Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AEL085W3.160ON52752728350.0
Ecym_35493.160ON53253214930.0
SAKL0C08800g3.160ON60153212721e-169
KLTH0C08888g3.160ON50653310701e-140
TDEL0D046203.160ON51653610241e-133
Kwal_56.227993.160ON53153110121e-131
Skud_4.2213.160ON5315469681e-125
ZYRO0B04950g3.160ON5065369511e-122
NDAI0G028903.160ON5365419441e-121
Smik_4.2053.160ON5315469311e-119
YDL030W (PRP9)3.160ON5305439301e-119
TPHA0A009103.160ON5275399231e-118
KAFR0C010503.160ON5065339171e-117
NCAS0C035403.160ON5185349181e-117
Kpol_479.263.160ON5175408881e-113
Suva_4.2193.160ON5315408841e-112
KLLA0F24662g3.160ON5305388421e-106
KNAG0K011203.160ON5275478011e-100
CAGL0K01573g3.160ON5165457572e-93
TBLA0B016003.160ON4863081688e-12
KLTH0G19096g8.11ON15954790.18
CAGL0K12804g8.11ON17249760.53
SAKL0F16214g7.545ON15766711.7
Ecym_15318.11ON17149721.9
TPHA0F026306.75ON126280723.5
CAGL0H02387g8.813ON111497723.8
NCAS0A093301.295ON122767714.7
Kwal_14.10648.11ON16254685.1
KLLA0B02673g4.282ON441107705.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AEL085W
         (527 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AEL085W Chr5 (467583..469166) [1584 bp, 527 aa] {ON} Syntenic ho...  1096   0.0  
Ecym_3549 Chr3 complement(1038111..1039709) [1599 bp, 532 aa] {O...   579   0.0  
SAKL0C08800g Chr3 (807712..809517) [1806 bp, 601 aa] {ON} simila...   494   e-169
KLTH0C08888g Chr3 (745663..747183) [1521 bp, 506 aa] {ON} simila...   416   e-140
TDEL0D04620 Chr4 complement(847509..849059) [1551 bp, 516 aa] {O...   399   e-133
Kwal_56.22799 s56 complement(284859..286454) [1596 bp, 531 aa] {...   394   e-131
Skud_4.221 Chr4 (392347..393942) [1596 bp, 531 aa] {ON} YDL030W ...   377   e-125
ZYRO0B04950g Chr2 complement(399973..401493) [1521 bp, 506 aa] {...   370   e-122
NDAI0G02890 Chr7 (669498..671108) [1611 bp, 536 aa] {ON} Anc_3.1...   368   e-121
Smik_4.205 Chr4 (377655..379250) [1596 bp, 531 aa] {ON} YDL030W ...   363   e-119
YDL030W Chr4 (397537..399129) [1593 bp, 530 aa] {ON}  PRP9Subuni...   362   e-119
TPHA0A00910 Chr1 (179145..180728) [1584 bp, 527 aa] {ON} Anc_3.1...   360   e-118
KAFR0C01050 Chr3 complement(214128..215648) [1521 bp, 506 aa] {O...   357   e-117
NCAS0C03540 Chr3 (707075..708631) [1557 bp, 518 aa] {ON} Anc_3.1...   358   e-117
Kpol_479.26 s479 complement(50993..52546) [1554 bp, 517 aa] {ON}...   346   e-113
Suva_4.219 Chr4 (387976..389571) [1596 bp, 531 aa] {ON} YDL030W ...   345   e-112
KLLA0F24662g Chr6 complement(2292807..2294399) [1593 bp, 530 aa]...   328   e-106
KNAG0K01120 Chr11 (218749..220332) [1584 bp, 527 aa] {ON} Anc_3....   313   e-100
CAGL0K01573g Chr11 (139809..141359) [1551 bp, 516 aa] {ON} simil...   296   2e-93
TBLA0B01600 Chr2 (352382..353842) [1461 bp, 486 aa] {ON} Anc_3.1...    69   8e-12
KLTH0G19096g Chr7 complement(1649335..1649814) [480 bp, 159 aa] ...    35   0.18 
CAGL0K12804g Chr11 complement(1269506..1270024) [519 bp, 172 aa]...    34   0.53 
SAKL0F16214g Chr6 complement(1312909..1313382) [474 bp, 157 aa] ...    32   1.7  
Ecym_1531 Chr1 complement(1094489..1095004) [516 bp, 171 aa] {ON...    32   1.9  
TPHA0F02630 Chr6 complement(583511..587299) [3789 bp, 1262 aa] {...    32   3.5  
CAGL0H02387g Chr8 (212116..215460) [3345 bp, 1114 aa] {ON} simil...    32   3.8  
NCAS0A09330 Chr1 (1844122..1847805) [3684 bp, 1227 aa] {ON} Anc_...    32   4.7  
Kwal_14.1064 s14 (178979..179467) [489 bp, 162 aa] {ON} YLR074C ...    31   5.1  
KLLA0B02673g Chr2 (235478..236803) [1326 bp, 441 aa] {ON} simila...    32   5.9  

>AEL085W Chr5 (467583..469166) [1584 bp, 527 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL030W (PRP9)
          Length = 527

 Score = 1096 bits (2835), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 527/527 (100%), Positives = 527/527 (100%)

Query: 1   MSSLEEKRAILEELEVIEGAISARIERNPEIYYSYLKELQLVNPDEKVLDNISKDDINSN 60
           MSSLEEKRAILEELEVIEGAISARIERNPEIYYSYLKELQLVNPDEKVLDNISKDDINSN
Sbjct: 1   MSSLEEKRAILEELEVIEGAISARIERNPEIYYSYLKELQLVNPDEKVLDNISKDDINSN 60

Query: 61  RIYVNKKARRSRKQLILQQHEIARFLQRYWKQVKRLNAFKSDDIESLRDPNMNFETFEAD 120
           RIYVNKKARRSRKQLILQQHEIARFLQRYWKQVKRLNAFKSDDIESLRDPNMNFETFEAD
Sbjct: 61  RIYVNKKARRSRKQLILQQHEIARFLQRYWKQVKRLNAFKSDDIESLRDPNMNFETFEAD 120

Query: 121 IKELQERQAEGADSESAISSLERKRREYSMFSASSGADQTILSNVGQFIDVNKLFMWEEH 180
           IKELQERQAEGADSESAISSLERKRREYSMFSASSGADQTILSNVGQFIDVNKLFMWEEH
Sbjct: 121 IKELQERQAEGADSESAISSLERKRREYSMFSASSGADQTILSNVGQFIDVNKLFMWEEH 180

Query: 181 YGEYLFLERLHQDWLNVVKDGSVTLLQFIAFLESFAGTGYLTAPPVDRNSKRYQVFIQKL 240
           YGEYLFLERLHQDWLNVVKDGSVTLLQFIAFLESFAGTGYLTAPPVDRNSKRYQVFIQKL
Sbjct: 181 YGEYLFLERLHQDWLNVVKDGSVTLLQFIAFLESFAGTGYLTAPPVDRNSKRYQVFIQKL 240

Query: 241 VTYLEGAFRNTYPLLNHRLLENRISQSFESYIANPVEDPPRGLLCIACGKHFKVGTVFAG 300
           VTYLEGAFRNTYPLLNHRLLENRISQSFESYIANPVEDPPRGLLCIACGKHFKVGTVFAG
Sbjct: 241 VTYLEGAFRNTYPLLNHRLLENRISQSFESYIANPVEDPPRGLLCIACGKHFKVGTVFAG 300

Query: 301 HLLGKKHAQSVTTKVATLRAEHTLHYLVIYLATSIENTRALVERKYAFTSGERNREMATI 360
           HLLGKKHAQSVTTKVATLRAEHTLHYLVIYLATSIENTRALVERKYAFTSGERNREMATI
Sbjct: 301 HLLGKKHAQSVTTKVATLRAEHTLHYLVIYLATSIENTRALVERKYAFTSGERNREMATI 360

