRLFEMGFQEQLNELLGSLPTAR 296
             +I+ATPGRFL L +E N DL      I+ +V DEADRL + G  ++  ++L  L  AR
Sbjct: 346 GRIIVATPGRFLEL-LERNPDLIPRFAKIDTLVLDEADRLLQDGHFDEFEKILKLLGKAR 404

Query: 297 ---------------QTLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLS 341
                          QT++FSAT   SL  F K   T+  +++    T   EN EM    
Sbjct: 405 KIKTSIDGKPTGSGWQTMIFSATF--SLDLFTKLDKTSWKILK----TAGGENNEM---- 454

Query: 342 VKNDEREANLLYLLQEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPL 401
               E+  N L    +    PV  +   +                            + L
Sbjct: 455 ----EQVLNHLMKKIQFKSKPVIIDTNPEH----------------KVTSQVKESLIECL 494

Query: 402 PSAKD-------MPSPNSTIIFVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLH 454
           P  +D       M  P +T++F +    V+ ++  L +       ++ ++ Q  R + L 
Sbjct: 495 PMERDLYVYYFIMMYPGTTLVFCNAIDSVKKLNAFLNNLKISSFQIHSSMAQKNRLRNLE 554

Query: 455 NF--------RCGLTNILVVTDVAARGVDIPLLANVVNMSLPASSKIFVHRVGRTARAGN 506
            F        + G   IL+ +DVAARG+DI  + +V++  LP S+ +++HR GRTAR  N
Sbjct: 555 KFKEQSEKNSKVGKPTILIASDVAARGLDISGIKHVLHYHLPRSADVYIHRSGRTARGDN 614

Query: 507 KGWAYTI 513
           +G +  I
Sbjct: 615 EGVSVMI 621

>KLLA0F15950g Chr6 (1477113..1478522) [1410 bp, 469 aa] {ON} similar
           to uniprot|P20449 Saccharomyces cerevisiae YOR046C DBP5
           Cytoplasmic ATP-dependent RNA helicase of the DEAD-box
           family involved in mRNA export from the nucleus
          Length = 469

 Score =  148 bits (374), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 113/383 (29%), Positives = 181/383 (47%), Gaps = 66/383 (17%)

Query: 140 FRQPTPIQRKTIPLILQQ--RDIVGMARTGSGKTAAFVLPLIEKLKMHSAKIGARAMILS 197
           F++P+ IQ K +PL+++    +++  +++G+GKTAAF L ++ ++  +      +A+ LS
Sbjct: 99  FQKPSKIQEKALPLLIRDPPHNMIAQSQSGTGKTAAFSLTMLTRVDPNVN--STQAICLS 156

Query: 198 PSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIATPGRFLHLKVE 257
           P+RELA QT +V +E  K +   S L+   D  E    +     ++++ TPG  L L   
Sbjct: 157 PARELARQTLEVIQEMGKFTKTSSQLVV-PDSFERNKPI---TANIVVGTPGTVLDLIRR 212

Query: 258 MNLDLHSIEYVVFDEADRLFE-MGFQEQLNELLGSLPTARQTLLFSATLPSSLVDFAKAG 316
             L+L SI+  V DEAD + +  G  +Q   +   LP   Q +LFSAT    +  +AK  
Sbjct: 213 KMLNLGSIKVFVLDEADNMLDKQGLGDQCIRVKKFLPKTCQLVLFSATFDDGVRQYAKKI 272

Query: 317 LTNPVLVRLD-TETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVATEEQLQRFRXX 375
           +   V + L   E  VS  ++ LF+   N+E +  +L  L  ++ I              
Sbjct: 273 IPTAVSLELQKNEVNVSA-IKQLFMDCDNEEHKYTILSELYGLLTI-------------- 317

Query: 376 XXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYVSNLLKDCGY 435
                                               S+IIFV T+     +   LK  G+
Sbjct: 318 -----------------------------------GSSIIFVKTKQTANLLYAKLKKEGH 342

Query: 436 LVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSLP------A 489
            VS L+G L    R + + +FR G + +L+ T+V ARG+DIP ++ VVN  LP      A
Sbjct: 343 QVSILHGDLQSQDRDRLIDDFREGRSKVLITTNVLARGIDIPSVSMVVNYDLPTLPNGQA 402

Query: 490 SSKIFVHRVGRTARAGNKGWAYT 512
               +VHR+GRT R G  G A +
Sbjct: 403 DPSTYVHRIGRTGRFGRTGVAIS 425

>KLLA0A05731g Chr1 (536243..537433) [1191 bp, 396 aa] {ON} highly
           similar to uniprot|P10081 Saccharomyces cerevisiae
           YKR059W TIF1 translation initiation factor eIF4A
          Length = 396

 Score =  146 bits (368), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 92/367 (25%), Positives = 173/367 (47%), Gaps = 53/367 (14%)

Query: 131 ILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHSAKIG 190
           +L  I   GF +P+ IQ++ I  I++ +D++  A++G+GKT  F +  ++ +     KI 
Sbjct: 33  LLRGIFGYGFVEPSAIQQRAILPIIEGKDVLAQAQSGTGKTGTFSIAALQNI---DEKIK 89