Query: 361 RDAYDAPAYSSGEPEDVIETPQQQQNAHPDDVNPLNLPLGPMGYPIPYWLYKLQGLDIEY 420
           RDAYDAPAYSSGEPEDVIETPQQQQNAHPDDVNPLNLPLGPMGYPIPYWLYKLQGLDIEY
Sbjct: 361 RDAYDAPAYSSGEPEDVIETPQQQQNAHPDDVNPLNLPLGPMGYPIPYWLYKLQGLDIEY 420

Query: 421 ACEICANHVYKGRRISNAIFRTAPCYGLRCLGIEPSPAFKDIYNIAEAQQLFQSLQSSTG 480
           ACEICANHVYKGRRISNAIFRTAPCYGLRCLGIEPSPAFKDIYNIAEAQQLFQSLQSSTG
Sbjct: 421 ACEICANHVYKGRRISNAIFRTAPCYGLRCLGIEPSPAFKDIYNIAEAQQLFQSLQSSTG 480

Query: 481 PAGLATRRAGAISSSANTRKLEVEVEDEDGNVMTHQVYEDLKKQGLL 527
           PAGLATRRAGAISSSANTRKLEVEVEDEDGNVMTHQVYEDLKKQGLL
Sbjct: 481 PAGLATRRAGAISSSANTRKLEVEVEDEDGNVMTHQVYEDLKKQGLL 527

>Ecym_3549 Chr3 complement(1038111..1039709) [1599 bp, 532 aa] {ON}
           similar to Ashbya gossypii AEL085W
          Length = 532

 Score =  579 bits (1493), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/532 (53%), Positives = 375/532 (70%), Gaps = 5/532 (0%)

Query: 1   MSSLEEKRAILEELEVIEGAISARIERNPEIYYSYLKELQLVNPDEKVLDNISKDDINSN 60
           MS LEEKRAILEELE+IE AIS RI RNPE++YSY+ EL +VN DEKVL NI   DI +N
Sbjct: 1   MSLLEEKRAILEELELIEDAISDRIARNPEVFYSYIHELSIVNSDEKVLSNIPNVDITAN 60

Query: 61  RIYVNKKARRSRKQLILQQHEIARFLQRYWKQVKRLNAFKSDDIESLRDPNMNFETFEAD 120
           R+Y+ KK++RSRKQ++LQQHEI++FL  Y K VK+LN +K+D+++  +D N NFE F   
Sbjct: 61  RVYMIKKSKRSRKQILLQQHEISKFLSYYLKNVKKLNGYKNDNVDEFKDHNQNFELFRDQ 120

Query: 121 IKELQERQAEGADSESAISSLERKRREYSMFSASSGADQTILSNVGQFIDVNKLFMWEEH 180
           I+ ++E+ AE ++SE+  +SLE ++ +Y+MFS S+   + ILS  GQ ID+NK F WEEH
Sbjct: 121 IQRIKEKYAEESNSEAFDASLEARKYQYTMFSNSNHQKKDILSLEGQSIDINKKFSWEEH 180

Query: 181 YGEYLFLERLHQDWLNVVKDGSVTLLQFIAFLESFAGTGYLTAPPVDRNSKRYQVFIQKL 240
           YGEYL L++ HQ++LN+VK+ +V+LLQFI FL++F   G+L  PPVDRNSK Y  F+++L
Sbjct: 181 YGEYLHLDQYHQEYLNIVKNANVSLLQFIGFLQTFCDHGHLKNPPVDRNSKIYHGFLERL 240

Query: 241 VTYLEGAFRNTYPLLNHRLLENRISQSFESYIANPVEDPPRGLLCIACGKHFKVGTVFAG 300
           + Y+   F + +PL+NH   + RI  SF  Y + P+ED  RG LC+ACGK FK  TV+  
Sbjct: 241 LKYVNSFFESAFPLINHVQFQKRIKNSFVEYTSTPIEDSSRGCLCVACGKWFKAITVYTS 300

Query: 301 HLLGKKHAQSVTTKVATLRAEHTLHYLVIYLATSIENTRALVERKYAFTSGERNREMATI 360
           HL G+KH  ++  +  +L  E+TL  L   L   + +T++ VERKYAFT  ER +E+A +
Sbjct: 301 HLQGRKHLNNLKCRRRSLMVEYTLQNLFTCLNKELVSTKSFVERKYAFTVEERIQELAKL 360

Query: 361 RDAYDAPAYSSGEPEDVIE--TPQQQQNAHPDDVNPLNLPLGPMGYPIPYWLYKLQGLDI 418
           RDAY+A AY   E ED  E  +    +   PDD NPLNLPLGP GYPIPYWLYKLQGLDI
Sbjct: 361 RDAYNANAYGDHEREDSQEDLSVSSSKETPPDDNNPLNLPLGPDGYPIPYWLYKLQGLDI 420

Query: 419 EYACEICANHVYKGRRISNAIFRTA-PCYGLRCLGIEPSPAFKDIYNIAEAQQLFQSLQS 477
           EY CEIC NH+YKGRR+    F      YGLRCLGIEP+  FK I  I++AQ L+  L++
Sbjct: 421 EYTCEICGNHLYKGRRVFERHFHEQRHTYGLRCLGIEPTSTFKGISKISDAQILWSRLKN 480

Query: 478 STGPAGLATRRAGAISSSA--NTRKLEVEVEDEDGNVMTHQVYEDLKKQGLL 527
           ++     +     A SS A     KLE+E+EDEDGNVM+H+VYEDLKKQGLL
Sbjct: 481 NSHLNSASATYPDATSSRAVVTNNKLEIEMEDEDGNVMSHRVYEDLKKQGLL 532

>SAKL0C08800g Chr3 (807712..809517) [1806 bp, 601 aa] {ON} similar
           to uniprot|P19736 Saccharomyces cerevisiae YDL030W PRP9
           Subunit of the SF3a splicing factor complex required for
           spliceosome assembly
          Length = 601

 Score =  494 bits (1272), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 260/532 (48%), Positives = 349/532 (65%), Gaps = 9/532 (1%)

Query: 1   MSSLEEKRAILEELEVIEGAISARIERNPEIYYSYLKELQLVNPDEK-VLDNISKDDINS 59
           M  LE KR++LE LEVIE AIS RI RNPE+YYSY +E +LV+ +   +L  +   DI++
Sbjct: 74  MEILEAKRSVLERLEVIENAISERIRRNPELYYSYYEEQRLVDKENHGLLPPVPASDISA 133

Query: 60  NRIYVNKKARRSRKQLILQQHEIARFLQRYWKQVKRLNAFKSDDIESLRDPNMNFETFEA 119
           NRI+  KK+RRSRKQ++LQQHEI RFL+ Y ++V RL+  K D  +S      +FE  E 
Sbjct: 134 NRIHSVKKSRRSRKQIVLQQHEIDRFLEEYQREVARLHGIKLDKDDS-ESAAPDFEQLEK 192

Query: 120 DIKELQERQAEGADSESAISSLERKRREYSMFSASSGADQTILSNVGQFIDVNKLFMWEE 179
            +K+ + R A   D    ++ ++ +  E+SMFS+S+   + ILS  G+ +D+N+LF  +E
Sbjct: 193 AVKDAKSRYA---DESRTLAGVDVESVEHSMFSSSTSTHKDILSTRGRDLDMNRLFARDE 249

Query: 180 HYGEYLFLERLHQDWLNVVKDGSVTLLQFIAFLESFAGTGYLTAPPVDRNSKRYQVFIQK 239
           HYGE+L LE  H +WLN+VKDGSVT LQF+  +E F    YL AP V+R SK+YQ F+  
Sbjct: 250 HYGEFLLLEPFHHEWLNIVKDGSVTALQFMNVVEMFVSDAYLVAPAVNRGSKKYQDFVGS 309

Query: 240 LVTYLEGAFRNTYPLLNHRLLENRISQSFESYIANPVEDPPRGLLCIACGKHFKVGTVFA 299
           L+ Y+   FR TYPL+NH  L  R++  F+ Y+  PV D  +GL CI CG+ FK+ TV+ 
Sbjct: 310 LLGYMSEFFRKTYPLVNHSTLGRRLAALFDEYLRAPVADETKGLFCIPCGRWFKLETVYK 369

Query: 300 GHLLGKKHAQSVTTKVATLRAEHTLHYLVIYLATSIENTRALVERKYAFTSGERNREMAT 359
            HL GKKH++++      L AE+ LH     L  +I NTRA VER  A T+ ER +E+  
Sbjct: 370 SHLSGKKHSKNLAKGDGHLLAEYKLHKYCGLLVQTIANTRAFVERNRALTADERAQELER 429

Query: 360 IRDAYDAPAYSSGEPEDVIETPQQQQNAHPDD-VNPLNLPLGPMGYPIPYWLYKLQGLDI 418
           +   Y+APAYS  E ED     QQ++    D+  NP NLPLGP GYPIPYWLYKLQGLDI
Sbjct: 430 LAKEYEAPAYSQHETEDAAREKQQKREPETDEGGNPFNLPLGPDGYPIPYWLYKLQGLDI 489

Query: 419 EYACEICANHVYKGRRISNAIFRTA-PCYGLRCLGIEPSPAFKDIYNIAEAQQLFQSLQS 477
           EY+CEIC+NH YKGRR     F  A   +GLRCLGIEPS  FK I  I EA+ L+  +Q+
Sbjct: 490 EYSCEICSNHTYKGRRYFEKHFSEARHIFGLRCLGIEPSATFKGITKIQEAKDLWARIQT 549

Query: 478 S--TGPAGLATRRAGAISSSANTRKLEVEVEDEDGNVMTHQVYEDLKKQGLL 527
           S  TG    A   A   +++ +T KLE+EVEDE+GNVM+ ++Y +LK+QGLL
Sbjct: 550 SVATGVGAGAIASAATAAATPSTAKLEIEVEDEEGNVMSEKLYHELKRQGLL 601

>KLTH0C08888g Chr3 (745663..747183) [1521 bp, 506 aa] {ON} similar
           to uniprot|P19736 Saccharomyces cerevisiae YDL030W PRP9
           Subunit of the SF3a splicing factor complex required for
           spliceosome assembly
          Length = 506

 Score =  416 bits (1070), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 229/533 (42%), Positives = 317/533 (59%), Gaps = 33/533 (6%)

Query: 1   MSSLEEKRAILEELEVIEGAISARIERNPEIYYSYLKELQLVNPDEKVLDNISKDDINSN 60
           M + E+ RA LEELE+IE A+++R+ RNPEI+Y  + E+ LV    +  D+I     ++N
Sbjct: 1   MKTYEDARATLEELELIENAVTSRLRRNPEIFYRNIDEVDLVEHSGR-FDHIPSSQKSAN 59

Query: 61  RIYVNKKARRSRKQLILQQHEIARFLQRYWKQVKRLNAFKSDDIESLRDP---NMNFETF 117
           ++Y  KK+RRSRKQ++ Q+HEI  FL +Y K  + L   + D  E   D    N   E  
Sbjct: 60  KVYTVKKSRRSRKQILAQEHEIKSFLSQYLKDCQSLGRVEFDMSEYRVDNGSVNKLLEHI 119

Query: 118 EADIKELQERQAEGADSESAISSLERKRREYSMFSASSGADQTILSNVGQFIDVNKLFMW 177
           E  IKE+  +  E  D             +Y+MFS+S+ +++ I+S   Q +D+N  F  
Sbjct: 120 ER-IKEIHPKDDEFGD-------------QYAMFSSSTPSNKNIISRKAQNLDINSYFTR 165

Query: 178 EEHYGEYLFLERLHQDWLNVVKDGSVTLLQFIAFLESFAGTGYLTAPPVDRNSKRYQVFI 237
           +E YGEYL LE  HQ WL+VVK+G VTLLQF++ +E F    YL  P V+RNS RY+ F+
Sbjct: 166 DEQYGEYLDLEPFHQKWLSVVKNGDVTLLQFLSEVEKFTDQRYLLQPAVNRNSSRYREFV 225

Query: 238 QKLVTYLEGAFRNTYPLLNHRLLENRISQSFESYIANPVEDPPRGLLCIACGKHFKVGTV 297
             L  YL       YPLL+  L+  +  + + + +A P+     G+ CI C K FK  TV
Sbjct: 226 ASLHHYLSDYAARAYPLLSWDLIHAKAQELYHTNVAKPIPSGESGVFCIPCDKRFKTDTV 285

Query: 298 FAGHLLGKKHAQSVTTKVATLRAEHTLHYLVIYLATSIENTRALVERKYAFTSGERNREM 357
           +  HL GK+H  ++    + L  EH+LH    YL+  +  TR  VERK AFT+ ER +E+
Sbjct: 286 YNAHLPGKRHVGNLHKNSSFLTQEHSLHIFCRYLSRELARTREFVERKLAFTTEERTQEL 345

Query: 358 ATIRDAYDAPAYSSGEPEDVIETPQQQQNAHPDDV--NPLNLPLGPMGYPIPYWLYKLQG 415
             + D YD+P Y   E ED  E   ++     D V  + +NLPLGP G+PIPYWLYKLQG
Sbjct: 346 ERLTDIYDSPVYGRQEQEDAQEDENKETEDKEDSVLDSSMNLPLGPDGFPIPYWLYKLQG 405

Query: 416 LDIEYACEICANHVYKGRRISNAIF-RTAPCYGLRCLGIEPSPAFKDIYNIAEAQQLFQS 474
           LDIEY CE+C N VY GRR  +  F      +GLR LGIEPS +FK +  I +A+QL+  
Sbjct: 406 LDIEYPCELCGNFVYNGRRQFDKHFGEQRHVFGLRRLGIEPSASFKGVTKIDDAKQLWSH 465

Query: 475 LQSSTGPAGLATRRAGAISSSANTRKLEVEVEDEDGNVMTHQVYEDLKKQGLL 527
           L+S++         +G +SS     KLEVEVEDEDGNVM+ +VY++LKKQGLL
Sbjct: 466 LRSTS---------SGRVSSEG---KLEVEVEDEDGNVMSKKVYDELKKQGLL 506

>TDEL0D04620 Chr4 complement(847509..849059) [1551 bp, 516 aa] {ON}
           Anc_3.160 YDL030W
          Length = 516

 Score =  399 bits (1024), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 224/536 (41%), Positives = 317/536 (59%), Gaps = 29/536 (5%)

Query: 1   MSSLEEKRAILEELEVIEGAISARIERNPEIYYSYLKELQLVNPDEKVLDNISKDDINSN 60
           M++LE +R+ LE+LEVIE +I++R ERNP +YY YL++  L+  D+  L +   +  N+N
Sbjct: 1   MNTLESRRSHLEDLEVIEQSIASRFERNPGLYYGYLQKRALI--DDIPLSSSITNAYNAN 58

Query: 61  RIYVNKKARRSRKQLILQQHEIARFLQRYWKQVKRLNAFKSD-DIESLRDPNMNFETFEA 119
           RIY  K+++R+RKQ +LQQHEI  FLQ   ++++ L + K   +  SLRD    FE F+ 
Sbjct: 59  RIYKAKRSKRNRKQFVLQQHEIDLFLQESMRKLRDLGSLKGPVNTHSLRDEEATFEIFKQ 118

Query: 120 DIKELQERQAEGADSESAISSLERKRREYSMFSASSGADQ--TILSNVGQFIDVNKLFMW 177
           +++E++++  +   S+S  S +  +  +++MFSA +   +  TILS   + + +N +F  
Sbjct: 119 NLEEIKDKYKDLG-SDSLFSDVNEEISKHAMFSALTTDSKPVTILSRSAKNLRLNDVFSR 177