Query: 191 A-RAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIATPG 249
           A + +IL+P+RELA+Q  KV    A   +++     GG  L++    +     +I+ TPG
Sbjct: 90  APQGLILAPTRELALQIQKVVMALAIHMDVKVHACIGGTSLQEDSEALRGGAQIIVGTPG 149

Query: 250 RFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSATLPSSL 309
           R   +         +I+  + DEAD +   GF+EQ+  +   LP   Q +L SAT+P  +
Sbjct: 150 RVFDMIDRRIFKTDNIKMFILDEADEMLSTGFKEQIYNIFTMLPPTSQVVLLSATMPGDV 209

Query: 310 VDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVATEEQL 369
           ++     + +PV + +  +    E +   +++V+ ++ + + L  L + I +  A     
Sbjct: 210 LEVTSKFMKDPVRILVKKDELTLEGIGQYYVNVEEEQYKYDCLTDLYDSISVTQA----- 264

Query: 370 QRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYVSNL 429
                                                       +IF +TR  VE ++  
Sbjct: 265 --------------------------------------------VIFCNTRRKVEELTER 280

Query: 430 LKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSLPA 489
           L++  + VS +Y  L Q  R   +  FR G + IL+ TD+ ARG+D+  ++ V+N  LP+
Sbjct: 281 LRENNFTVSAIYSDLQQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDLPS 340

Query: 490 SSKIFVH 496
           + + ++H
Sbjct: 341 NKENYIH 347

>AGL112C Chr7 complement(495879..497855) [1977 bp, 658 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR194C
           (MSS116)
          Length = 658

 Score =  150 bits (380), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 119/396 (30%), Positives = 192/396 (48%), Gaps = 75/396 (18%)

Query: 138 KGFRQPTPIQRKTIPLILQ-QRDIVGMARTGSGKTAAFVLPLIEKLKMHSAKIGARAMIL 196
           +GF + TP+Q+KT+  ILQ + D+V  A+TG+GKT AF++PL ++L         +A+++
Sbjct: 144 RGFDKLTPVQQKTLKPILQTEHDVVARAKTGTGKTLAFLMPLFQRLLEGPPSENVKAVVI 203

Query: 197 SPSRELAMQTHKVFKEFAKGSN-------LRSVLLTGGDGLEDQF-SMMMSNPDVIIATP 248
           +P+R+LA Q   +F E  +  N         +V++ GG    + F S+    P++++ATP
Sbjct: 204 APTRDLAAQ---IFNEINEMRNANRKLRRFNAVVMMGGSSRTETFRSLERRRPNIVVATP 260

Query: 249 GRFLHLKVEMNLDLHS-IEYVVFDEADRLFEMGFQ---EQLNELLGSL----PTARQTLL 300
           GR + +         + +++ V DEAD L E+GF+   EQ+N++L  L     T  +TLL
Sbjct: 261 GRLIDMLEACGPKYFTEVDFKVLDEADTLLEIGFKQALEQINDILNQLNQKGTTHIRTLL 320

Query: 301 FSATLPSSLVDFAKAGLTNPVLVRLDT----ETKVSENLEMLFLSVKN--DEREANLLYL 354
            SATL   +   A + + +   + +DT    E   +EN+    +  K+  D   A+L  +
Sbjct: 321 VSATLDDKVQSLANSIMNHAKCLFIDTVDPNEQATNENIAQKVVISKDFADNITASLYKI 380

Query: 355 LQEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTI 414
            +E    P     +L+                                           I
Sbjct: 381 REEASANP-----KLK------------------------------------------AI 393

Query: 415 IFVSTRHHVEYVSNLLKD-C-GYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAAR 472
           +F+ T   VEY   LL+  C G  V   +G L Q  R   +  FR   + ILV TDVAAR
Sbjct: 394 VFMPTIVAVEYWGELLQSQCRGTPVLLFHGGLSQGRRNSTMKRFRAMDSGILVCTDVAAR 453

Query: 473 GVDIPLLANVVNMSLPASSKIFVHRVGRTARAGNKG 508
           G+D+  + +V  + +P S   ++HR+GRT RAG KG
Sbjct: 454 GMDVSDVQHVYQVGVPTSPDNYIHRIGRTGRAGRKG 489

>CAGL0F05577g Chr6 (559705..561705) [2001 bp, 666 aa] {ON} similar
           to uniprot|P15424 Saccharomyces cerevisiae YDR194c
           MSS116
          Length = 666

 Score =  150 bits (380), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 123/411 (29%), Positives = 205/411 (49%), Gaps = 71/411 (17%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTI-PLILQQ-RDIVGMARTGSGKTAAFVLPLIEKL-- 182
           +S+ +  +ISR GF Q TP+Q+KTI P+I     DI+  A+TG+GKT AF+LP+ + L  
Sbjct: 166 ISRDLYDSISRMGFEQLTPVQQKTIEPIITNSDSDIIARAKTGTGKTFAFLLPIFQHLLN 225