Query: 178 EEHYGEYLFLERLHQDWLNVVKDGSVTLLQFIAFLESFAGT-GYLTAPPVDRNSKRYQVF 236
           EE YGEYL L+R H  WLNV++    TLLQF + LE F     Y+ APP+DR + RY  F
Sbjct: 178 EEQYGEYLDLDRFHSSWLNVIRSTECTLLQFYSILEKFLDDRQYILAPPMDRKNGRYAEF 237

Query: 237 IQKLVTYLEGAFRNTYPLLNHRLLENRISQSFESYIANPVEDPPRGLLCIACGKHFKVGT 296
           + ++  YLE  F+    LLNH  LE RI   F   +A P+    +G  CIAC K FKV T
Sbjct: 238 LVEISNYLEKFFQKANVLLNHTKLERRIQSEFSRSLATPLHTGGKGFYCIACCKWFKVPT 297

Query: 297 VFAGHLLGKKHAQSVTTKVATLRAEHTLHYLVIYLATSIENTRALVERKYAFTSGERNRE 356
           VF  HL GK H  +++ +   L+AE+ LH  +  L+     TR   ERK AFT+ ER +E
Sbjct: 298 VFDSHLTGKHHKNNLSKRSKHLQAEYKLHRYLTLLSEEFRRTREFTERKVAFTAEERMQE 357

Query: 357 MATIRDAYDAPAYSSGEPEDVIETPQQQQNAHPDDVNPL----NLPLGPMGYPIPYWLYK 412
           MA +   Y AP Y   E E   E P   + A  D  + L    +LPLG  G PIPYWLYK
Sbjct: 358 MARLNHDYHAPDYGPDEKEQ--EDPDSNK-AELDKNSALGGSFDLPLGADGLPIPYWLYK 414

Query: 413 LQGLDIEYACEICANHVYKGRR-ISNAIFRTAPCYGLRCLGIEPSPAFKDIYNIAEAQQL 471
           LQGLD+EY+CEIC N  YKGRR            + L+CLGIEPS  FK I  I EAQ L
Sbjct: 415 LQGLDVEYSCEICTNQTYKGRRAFEKHFLEPTHTFHLKCLGIEPSITFKGITGIQEAQDL 474

Query: 472 FQSLQSSTGPAGLATRRAGAISSSANTRKLEVEVEDEDGNVMTHQVYEDLKKQGLL 527
           ++   S   P                 +K+++EVED++GNV+T +VY++LKKQGL+
Sbjct: 475 WRQTSSRNRP--------------QTQKKIDLEVEDQEGNVLTQKVYQELKKQGLV 516

>Kwal_56.22799 s56 complement(284859..286454) [1596 bp, 531 aa] {ON}
           YDL030W (PRP9) - RNA splicing factor [contig 184] FULL
          Length = 531

 Score =  394 bits (1012), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 223/531 (41%), Positives = 318/531 (59%), Gaps = 28/531 (5%)

Query: 1   MSSLEEKRAILEELEVIEGAISARIERNPEIYYSYLKELQLVNPDEKVLDNISKDDINSN 60
           M + E  R+ LEELE+IEGAI+AR+ RNPEI+Y  + EL+L+  D KV D+ ++ + NSN
Sbjct: 25  MVTYESSRSTLEELELIEGAIAARLRRNPEIFYRNVDELKLITGDAKV-DDYAEIEKNSN 83

Query: 61  RIYVNKKARRSRKQLILQQHEIARFLQRYWKQVKRLNAFKSDDIESLRDPNMNFETFEAD 120
           +IY  +K +R+RKQ++ Q+HEI  FL+ Y K+ + L   + D    LR   +   + +  
Sbjct: 84  KIYSVRKTKRTRKQILAQEHEIQLFLEEYRKKSESLRNVEFD----LRRYQVTDGSVDGF 139

Query: 121 IKELQERQAEGADSESAISSLERKRREYSMFSASSGADQTILSNVGQFIDVNKLFMWEEH 180
           ++ ++   +E  D       ++     Y+MFS S+ A + ILS   + +D+N  F  EE 
Sbjct: 140 LEHIETINSEVPDD------IDDSMENYTMFSNSTAARRDILSKKARALDINAKFTREEQ 193

Query: 181 YGEYLFLERLHQDWLNVVKDGSVTLLQFIAFLESFAGTGYLTAPPVDRNSKRYQVFIQKL 240
           YGE+L LE  HQ WL+VVKDGSV+LLQF+  +E F    +L  P V+R S RYQ F++ L
Sbjct: 194 YGEFLDLEPFHQQWLSVVKDGSVSLLQFLGEIEKFTTKRFLLTPAVNRGSARYQDFVKAL 253

Query: 241 VTYLEGAFRNTYPLLNHRLLENRISQSFESYIANPVEDPPRGLLCIACGKHFKVGTVFAG 300
           + YL+      YPL +   +   I  ++  Y ++P E    GL CI C K FK  TV+  
Sbjct: 254 LCYLQDYLMRAYPLQDWDKIHAEIQATYCDYKSHPEEAGDSGLFCIPCDKTFKAETVYLA 313

Query: 301 HLLGKKHAQSVTTKVATLRAEHTLHYLVIYLATSIENTRALVERKYAFTSGERNREMATI 360
           HL GKKH  ++  K   L  E+ LH L  YL   +  TR  VERK AFT  ER +EM  +
Sbjct: 314 HLTGKKHINNMNKKDEFLAQEYKLHMLCCYLVQELVRTREFVERKLAFTPEERRQEMERL 373

Query: 361 RDAYDAPAYSSGEPEDVIETPQQQQNAHPDDVNP---LNLPLGPMGYPIPYWLYKLQGLD 417
              Y++P Y   E ED+ E   Q+   + +D  P    +LPLGP G+PIPYWLYKLQGLD
Sbjct: 374 TTVYESPVYGEQEQEDIAEA-DQKPTTNQEDSTPEPSFDLPLGPDGFPIPYWLYKLQGLD 432

Query: 418 IEYACEICANHVYKGRRISNAIF-RTAPCYGLRCLGIEPSPAFKDIYNIAEAQQLFQSLQ 476
           IEY CE+C N +YKGRR  +  F      +GL+ LG++PSP+FK + +I + +QL+  L+
Sbjct: 433 IEYPCEVCGNLIYKGRRQFDKHFTEQRHIFGLKRLGVDPSPSFKGVTSIDDVKQLWAHLR 492

Query: 477 SSTGPAGLATRRAGAISSSANTRKLEVEVEDEDGNVMTHQVYEDLKKQGLL 527
           SS+             +S+A   K E E+EDE+GNVM+ +VYE+LKKQGL+
Sbjct: 493 SSSK------------ASNAAGPKFEEEIEDEEGNVMSKKVYEELKKQGLI 531

>Skud_4.221 Chr4 (392347..393942) [1596 bp, 531 aa] {ON} YDL030W
           (REAL)
          Length = 531

 Score =  377 bits (968), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 225/546 (41%), Positives = 325/546 (59%), Gaps = 34/546 (6%)

Query: 1   MSSLEEKRAILEELEVIEGAISARIERNPEIYYSYLKELQLVNPDEKVLDNISKDDINSN 60
           M+ LE +R++LE+LE+IE AI+ RI+RNPE+YY Y++E   V PD K+        I  N
Sbjct: 1   MNVLETRRSLLEDLEIIENAIAIRIQRNPELYYHYIQESCKVFPDVKL---PKPSLIAEN 57

Query: 61  RIYVNKKARRSRKQLILQQHEIARFLQRYWKQVKRLNAFKSDDIESLRDPNMNFETFEAD 120
           +IY  KK +R+RKQ+ILQQHEI  FL+ Y ++ K  N  +S+++E + + +   + FE +
Sbjct: 58  KIYKLKKVKRNRKQVILQQHEIDLFLRDYHEKQKAFN--ESNNLEGVEEDDKEVDRFEQN 115