Query: 183 -KMHSAKIGARAMILSPSRELAMQTH-KVFKEFAKGSNLRS---VLLTGGDGLEDQFSMM 237
            K+ S     +++I++P+R+LA+Q   +V K  +K   L++   V L GG   +     +
Sbjct: 226 TKIDSQN-KVKSVIVAPTRDLALQIEDEVRKIHSKNRKLKAFECVSLVGGTNFDRSIRYI 284

Query: 238 MS-NPDVIIATPGRFLHLKVEM-NLDLHSIEYVVFDEADRLFEMGFQEQL---NELLGSL 292
              +P ++I TPGR + +  +  N     +++ V DEADRL E+GF+E L   N++L +L
Sbjct: 285 EKVSPSIVIGTPGRLIDVMEKFGNKFFKDVDFKVLDEADRLLEIGFKEDLSYINKMLNTL 344

Query: 293 PTAR----QTLLFSATLPSSLVDFAKAGLTNPVLVRLDT----ETKVSENLEMLFLSVKN 344
            T      +TLLFSATL   +   +   +     + +DT    E +  E ++   +    
Sbjct: 345 NTNSTEHIRTLLFSATLDHKVQSLSNDIMNKEECLYIDTIDENEPQAHEKIDQTLVV--- 401

Query: 345 DEREANLLYLLQEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSA 404
            E  A+ LY          A  E ++ F                                
Sbjct: 402 GETFADNLY----------AAIEHIREF-------------------------------- 419

Query: 405 KDMPSPN-STIIFVSTRHHVEYVSNLLKDCGYLVSY-LYGTLDQHARRQQLHNFRCGLTN 462
               +PN  +I+F+ T    ++++ +LK    L  Y  +G +DQ  R + ++ F+     
Sbjct: 420 -GTKTPNYKSILFLPTVKFTKFMATILKRQVKLPIYEFHGQIDQKKRTRIVNEFKTMKKG 478

Query: 463 ILVVTDVAARGVDIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWAYTI 513
           +LV TDV ARG+D P +  V+ + LP+    ++HR+GRTAR+G +G + T 
Sbjct: 479 LLVCTDVGARGMDFPNITEVLQIGLPSEIPNYIHRIGRTARSGKEGSSVTF 529

>KAFR0C06090 Chr3 complement(1208993..1210417) [1425 bp, 474 aa]
           {ON} Anc_5.643 YOR046C
          Length = 474

 Score =  147 bits (372), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 110/397 (27%), Positives = 190/397 (47%), Gaps = 68/397 (17%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQ--RDIVGMARTGSGKTAAFVLPLIEKLKM 184
           L+  +L  +    F++P+ +Q + +PL+L    R+++  +++G+GKTAAF L ++ ++  
Sbjct: 91  LAPELLKGVYAMKFQKPSKVQERALPLLLSNPPRNMIAQSQSGTGKTAAFSLAMLSRV-- 148

Query: 185 HSAKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMS-NPDV 243
           ++   G +A+ L+PSRELA QT +V +E  K + + + L+     + D F         +
Sbjct: 149 NTEIDGTQAICLAPSRELARQTLEVIQEMGKFTKITTQLI-----VPDSFPKNEHIKAQI 203

Query: 244 IIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFE-MGFQEQLNELLGSLPTARQTLLFS 302
           I+ TPG  L L     L L+S++  V DEAD + +  G  +Q   +   LP   Q +LFS
Sbjct: 204 IVGTPGTVLDLMRRKLLTLNSVKVFVLDEADNMLDKQGLGDQCIRVKRFLPKTTQLVLFS 263

Query: 303 ATLPSSLVDFAKAGLTNPVLVRLD-TETKVSENLEMLFLSVKNDEREANLLYLLQEVIKI 361
           AT   ++  +AK  +     + L   E  VS  ++ L++   +++ +  +L  L  ++ I
Sbjct: 264 ATFADAVRQYAKKVVPEANTLELQRNEVNVSA-IKQLYMDCNDEQHKYEVLCELYGLLTI 322

Query: 362 PVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRH 421
                                                             S+IIFV+T++
Sbjct: 323 -------------------------------------------------GSSIIFVATKN 333

Query: 422 HVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLAN 481
               +   LK  G+ VS L+G L    R + + +FR G + +L+ T+V ARG+DIP ++ 
Sbjct: 334 TANLLYGKLKQEGHQVSILHGDLQSQERDRLIDDFREGRSKVLITTNVLARGIDIPTVSM 393

Query: 482 VVNMSLP------ASSKIFVHRVGRTARAGNKGWAYT 512
           VVN  LP      A    ++HR+GRT R G  G A +
Sbjct: 394 VVNYDLPTLPNGLADPATYIHRIGRTGRFGRTGVAIS 430

>TPHA0B03040 Chr2 complement(690810..692000) [1191 bp, 396 aa] {ON}
           Anc_1.211 YJL138C
          Length = 396

 Score =  145 bits (367), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 95/367 (25%), Positives = 176/367 (47%), Gaps = 54/367 (14%)

Query: 131 ILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHSAKIG 190
           +L  +   GF +P+ IQ++ I  I+++ D++  A++G+GKT  F +  +E++   S+   
Sbjct: 34  LLKGVYGYGFEEPSAIQQRAILPIVEKHDVLAQAQSGTGKTGTFSIAALERID--SSIKS 91

Query: 191 ARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDG-LEDQFSMMMSNPDVIIATPG 249
            +A+IL+P+RELA+Q  KV    A   +++     GG   +ED  S  + +  +++ TPG
Sbjct: 92  PQALILAPTRELALQIQKVVIALALHMDVKVHACIGGTSFVED--SEGLRDAQIVVGTPG 149

Query: 250 RFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSATLPSSL 309
           R             +I+  + DEAD +   GF+EQ+ ++   LP   Q +L SATLP+ +
Sbjct: 150 RVSDNIQRRRFKTDNIKMFILDEADEMLSSGFREQIYQIFTMLPPTTQVVLLSATLPNDV 209

Query: 310 VDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVATEEQL 369
           ++     + NPV + +  +    E ++  +++V+ D+ + + L  L + I +  A     
Sbjct: 210 LEVTTKFMRNPVRILVKKDELTLEGIKQFYINVEEDDYKFDCLTDLYDSISVTQA----- 264

Query: 370 QRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYVSNL 429
                                                       +IF +TR  VE ++  
Sbjct: 265 --------------------------------------------VIFCNTRRKVEELTQK 280

Query: 430 LKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSLPA 489
           L +  + VS +Y  L Q  R   +  FR G + IL+ TD+ ARG+D+  ++ V+N  LP 
Sbjct: 281 LTENNFTVSSIYSDLPQQERDVIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDLPT 340

Query: 490 SSKIFVH 496
           + + ++H
Sbjct: 341 NKENYIH 347

>SAKL0C10296g Chr3 complement(927939..930377) [2439 bp, 812 aa] {ON}
           similar to uniprot|P38112 Saccharomyces cerevisiae
           YBR142W MAK5 Essential nucleolar protein putative
           DEAD-box RNA helicase required for maintenance of M1
           dsRNA virus involved in biogenesis of large (60S)
           ribosomal subunits
          Length = 812

 Score =  150 bits (380), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 129/425 (30%), Positives = 203/425 (47%), Gaps = 69/425 (16%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKL-KMH 185
           LS   L  +S+ GF +PT IQ KTIPL LQ  DI+G A TGSGKT A+ +P++E L K  
Sbjct: 242 LSFTTLQGLSQLGFLRPTEIQAKTIPLALQNEDIMGKASTGSGKTLAYGIPILETLVKDR 301

Query: 186 SAKIGARAMILSPSRELAMQTHKVFKEFAKG---SNLRSVL-LTGGDGLEDQFSMM--MS 239
           +A      +I +P+RELA Q  +  ++ A      N  S++ LTGG  ++ Q  ++    
Sbjct: 302 TASERPVGLIFTPTRELAHQVTQHLQKVAGAIYEKNQYSIISLTGGLSIQKQERLLGYKG 361

Query: 240 NPDVIIATPGRFLHL---KVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTAR 296
           +  +++ATPGRFL L     E       I+ +V DEADRL + G  ++  ++L  L  AR
Sbjct: 362 SARIVVATPGRFLELIEKSKEFIKRFSQIDTLVLDEADRLLQDGHFDEFEKILKHLGRAR 421

Query: 297 -----------QTLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKND 345
                      QT++FSAT   SL  F K  L+      L        N           
Sbjct: 422 NVKGGSKSDGWQTMVFSATF--SLELFNK--LSTASWKSLKKGAGEDSN----------- 466

Query: 346 EREANLLYLLQEV--IKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPS 403
           E EA L YL+ ++     PV  +   ++                           + LP+
Sbjct: 467 EMEAVLKYLMTKIHFKSKPVIIDTNPEQ----------------KVTSQVRESLIECLPT 510

Query: 404 AKDM-------PSPNSTIIFVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNF 456
            +D+         P +T++F +    V+ ++N L +       ++ ++ Q  R + L  F
Sbjct: 511 ERDLYVYYFVSMYPGTTLVFCNAIDSVKKLNNYLNNLKISSFQIHSSMSQKNRLRNLEKF 570

Query: 457 RCGLTN--------ILVVTDVAARGVDIPLLANVVNMSLPASSKIFVHRVGRTARAGNKG 508
           +    N        +L+ +DVAARG+DIP + +V++  LP S+ +++HR GRTARA ++G
Sbjct: 571 QQQAHNNDFLNKPTVLLASDVAARGLDIPGIKHVIHYHLPRSADVYIHRSGRTARADSEG 630

Query: 509 WAYTI 513
            +  I
Sbjct: 631 VSVMI 635

>Ecym_5196 Chr5 complement(405570..406760) [1191 bp, 396 aa] {ON}
           similar to Ashbya gossypii ACR253C
          Length = 396

 Score =  145 bits (365), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 94/370 (25%), Positives = 172/370 (46%), Gaps = 51/370 (13%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHS 186
           L + +L  I   GF  P+ IQ++ I  I++  D++  A++G+GKT  F +  ++++   S
Sbjct: 29  LKEVLLRGIYGYGFVDPSAIQQRAILPIIEGHDVLAQAQSGTGKTGTFSIAALQRID-ES 87