Query: 121 IKELQERQAEGADSESAISSLERKRREYSMFSASSGADQ--TILSNVGQFIDVNKLFMWE 178
           ++EL+ER     D+     +L R +  Y++FS+S+   +   ILS   + +D+NK+F  +
Sbjct: 116 LQELEERLKNEDDNFQLDINLTRSK--YALFSSSADPSKRTNILSERARDLDLNKIFTRD 173

Query: 179 EHYGEYLFLERLHQDWLNVVKDGSVTLLQFIAFLESFAG-TGYLTAPPVDRNSKRYQVFI 237
           E YGEY+ L++ H  WLNV++    +LLQF   LE F     +L  PP+DR + RY  F+
Sbjct: 174 EQYGEYMELDQFHYLWLNVIRRSDCSLLQFFNILELFVDDKKFLLTPPMDRKNDRYMDFL 233

Query: 238 QKLVTYLEGAFRNTYPLLNHRLLENRISQSFE-SYIANPVEDPPRGLLCIACGKHFKVGT 296
            +L  YLE  F  +Y L +  ++EN I   FE SY    V    +G+ C  C K FK   
Sbjct: 234 MRLSKYLETFFFKSYVLFDKEMVENSIESDFENSYCKGLVRSEAKGIYCPFCSKWFKTFP 293

Query: 297 VFAGHLLGKKHAQSVTTKVATLRAEHTLHYLVIYLATSIENTRALVERKYAFTSGERNRE 356
           VF  HL GK H ++   +  T+ +E+ LH  + YL     +TR+ +ERK AFT+ ER  E
Sbjct: 294 VFENHLSGKNHKKNEAKRKNTVYSEYKLHRYLKYLKDEFFHTRSFIERKLAFTANERMAE 353

Query: 357 MATIRDAYDAPAYSSGEPEDVIETPQQQQNAHPDDVNP----LNLPLGPMGYPIPYWLYK 412
           M ++ + Y+APAY   E E   +    ++     +  P     ++PLGP G P+PYWLYK
Sbjct: 354 MDSLTEKYEAPAYDHTEGEGDGQCDAGRKGDLLQEKQPFGKSFDMPLGPDGLPMPYWLYK 413

Query: 413 LQGLDIEYACEICANHVYKGRRISNAIF-RTAPCYGLRCLGIEPSPAFKDIYNIAEAQQL 471
           L GLD EY CEICAN VY GRR     F   A  Y LRCLGIEPSPAFK I  IAE Q+L
Sbjct: 414 LHGLDREYPCEICANRVYNGRRTFERHFNEEAHLYHLRCLGIEPSPAFKGITKIAEVQKL 473

Query: 472 FQSLQSSTGPAGLATRRAGAISSSANTRK----------LEVEVEDEDGNVMTHQVYEDL 521
           ++ +Q+          R+G+ ++ A T+K          LE+E EDE+GNVM+ +VY++L
Sbjct: 474 WKDIQNQ--------HRSGSSTAVALTKKSPSQPKLPTGLELEEEDEEGNVMSKKVYDEL 525

Query: 522 KKQGLL 527
           KKQGL+
Sbjct: 526 KKQGLV 531

>ZYRO0B04950g Chr2 complement(399973..401493) [1521 bp, 506 aa] {ON}
           similar to uniprot|P19736 Saccharomyces cerevisiae
           YDL030W PRP9 Subunit of the SF3a splicing factor complex
           required for spliceosome assembly
          Length = 506

 Score =  370 bits (951), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 215/536 (40%), Positives = 304/536 (56%), Gaps = 39/536 (7%)

Query: 1   MSSLEEKRAILEELEVIEGAISARIERNPEIYYSYLKELQLVNPDEKVLDNISKDDINSN 60
           M++LE +R +LE LE+IE AIS R  RNPE+YYS + +  L++     ++  S   +  N
Sbjct: 1   MTTLETRRQLLEGLEIIEDAISQRFGRNPELYYSNITKQVLIDGG---IELPSTTAMAVN 57

Query: 61  RIYVNKKARRSRKQLILQQHEIARFLQRYWKQVKRLNAFKSD-DIESLRDPNMNFETFEA 119
           RIY +K+ +RSRKQL+ QQHEI  FL +   + K L+      D+E  RD  +NF+ F  
Sbjct: 58  RIYKSKRTKRSRKQLVTQQHEINLFLSQALDKQKELSGVNGTVDVEDYRDEEINFDKFRE 117

Query: 120 DIKELQERQAEGADSESAISSLERKRREYSMFSASSGADQTILSNVGQFIDVNKLFMWEE 179
            + ++  +     D E     +      + MFSA+  +  TILS   + +D+N++F  +E
Sbjct: 118 AVDQINSKYE---DQEGLALDINENIVNHEMFSATF-SKSTILSESARDLDLNQIFTRDE 173

Query: 180 HYGEYLFLERLHQDWLNVVKDGSVTLLQFIAFLESFAG-TGYLTAPPVDRNSKRYQVFIQ 238
            YG+ L LE+ H  WLNV+K    + LQF   L+ F   + YL +PP+DR ++RY  F+ 
Sbjct: 174 QYGDLLDLEKFHSQWLNVIKRADCSYLQFFDVLQKFLDPSEYLLSPPMDRKNERYGQFLI 233

Query: 239 KLVTYLEGAFRNTYPLLNHRLLENRISQSFESYIANPVEDPPRGLLCIACGKHFKVGTVF 298
           +L  Y+E  F   Y L+N  +L  R+   FE Y+  P+     GL C+ACGK FK  TVF
Sbjct: 234 ELFQYVEQFFAKVYVLVNSTILSQRMESDFEEYLRMPIYKSNHGLYCVACGKWFKTPTVF 293

Query: 299 AGHLLGKKHAQSVTTKVATLRAEHTLHYLVIYLATSIENTRALVERKYAFTSGERNREMA 358
             HL GK H  +   +   L+AE+ LH  +  L   +E TR  VERK AFT+ ER  EM+
Sbjct: 294 QSHLTGKHHRNNRDKRFTKLQAEYKLHRYLKILQGQLERTRGFVERKMAFTTEERMEEMS 353

Query: 359 TIRDAYDAPAYS-----SGEPEDVIETPQQQQNAHPDDVNPLNLPLGPMGYPIPYWLYKL 413
            +   Y+ P Y+       E ED ++TP +++         + LPLG  G PIP WLYKL
Sbjct: 354 RLARIYEGPDYAPDEKEIEEKEDSVDTPSEKKMN-----GGIELPLGLDGLPIPLWLYKL 408

Query: 414 QGLDIEYACEICANHVYKGRRISNAIFRTAPC--YGLRCLGIEPSPAFKDIYNIAEAQQL 471
           QGLD+ Y+CEIC N  Y+GRR+    F T P   + L+CLGIE S AF+ I +I EAQ L
Sbjct: 409 QGLDVTYSCEICGNQTYRGRRMFERHF-TEPTHLFHLKCLGIEASDAFRSITSIEEAQNL 467

Query: 472 FQSLQSSTGPAGLATRRAGAISSSANTRKLEVEVEDEDGNVMTHQVYEDLKKQGLL 527
           ++                  IS +  T   ++EVEDE+GNVMT QVYE+LKKQGL+
Sbjct: 468 WKR-----------------ISGNNTTSSRDIEVEDEEGNVMTQQVYEELKKQGLV 506

>NDAI0G02890 Chr7 (669498..671108) [1611 bp, 536 aa] {ON} Anc_3.160
           YDL030W
          Length = 536

 Score =  368 bits (944), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 213/541 (39%), Positives = 312/541 (57%), Gaps = 29/541 (5%)