Query: 187 AKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIA 246
            K   +A+IL+P+RELA+Q  KV    A   +++     GG    +    + +   +++ 
Sbjct: 88  IK-SPQALILAPTRELALQIQKVVMALALHMDVKVHACIGGTDPREDAEALRAGAQIVVG 146

Query: 247 TPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSATLP 306
           TPGR   +          I+  + DEAD +   GF+EQ+ ++   LP   Q +L SAT+P
Sbjct: 147 TPGRVFDMIERRFFKTDHIKMFILDEADEMLSSGFKEQIYKIFTMLPPTTQVVLLSATMP 206

Query: 307 SSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVATE 366
             ++D     +  PV + +  +    E ++  F++V+++E + + L  L + I +  A  
Sbjct: 207 KEVLDVTDKFMNKPVRILVKKDALTLEGIQQYFINVESEEYKYDCLSDLYDSISVTQA-- 264

Query: 367 EQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYV 426
                                                          +IF +TR  VE +
Sbjct: 265 -----------------------------------------------VIFCNTRRKVEEL 277

Query: 427 SNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMS 486
           +  L +  + VS +Y  L Q  R   +  FR G + IL+ TD+ ARG+D+  ++ V+N  
Sbjct: 278 TKRLTEDDFTVSAIYSDLPQAQRDTIMKEFRTGSSRILISTDLLARGIDVQQVSLVINYD 337

Query: 487 LPASSKIFVH 496
           LP + + ++H
Sbjct: 338 LPNNKENYIH 347

>TBLA0J00890 Chr10 complement(199404..200900) [1497 bp, 498 aa] {ON}
           Anc_5.643 YOR046C
          Length = 498

 Score =  146 bits (369), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 108/386 (27%), Positives = 184/386 (47%), Gaps = 70/386 (18%)

Query: 140 FRQPTPIQRKTIPLILQQ--RDIVGMARTGSGKTAAFVLPLIEKLKMHSAKIGARAMILS 197
           F++P+ IQ   +PL+L    ++++  +++G+GKTAAF L ++ ++ +       +A+ L+
Sbjct: 126 FQKPSKIQEHALPLLLHDPPKNMIAQSQSGTGKTAAFSLAMLSRVDLQLGPQIPQAICLA 185

Query: 198 PSRELAMQTHKVFKEFAKGSNLRSVLL---TGGDGLEDQFSMMMSNPDVIIATPGRFLHL 254
           P+RELA QT +V +E  K + + + L+   + G   E Q        ++I+ TPG  L L
Sbjct: 186 PTRELARQTLEVIQEMGKFTEITNHLVVPESYGKNQEIQ-------ANIIVGTPGTVLDL 238

Query: 255 KVEMNLDLHSIEYVVFDEADRLFEM-GFQEQLNELLGSLPTARQTLLFSATLPSSLVDFA 313
                +    I+  V DEAD + +M G  +Q   +   LP   Q +LFSAT    +  +A
Sbjct: 239 IRRKMIQTKHIKVFVLDEADNMLDMQGLSDQCLRVKKILPKTTQLVLFSATFDEKVKTYA 298

Query: 314 KAGLTNPVLVRL-DTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVATEEQLQRF 372
           K  + N  ++ L + E  VS  ++ L++   N+  +  +L  L  ++ I           
Sbjct: 299 KRVVPNANVLELQNNEVNVSA-IKQLYMDCNNENHKFEVLCELYGLLTI----------- 346

Query: 373 RXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYVSNLLKD 432
                                                  S+IIFV+T++    +   LK+
Sbjct: 347 --------------------------------------GSSIIFVATKNTANLLYGKLKN 368

Query: 433 CGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSLP---- 488
            G+ VS L+G L    R + + +FR G + +L+ T+V ARG+DIP ++ VVN  LP    
Sbjct: 369 EGHQVSILHGDLQTQDRDRLIDDFREGKSKVLITTNVLARGIDIPTVSMVVNYDLPTTKN 428

Query: 489 --ASSKIFVHRVGRTARAGNKGWAYT 512
             A    ++HR+GRT R G  G A +
Sbjct: 429 GQADPATYIHRIGRTGRFGRTGVAIS 454

>TPHA0N00940 Chr14 (202770..205085) [2316 bp, 771 aa] {ON} Anc_5.241
           YJL033W
          Length = 771

 Score =  149 bits (377), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 81/196 (41%), Positives = 126/196 (64%), Gaps = 4/196 (2%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKL--KM 184
           LS   +  ++   F + T IQR +IP+ L+  DI+G A+TGSGKT AF++P++EKL  + 
Sbjct: 48  LSSATVKGLNEASFVKVTEIQRDSIPISLKGHDILGAAKTGSGKTLAFLIPVLEKLYREK 107

Query: 185 HSAKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVI 244
            S   G  A+I+SP+RELAMQT++V  +    ++  + L+ GG  ++ + S  +S  +++
Sbjct: 108 WSEFDGLGALIISPTRELAMQTYEVLTKIGTHTSFSAGLVIGGKDVKFE-SARISKINIL 166

Query: 245 IATPGRFL-HLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSA 303
           I TPGR L H+   + L   +++ +V DEADR  +MGFQ+ L+ ++ +LP  RQTLLFSA
Sbjct: 167 IGTPGRILQHMDQAVGLSTSNLQMLVLDEADRCLDMGFQKTLDAIVSNLPPTRQTLLFSA 226

Query: 304 TLPSSLVDFAKAGLTN 319
           T   SL D A+  LT+
Sbjct: 227 TQSQSLTDLARLSLTD 242

 Score = 68.6 bits (166), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 50/97 (51%), Gaps = 2/97 (2%)

Query: 414 IIFVSTRHHVEYVSNLLKDC--GYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAA 471
           I+F+S+   V +V    +    G  + +L+G   Q AR + L  F       L  TDV A
Sbjct: 295 IVFLSSSKQVHFVYETFRKMQPGISLMHLHGRQKQRARTETLDKFSRAQQVCLFATDVVA 354

Query: 472 RGVDIPLLANVVNMSLPASSKIFVHRVGRTARAGNKG 508
           RG+D P +  VV +  P     ++HRVGR+AR G +G
Sbjct: 355 RGIDFPSVDWVVQLDCPEDVDTYIHRVGRSARYGKQG 391

>TDEL0F05260 Chr6 complement(983324..985291) [1968 bp, 655 aa] {ON}
           Anc_8.402 YDR194C
          Length = 655

 Score =  148 bits (374), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 119/413 (28%), Positives = 194/413 (46%), Gaps = 79/413 (19%)

Query: 127 LSKFILGNISRKGFRQPTPIQRKTIPLILQ--QRDIVGMARTGSGKTAAFVLPLIEKL-- 182
           L K +  +ISR  F   T +Q+KTI  I+Q  ++D++  A+TG+GKT AF++P+ + L  
Sbjct: 105 LDKTLHKSISRMNFTGLTSVQQKTIKPIVQSEEQDVIARAKTGTGKTFAFLIPIFQHLIN 164

Query: 183 KMHSAKIGARAMILSPSRELAMQ----THKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMM 238
               ++   + +I++P+R+LA+Q     HK+ +          V L GG         M 
Sbjct: 165 TRRDSQYMVKCVIVAPTRDLALQIETEVHKIHEHNYALKKFGCVSLVGGTNFGSAMRKMS 224

Query: 239 S-NPDVIIATPGRFLHLKVEMNLDLHS------IEYVVFDEADRLFEMGFQEQ------- 284
           S  P+++IATPGR + +     LD ++      +++ + DEADRL E+GF+E        
Sbjct: 225 SVRPNIVIATPGRLMAV-----LDQYADRYFKFVDFKILDEADRLLEIGFKEDLESISDT 279

Query: 285 LNELLGSLPTARQTLLFSATLPSSLVDFAKAGLTNPVLVRLDT----ETKVSENLEMLFL 340
           LNE+    P   +TLLFSATL   +   A   +     V LDT    E +  E +E    
Sbjct: 280 LNEINDKSPDHIRTLLFSATLDDKVQKLASKIMNKDECVFLDTVDKNEPEAHEKIEQ--- 336

Query: 341 SVKNDEREANLLYLLQEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQP 400
           S+   ER A+ +Y   + IK  + +E                                  
Sbjct: 337 SMVISERMAHSIYAAVDHIKQKMVSE---------------------------------- 362

Query: 401 LPSAKDMPSPNSTIIFVSTRHHVEYVSNLLK---DCGYLVSYLYGTLDQHARRQQLHNFR 457
            P+ K        I+F  T     ++S +L+        V   +G +DQ  R   ++ F+
Sbjct: 363 -PNYK-------AILFTPTVKFTRFLSAILRRELRSKLPVLEFHGQIDQRRRTNLVNQFK 414

Query: 458 CGLTNILVVTDVAARGVDIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWA 510
              + +LV TDV ARG+D P +  V+ + +P+    ++HR+GRTAR G +G +
Sbjct: 415 RDKSGLLVCTDVGARGMDFPNVTEVLQIGVPSELANYIHRIGRTARGGQEGSS 467

>Kwal_23.3235 s23 (209691..211721) [2031 bp, 676 aa] {ON} YDR194C
           (MSS116) - Mitochondrial DEAD box RNA helicase [contig
           250] FULL
          Length = 676

 Score =  149 bits (375), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 110/396 (27%), Positives = 186/396 (46%), Gaps = 62/396 (15%)

Query: 135 ISRKGFRQPTPIQRKTI-PLILQQRDIVGMARTGSGKTAAFVLPLIEKL---KMHSAKIG 190
           +SR  F   TP+Q+KT+ P++  + D++  A+TG+GKT AF++P+ E L   ++ S  + 
Sbjct: 119 VSRMNFESLTPVQQKTMKPILATEHDVIARAKTGTGKTLAFLVPIFEHLIKTRVESPYM- 177

Query: 191 ARAMILSPSRELAMQTHKVFKEFAKGS----NLRSVLLTGGDGLEDQFSMMM-SNPDVII 245
            + +I++P+R+LA+Q      +  K +      +S+ L GG   +     M    P++++
Sbjct: 178 VKCVIVAPTRDLALQIDSEVAKLHKNNYALKKFKSIALIGGSNFQAAIKRMFKERPNIVV 237