Query: 4   LEEKRAILEELEVIEGAISARIERNPEIYYSYLKELQLVNPDEKVLDNISKDDINSNRIY 63
           LE++R++LE+LE+IE AIS R +RNPE+YYS LK++  + P ++V +  +   + +N+IY
Sbjct: 6   LEKRRSLLEDLEIIENAISTRFQRNPELYYSNLKKVSELFPSKQVEELPTHSIMTNNKIY 65

Query: 64  VNKKARRSRKQLILQQHEIARFLQRYWKQVKRLNA------FKSD-DIESLRDPNMNFET 116
             KK +R+RKQ+ LQQHEI+ F++ ++ + K L        FK+  + E +  P   F+ 
Sbjct: 66  KTKKLKRNRKQIALQQHEISLFIKDFFSKQKELETLTREANFKAKKNKEEILLPVEEFKD 125

Query: 117 FEADIKELQERQAEGADSESAISSLERKRREYSMFSASSGADQ--TILSNVGQFIDVNKL 174
             ++I E  +    G   E  I+    K  +YSMFS S       TILS+    +D+N +
Sbjct: 126 ILSEINE-ADGNENGNRRELEIND---KINKYSMFSNSLNKSHPSTILSSRASDLDINSI 181

Query: 175 FMWEEHYGEYLFLERLHQDWLNVVKDGSVTLLQFIAFLESFAGTG-YLTAPPVDRNSKRY 233
           F  EE YGEYL L   + +WLNVVK   +T LQF+  L+ F     Y+  PP+DR ++ Y
Sbjct: 182 FSLEEQYGEYLALNPYYTEWLNVVKKEDLTFLQFLNMLKIFQDDKRYIVQPPMDRKNEPY 241

Query: 234 QVFIQKLVTYLEGAFRNTYPLLNHRLLENRISQSFESYIANPVEDPPRGLLCIACGKHFK 293
             ++Q+  +YLE  F   YPL++ R     + + F   I  P+E+  +G  C  C K FK
Sbjct: 242 MKYLQRYCSYLESFFERKYPLIDSRYTSRELKKEFNKSIIKPLENEKKGFFCKTCCKWFK 301

Query: 294 VGTVFAGHLLGKKHAQSVTTKVATLRAEHTLHYLVIYLATSIENTRALVERKYAFTSGER 353
             TVF  HL G+KH +S   +V  L AE+  H   + L    ++T   VERK AFT  ER
Sbjct: 302 TLTVFESHLNGQKHIKSYNKRVQGLYAEYKTHRYSMLLKEEHQSTCEFVERKMAFTVEER 361

Query: 354 NREMATIRDAYDAPAYSSGEPE-DVIETPQQQQNAHPDD------VNPLNLPLGPMGYPI 406
             EM  + +   APAY   E E D   T    ++   +D         +N+PLGP G P+
Sbjct: 362 ITEMKRLAEICKAPAYDVNEKEGDENNTELNVKDNLKNDGASAMLSGSINMPLGPDGLPM 421

Query: 407 PYWLYKLQGLDIEYACEICANHVYKGRRISNAIFRTAP-CYGLRCLGIEPSPAFKDIYNI 465
           P+WLYKLQGLD+ Y CEIC+N ++KGRR  +  F  A   Y LRCLGIEP+PAFK +  I
Sbjct: 422 PFWLYKLQGLDVSYPCEICSNQIFKGRRTFDKHFTEATHIYHLRCLGIEPTPAFKGVTKI 481

Query: 466 AEAQQLFQSLQSSTGPAGLATRRAGAISSSANTRKLEVEVEDEDGNVMTHQVYEDLKKQG 525
            EAQ+L+ ++++ T            I +  +  K+ +EVED++GN+MT +VY++LKKQG
Sbjct: 482 EEAQRLWNNMKNDTIMGD-----KKFIETIPD--KMAIEVEDKEGNIMTQKVYDELKKQG 534

Query: 526 L 526
           L
Sbjct: 535 L 535

>Smik_4.205 Chr4 (377655..379250) [1596 bp, 531 aa] {ON} YDL030W
           (REAL)
          Length = 531

 Score =  363 bits (931), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 223/546 (40%), Positives = 321/546 (58%), Gaps = 34/546 (6%)

Query: 1   MSSLEEKRAILEELEVIEGAISARIERNPEIYYSYLKELQLVNPDEKVLDNISKDDINSN 60
           MS LE +R++LE++E+IE AI  RI RNPE+YY Y++E   V PD K+  +     I  N
Sbjct: 1   MSFLETRRSLLEDMEIIENAIVERIRRNPELYYHYIQESSKVFPDVKLPKSSL---IAEN 57

Query: 61  RIYVNKKARRSRKQLILQQHEIARFLQRYWKQVKRLNAFKSDDIESLRDPNMNFETFEAD 120
           +++  KK +R+RKQ+ILQQHEI+ FL+ Y ++ K  N   S +     D ++   +F+ +
Sbjct: 58  KLFKIKKVKRNRKQVILQQHEISLFLRDYLEKQKSFNNINSQNYSQEDDKDLC--SFDEE 115

Query: 121 IKELQ-ERQAEGADSESAISSLERKRREYSMFSAS--SGADQTILSNVGQFIDVNKLFMW 177
           +++L+ E ++E  + +  I+S   KR +Y++FS+S  S     ILS   + +D+NK+F  
Sbjct: 116 LRQLEDELKSEEENFQLDINS---KRNKYALFSSSIDSSKRTNILSERARDLDLNKIFTR 172

Query: 178 EEHYGEYLFLERLHQDWLNVVKDGSVTLLQFIAFLESFAG-TGYLTAPPVDRNSKRYQVF 236
           +E YGEY+ LE+ H  WLNV K    +LLQF   +E F     YL  PP+DR + RY  F
Sbjct: 173 DEQYGEYMELEQFHSLWLNVFKRSDCSLLQFFDVVELFVDDKKYLLTPPMDRKNDRYMAF 232

Query: 237 IQKLVTYLEGAFRNTYPLLNHRLLENRISQSFE-SYIANPVEDPPRGLLCIACGKHFKVG 295
           + KL  YLE  F  +Y L +  ++E+ I   FE SY    +    +G+ C  C K FK  
Sbjct: 233 LIKLCKYLETFFFKSYALFDKEVIESSIRFDFEQSYCKGSLRSEAKGIHCPFCYKWFKTS 292

Query: 296 TVFAGHLLGKKHAQSVTTKVATLRAEHTLHYLVIYLATSIENTRALVERKYAFTSGERNR 355
            VF  HL GK H ++   +  T+ +E+ LH  + YL     +T++ VERK  FT+ ER  
Sbjct: 293 PVFENHLTGKIHKKNEFKRKDTVYSEYKLHRYLKYLKDEFSHTKSFVERKLVFTANERIA 352

Query: 356 EMATIRDAYDAPAYSSGEPEDVIETPQQQQNAHPDDV--------NPLNLPLGPMGYPIP 407
           EM  +   Y+APAY   +P D  +  QQ+ +   DD            ++PLGP G P+P
Sbjct: 353 EMDALTQKYEAPAY---DPTDK-DGDQQKGSDQRDDQLQEKHFFGKSFDMPLGPDGLPMP 408

Query: 408 YWLYKLQGLDIEYACEICANHVYKGRRISNAIFRTAP-CYGLRCLGIEPSPAFKDIYNIA 466
           +WLYKL GLD EY CEICAN VY GRR     F   P  Y LRCLGIEPS AFK I  I 
Sbjct: 409 HWLYKLHGLDREYHCEICANKVYNGRRTFERHFNEGPHLYHLRCLGIEPSLAFKGITKIT 468

Query: 467 EAQQLFQSLQSSTGPAGLATRRAGAISSSANTR-KLEV----EVEDEDGNVMTHQVYEDL 521
           EAQ+L++++Q    P   AT  A +++   ++R KL      E EDE+GNVM+ +V+++L
Sbjct: 469 EAQKLWENMQKQ--PQS-ATSIASSLTKLKHSRSKLPTELELEEEDEEGNVMSKKVFDEL 525

Query: 522 KKQGLL 527
           KKQGL+
Sbjct: 526 KKQGLV 531

>YDL030W Chr4 (397537..399129) [1593 bp, 530 aa] {ON}  PRP9Subunit
           of the SF3a splicing factor complex, required for
           spliceosome assembly; acts after the formation of the U1
           snRNP-pre-mRNA complex
          Length = 530

 Score =  362 bits (930), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 221/543 (40%), Positives = 321/543 (59%), Gaps = 29/543 (5%)

Query: 1   MSSLEEKRAILEELEVIEGAISARIERNPEIYYSYLKELQLVNPDEKVLDNISKDDINSN 60
           M+ LE +R++LEE+E+IE AI+ RI+RNPE+YY Y++E   V PD K+        I  N
Sbjct: 1   MNLLETRRSLLEEMEIIENAIAERIQRNPELYYHYIQESSKVFPDTKL---PRSSLIAEN 57

Query: 61  RIYVNKKARRSRKQLILQQHEIARFLQRYWKQVKRLNAFKSDDIESLRDPNMNFETFEAD 120
           +IY  KK +R RKQ+ILQQHEI  FL+ Y ++ +  N  K +  E  ++ + +   FE  
Sbjct: 58  KIYKFKKVKRKRKQIILQQHEINIFLRDYQEKQQTFN--KINRPEETQEDDKDLPNFERK 115

Query: 121 IKELQ-ERQAEGADSESAISSLERKRREYSMFSASSGADQ--TILSNVGQFIDVNKLFMW 177
           +++L+ E + E  + E  I+S   K+ +Y++FS+SS   +   ILS+  + +D+N++F  
Sbjct: 116 LQQLEKELKNEDENFELDINS---KKDKYALFSSSSDPSRRTNILSDRARDLDLNEIFTR 172

Query: 178 EEHYGEYLFLERLHQDWLNVVKDGSVTLLQFIAFLESFAGT-GYLTAPPVDRNSKRYQVF 236
           +E YGEY+ LE+ H  WLNV+K G  +LLQF+  LE F     YL  PP+DR + RY  F
Sbjct: 173 DEQYGEYMELEQFHSLWLNVIKRGDCSLLQFLDILELFLDDEKYLLTPPMDRKNDRYMAF 232

Query: 237 IQKLVTYLEGAFRNTYPLLNHRLLENRISQSFE-SYIANPVEDPPRGLLCIACGKHFKVG 295
           + KL  Y+E  F  +Y LL+   +EN I   FE SY    +    +G+ C  C + FK  
Sbjct: 233 LLKLSKYVETFFFKSYALLDAAAVENLIKSDFEHSYCRGSLRSEAKGIYCPFCSRWFKTS 292

Query: 296 TVFAGHLLGKKHAQSVTTKVATLRAEHTLHYLVIYLATSIENTRALVERKYAFTSGERNR 355
           +VF  HL+GK H ++ + +   + +E+ LH  + YL      TR+ VERK AFT+ ER  
Sbjct: 293 SVFESHLVGKIHKKNESKRRNFVYSEYKLHRYLKYLNDEFSRTRSFVERKLAFTANERMA 352

Query: 356 EMATIRDAYDAPAYSSGEPEDVIETPQQQQNAHPDDVN----PLNLPLGPMGYPIPYWLY 411
           EM  +   Y+APAY S E E   +   +Q++    + +      ++PLGP G P+PYWLY
Sbjct: 353 EMDILTQKYEAPAYDSTEKEGAEQVDGEQRDGQLQEEHLSGKSFDMPLGPDGLPMPYWLY 412

Query: 412 KLQGLDIEYACEICANHVYKGRRISNAIFRTA-PCYGLRCLGIEPSPAFKDIYNIAEAQQ 470
           KL GLD EY CEIC+N VY GRR     F      Y LRCLGIEPS  FK I  I EAQ+
Sbjct: 413 KLHGLDREYRCEICSNKVYNGRRTFERHFNEERHIYHLRCLGIEPSSVFKGITKIKEAQE 472

Query: 471 LFQSLQSSTGPAGLATRRAGAISSSANTRKLEVEV------EDEDGNVMTHQVYEDLKKQ 524
           L++++Q  +    +A     A+    N  +L+V        EDE+GNVM+ +VY++LKKQ
Sbjct: 473 LWKNMQGQSQLTSIA-----AVPPKPNPSQLKVPTELELEEEDEEGNVMSKKVYDELKKQ 527

Query: 525 GLL 527
           GL+
Sbjct: 528 GLV 530

>TPHA0A00910 Chr1 (179145..180728) [1584 bp, 527 aa] {ON} Anc_3.160
           YDL030W
          Length = 527

 Score =  360 bits (923), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 215/539 (39%), Positives = 307/539 (56%), Gaps = 24/539 (4%)

Query: 1   MSSLEEKRAILEELEVIEGAISARIERNPEIYYSYLKELQ-LVNPDEKVLDNISKDDINS 59
           MS++EE+R++LE+LEVIE +I+ R +RNPE+YY Y + L+ +V+PD   +D  SK   N+
Sbjct: 1   MSNIEERRSLLEDLEVIESSITKRFQRNPELYYKYQEGLKKVVDPD---IDLPSKTVRNT 57

Query: 60  NRIYVNKKARRSRKQLILQQHEIARFLQRYWKQVKRLNAFKSDDIESLRDPNMNFETFEA 119
           N+IY  +K +R RKQ++LQQ+EI  FL  Y ++ K+L   K D I   RD   +F  FE 
Sbjct: 58  NKIYKTRKHKRKRKQILLQQYEINEFLDDYRRKEKQLMKQKLD-ISEFRDKGADFVKFEE 116

Query: 120 DIKELQERQAEGADSESAISSLERKRREYSMFSASSGAD--QTILSNVGQFIDVNKLFMW 177
            ++ +        +       L  K+ +Y+MFS+S   +    ILS   Q +D+N  F  
Sbjct: 117 LLESINNEYNNQNEETPTNLKLLDKKDKYAMFSSSININSPNNILSKRSQLLDLNNYFSK 176

Query: 178 EEHYGEYLFLERLHQDWLNVVKDGSVTLLQFIAFLESFAGTG-YLTAPPVDRNSKRYQVF 236
           EE YGE L LE+ +  WLNVVK    ++L++I  L  F     ++   P+DR + RY  F
Sbjct: 177 EEQYGEILNLEQFYSSWLNVVKTADCSILKYILMLNVFLDKDEFILNSPMDRKNLRYVDF 236

Query: 237 IQKLVTYLEGAFRNTYPLLNHRLLENRISQSFESYIANPVEDPPRGLLCIACGKHFKVGT 296
           I+ L  Y E      Y L N    +  + +SFE Y   P+    +G LCI+CGK FK   
Sbjct: 237 IRILSKYFESYLEKRYILNNWINFKTELKKSFEKYSIKPIVKEKKGYLCISCGKWFKNSN 296

Query: 297 VFAGHLLGKKHAQSVTTKVATLRAEHTLHYLVIYLATSIENTRALVERKYAFTSGERNRE 356
           V+ GHL GK+H +  + +   L  E+ LH ++ YL    + ++A +ERK AFT+ ERN E
Sbjct: 297 VYDGHLKGKQHEKHYSNRKMFLYNEYKLHRIINYLKYEFDESKAYMERKLAFTNTERNNE 356

Query: 357 MATIRDAYDAPAYSSGEPEDVI---ETPQQQQNAHPDDVNPLNLPLGPMGYPIPYWLYKL 413
           +  +   Y+ PAY+  EPE+     E      NA  D     N+PLGP G PIP WLYKL
Sbjct: 357 LKLLTKKYEEPAYNKDEPENTDKYEEDDNSMSNAAEDRNKSFNMPLGPDGMPIPLWLYKL 416