Query: 246 ATPGRFLHLKVEMNLDLHS-IEYVVFDEADRLFEMGFQEQLNELLGSL-------PTARQ 297
           ATPGR + +  + + +    +++ V DEADRL E+GF E L E+  +L       P   +
Sbjct: 238 ATPGRLMDVMSKFSHEFFKHVDFKVLDEADRLLEIGFDEDLREISKNLSSINAAGPEHIR 297

Query: 298 TLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKVS-ENLEMLFLSVKNDEREANLLYLLQ 356
           TLLFSATL  ++   A   +     + LDT  K   E  E +  S+   +  A+ +Y   
Sbjct: 298 TLLFSATLGDNVQKLASGIMDRKQCLFLDTVDKNEPEAHERIEQSLVISDTFAHNMYAPI 357

Query: 357 EVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIF 416
             IK  +A  ++                                         P   I+F
Sbjct: 358 SAIKDRIAENDK-----------------------------------------PFKAILF 376

Query: 417 VSTRHHVEYVSNLLKDC--GYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGV 474
           V T    ++  ++L+       V   +G +DQ  R + +  F+     I V TDV ARG+
Sbjct: 377 VPTVKFTKFYCSVLERLFPSLPVYEFHGKIDQRKRTKMVQLFKRAHEGIFVCTDVGARGM 436

Query: 475 DIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWA 510
           D P +  V  + +P+    ++HR+GRTAR G  G A
Sbjct: 437 DFPDVEEVYQLGVPSELSNYIHRIGRTARGGKDGKA 472

>KLTH0F08382g Chr6 (724794..726767) [1974 bp, 657 aa] {ON} similar
           to uniprot|P15424 Saccharomyces cerevisiae YDR194C
           MSS116 DEAD-box protein required for efficient splicing
           of mitochondrial Group I and II introns presumed RNA
           helicase due to DEAD-box motif
          Length = 657

 Score =  148 bits (373), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 111/399 (27%), Positives = 189/399 (47%), Gaps = 68/399 (17%)

Query: 135 ISRKGFRQPTPIQRKTI-PLILQQRDIVGMARTGSGKTAAFVLPLIEKL---KMHSAKIG 190
           +SR  F   TP+Q+KTI P++  + D++  A+TG+GKT AF++P+ E L   +  S  + 
Sbjct: 118 VSRMNFESLTPVQQKTIKPILETEHDVIARAKTGTGKTLAFLVPIFEHLIKTRTESPSM- 176

Query: 191 ARAMILSPSRELAMQTHKVFKEFAKGSN----LRSVLLTGGDGLEDQFSMMMSN-PDVII 245
            + +I++P+R+LA+Q     ++  K ++     +S+ L GG   +     M  + P++++
Sbjct: 177 VKCVIVAPTRDLALQIDSEIEKLHKNNHALRKFKSIALIGGSNFQVAIKRMFKDTPNIVV 236

Query: 246 ATPGRFLHLKVEMNLDLHS-IEYVVFDEADRLFEMGFQEQLNELLGSL-------PTARQ 297
           ATPGR + +  + +      +++ V DEADRL E+GF E L ++  +L       P   +
Sbjct: 237 ATPGRLMDVMSKFSDKFFKHVDFKVLDEADRLLEIGFDEDLRDISKTLNSINATGPEHIR 296

Query: 298 TLLFSATLPSSLVDFAKAGLTNPVLVRLDT----ETKVSENLEMLFLSVKNDEREANLLY 353
           TLLFSATL  ++   A   +     + LDT    E +  E ++   +  +N    A+ LY
Sbjct: 297 TLLFSATLGDNVQKLAAGIMNRKESLFLDTVDVNEPEAHEKIDQRLVISEN---FASNLY 353

Query: 354 LLQEVIKIPVATEEQLQRFRXXXXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNST 413
                IK  +AT  +                                         P   
Sbjct: 354 APISAIKNRLATNNE-----------------------------------------PFKA 372

Query: 414 IIFVSTRHHVEYVSNLLKDC--GYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAA 471
           I+FV T    ++   +L+       V   +G +DQ  R + +  F+     I V TDV A
Sbjct: 373 ILFVPTVKFTKFYCTILERLFPSLPVYEFHGKIDQRKRTKMVGLFKRAHEGIFVCTDVGA 432

Query: 472 RGVDIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWA 510
           RG+D P +  V+ + +P+    ++HR+GRTAR G +G A
Sbjct: 433 RGMDFPGVEEVLQLGVPSELSNYIHRIGRTARGGKEGKA 471

>Ecym_5488 Chr5 (998651..1000099) [1449 bp, 482 aa] {ON} similar to
           Ashbya gossypii ACR078W
          Length = 482

 Score =  145 bits (366), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 107/383 (27%), Positives = 185/383 (48%), Gaps = 66/383 (17%)

Query: 140 FRQPTPIQRKTIPLILQQ--RDIVGMARTGSGKTAAFVLPLIEKLKMHSAKIGA-RAMIL 196
           F++P+ IQ + +PL+L    R+++  +++G+GKTAAF L ++ ++     K+ A +A+ L
Sbjct: 113 FQKPSKIQERALPLLLHNPPRNMIAQSQSGTGKTAAFSLTMLSRV---DPKVDATQAICL 169

Query: 197 SPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIATPGRFLHLKV 256
           +PSRELA QT +V +E  K +N+ + ++   D  E   ++      +I+ TPG  L L  
Sbjct: 170 APSRELARQTLEVVQEMGKYTNISTQVIV-PDSYEKNKAI---KSHIIVGTPGTVLDLMR 225

Query: 257 EMNLDLHSIEYVVFDEADRLFE-MGFQEQLNELLGSLPTARQTLLFSATLPSSLVDFAKA 315
              + L +++  V DEAD + +  G  +Q   +   LP   Q +LFSAT   S+ ++A+ 
Sbjct: 226 RKMIQLGTVKVFVLDEADNMLDKQGLGDQCIRVKKFLPKDCQLVLFSATFDDSVRNYARR 285

Query: 316 GLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVATEEQLQRFRXX 375
            + +   + L+      E +  LF+   +++ +  +L  L  ++ I              
Sbjct: 286 VVPDANSLELERNEVNVEAIRQLFMDCNDEKHKFQVLCDLYGLMTI-------------- 331

Query: 376 XXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYVSNLLKDCGY 435
                                               S+IIFV T+     +   LK  G+
Sbjct: 332 -----------------------------------GSSIIFVQTKQTANMLYAELKKEGH 356

Query: 436 LVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSLPASS---- 491
            VS L+G L    R + + +FR G + +L+ T+V ARG+DIP ++ VVN  LP ++    
Sbjct: 357 QVSILHGDLQTSDRDKLIDDFREGRSKVLITTNVLARGIDIPTVSMVVNYDLPVTANGQP 416

Query: 492 --KIFVHRVGRTARAGNKGWAYT 512
               +VHR+GRT R G  G A +
Sbjct: 417 DPSTYVHRIGRTGRFGRTGVAIS 439

>SAKL0G01496g Chr7 (125044..125050,125133..126568) [1443 bp, 480 aa]
           {ON} similar to uniprot|P20449 Saccharomyces cerevisiae
           YOR046C DBP5 Cytoplasmic ATP-dependent RNA helicase of
           the DEAD-box family involved in mRNA export from the
           nucleus
          Length = 480

 Score =  145 bits (365), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 106/383 (27%), Positives = 181/383 (47%), Gaps = 66/383 (17%)

Query: 140 FRQPTPIQRKTIPLILQQ--RDIVGMARTGSGKTAAFVLPLIEKLKMHSAKIGARAMILS 197
           F++P+ IQ + +PL+L    R+++  +++G+GKTAAF L ++ ++     K   +A+ L+
Sbjct: 111 FQKPSKIQERALPLLLHNPPRNMIAQSQSGTGKTAAFSLTMLSRVDPALNK--TQAICLA 168

Query: 198 PSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMS-NPDVIIATPGRFLHLKV 256
           P+RELA QT +V +E  K + + + L+     + D F      N  +I+ TPG  L L  
Sbjct: 169 PARELARQTLEVIQEMGKFTKISTQLV-----VPDSFKKNEPINAQIIVGTPGTVLDLMR 223

Query: 257 EMNLDLHSIEYVVFDEADRLFE-MGFQEQLNELLGSLPTARQTLLFSATLPSSLVDFAKA 315
              L L +++  V DEAD + +  G  +Q   +   LP + Q +LFSAT   S+  +A+ 
Sbjct: 224 RKMLQLGNVKVFVLDEADNMLDKQGLGDQCIRVKKFLPKSTQLVLFSATFDDSVRAYARK 283

Query: 316 GLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVATEEQLQRFRXX 375
            + +   + L       E ++ L++   +++ +  +L  L  ++ I              
Sbjct: 284 VVPDANSLELQKNEVNVEAIKQLYMDCNDEKHKFEVLSELYGLLTI-------------- 329

Query: 376 XXXXXXXXXXXXXXXXXXXXXXXQPLPSAKDMPSPNSTIIFVSTRHHVEYVSNLLKDCGY 435
                                               S+IIFV T+     +   LK  G+
Sbjct: 330 -----------------------------------GSSIIFVQTKQTANVLYAKLKQEGH 354

Query: 436 LVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSLP------A 489
            VS L+G L    R + + +FR G + +L+ T+V ARG+DIP ++ VVN  LP      A
Sbjct: 355 QVSILHGDLQSTERDRLIDDFREGRSKVLITTNVLARGIDIPTVSMVVNYDLPTLHNGKA 414

Query: 490 SSKIFVHRVGRTARAGNKGWAYT 512
               ++HR+GRT R G  G A +
Sbjct: 415 DPSTYIHRIGRTGRFGRTGVAIS 437

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.132    0.370 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 87,107,190
Number of extensions: 3601815
Number of successful extensions: 13709
Number of sequences better than 10.0: 594
Number of HSP's gapped: 12770
Number of HSP's successfully gapped: 1080
Length of query: 960
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 841
Effective length of database: 39,836,145
Effective search space: 33502197945
Effective search space used: 33502197945
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 71 (32.0 bits)