Query: 414 QGLDIEYACEICANHVYKGRR-ISNAIFRTAPCYGLRCLGIEPSPAFKDIYNIAEAQQLF 472
           QGLDI+Y CEIC N  Y+GR+   N          L  LGI+ S AFK I +IAEA+ L+
Sbjct: 417 QGLDIKYNCEICGNKEYQGRKAYENHFSELTHTSHLYFLGIQYSKAFKGITSIAEAKSLW 476

Query: 473 QSLQSSTGPAGLATRRAGAISSSANTRKL----EVEVEDEDGNVMTHQVYEDLKKQGLL 527
            S+ +S G A        A  S+ N  KL    ++EVED +GNVM+ ++Y++LKKQ L+
Sbjct: 477 SSMHASNGSA--------ASFSNQNNTKLAMTEDIEVEDSEGNVMSKKIYDELKKQNLV 527

>KAFR0C01050 Chr3 complement(214128..215648) [1521 bp, 506 aa] {ON}
           Anc_3.160 YDL030W
          Length = 506

 Score =  357 bits (917), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 219/533 (41%), Positives = 318/533 (59%), Gaps = 33/533 (6%)

Query: 1   MSSLEEKRAILEELEVIEGAISARIERNPEIYYSYLKELQLVNPDEKVLDNISKDDINSN 60
           M++LEEKR + E+LEVIE AI+ R++RNPE+YY+YL++L     ++  L+  S  DI +N
Sbjct: 1   MANLEEKRDLCEDLEVIEDAIAKRLQRNPELYYNYLEKLSSF--EKHSLEVPSSIDIKNN 58

Query: 61  RIYVNKKARRSRKQLILQQHEIARFLQRYWKQVKRLNAF-KSDDIESLRDPNMNFETFEA 119
           R+Y +KKA+RS+KQ++ QQHEI  F++ Y  + K LN   K  D   +     +F     
Sbjct: 59  RVYKSKKAKRSKKQIVAQQHEIRLFIEDYTNKQKGLNMLMKRKDTTQISSDIGDF----- 113

Query: 120 DIKELQERQAEGADSESAISSLERKRREYSMFSASSGADQTILSNVGQFIDVNKLFMWEE 179
            I  + E ++         SSL+ K   YSMFSAS+   ++ILS     +D+N+ F  +E
Sbjct: 114 -ITSITENKSH------VKSSLKDKIDYYSMFSAST-TQKSILSKRAADLDINQTFTRDE 165

Query: 180 HYGEYLFLERLHQDWLNVVKDGSVTLLQFIAFLESFAGT-GYLTAPPVDRNSKRYQVFIQ 238
            +GE + LER H  WL+VVKD S +LL F   +ESF  T  YL +P +DR ++RYQ FI+
Sbjct: 166 QFGECMDLERFHNVWLSVVKDDSYSLLDFFRVIESFLDTKSYLKSPHMDRKNQRYQEFIK 225

Query: 239 KLVTYLEGAFRNTYPLLNHRLLENRISQSFESYIANPVEDPPRGLLCIACGKHFKVGTVF 298
            +  Y+E  F   + L++   +  R+ Q F  Y+ NP+ +   G  C+AC K FK  +VF
Sbjct: 226 TISGYVESFFFKKFCLIDKEYVNARLQQDFILYLDNPLNNQ-NGFFCVACNKSFKTKSVF 284

Query: 299 AGHLLGKKHAQSVTTKVATLRAEHTLHYLVIYLATSIENTRALVERKYAFTSGERNREMA 358
             HL GK+H ++V  +  +L +E+ L+  +  L T   NT+   ERK +FT+ ER  E+ 
Sbjct: 285 DNHLPGKQHKRNVDKRRNSLISEYKLYRFLNLLRTEFNNTKEFTERKISFTANERREELE 344

Query: 359 TIRDAYDAPAYSSGEPEDVIETPQQ--QQNAHPDDVNPL-NLPLGPMGYPIPYWLYKLQG 415
            + + Y+AP Y S E E+  E   +   +N +   ++ L N+PLGP G P+P+WLYKLQG
Sbjct: 345 RLNNEYNAPVYGSEEQEEGDEEHDEYASKNGNRSILDGLFNMPLGPDGVPMPFWLYKLQG 404

Query: 416 LDIEYACEICANHVYKGRRISNAIFRTAPC-YGLRCLGIEPSPAFKDIYNIAEAQQLFQS 474
           LD+ Y CEIC+N  +KGRR     F      Y LRCLGI PSP F  I  I EAQ L+  
Sbjct: 405 LDVSYYCEICSNREFKGRRAFERHFNEKTHQYHLRCLGITPSPTFVGITAITEAQTLWDH 464

Query: 475 LQSSTGPAGLATRRAGAISSSANTRKLEVEVEDEDGNVMTHQVYEDLKKQGLL 527
           +QS        T++  A S   +   +++EVED DGNV+T +VY+DLK+QGLL
Sbjct: 465 IQS--------TQKKKAPSGKID---MDIEVEDADGNVLTRKVYDDLKRQGLL 506

>NCAS0C03540 Chr3 (707075..708631) [1557 bp, 518 aa] {ON} Anc_3.160
           YDL030W
          Length = 518

 Score =  358 bits (918), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 211/534 (39%), Positives = 304/534 (56%), Gaps = 32/534 (5%)

Query: 4   LEEKRAILEELEVIEGAISARIERNPEIYYSYLKELQLVNPDEKVLDNISKDDINSNRIY 63
           LE+KR +LE+LEVIE AI+ R +RNPE+YY  + +L ++      +D  ++ + ++N+IY
Sbjct: 5   LEKKRNLLEDLEVIEDAIAKRFQRNPELYYDNITKLSILT--NLSIDTPAESNKSNNKIY 62

Query: 64  VNKKARRSRKQLILQQHEIARFLQRYWKQVKRLNAFKSDDIESLRDPNMNFETFEADIKE 123
             KK +RSRKQ +LQQ EI  FL+ + ++ + L        E+++D N+  ETF+  I++
Sbjct: 63  KRKKLKRSRKQFVLQQQEINIFLKDFEERRRVLLDLGK---ETVKDDNITLETFKTMIQD 119

Query: 124 LQERQAEGADSESAISSLERKRREYSMFSASSGADQ--TILSNVGQFIDVNKLFMWEEHY 181
           +  ++     S S +  + +K   Y+MFSAS    +   ILS     +D+NK F  EE Y
Sbjct: 120 INAKK-----SSSEVLPINQKITRYAMFSASISESKPNNILSQRCAGLDINKYFSREEQY 174

Query: 182 GEYLFLERLHQDWLNVVKDGSVTLLQFIAFLESFAGT-GYLTAPPVDRNSKRYQVFIQKL 240
           G+Y+  E  + +WLNVVK G VTLLQF+  L  F     YLT PP+DR + RY  F++ L
Sbjct: 175 GQYMDFENFYLEWLNVVKTGDVTLLQFLNLLRVFMDEEKYLTHPPMDRKNNRYMKFLESL 234

Query: 241 VTYLEGAFRNTYPLLNHRLLENRISQSFESYIANPVEDPPRGLLCIACGKHFKVGTVFAG 300
            +Y+E  F   Y L+N   + ++I   F  YI  P E   +G  C AC K FK  +VF  
Sbjct: 235 CSYVESFFFRKYALINKSAITSQIESQFTEYIKEPTEHSVKGQYCKACAKWFKTESVFVN 294

Query: 301 HLLGKKHAQSVTTKVATLRAEHTLHYLVIYLATSIENTRALVERKYAFTSGERNREMATI 360
           H+ GK H ++   +   L +E+ LH     L    + T   +E K A T+ ER  EM  +
Sbjct: 295 HIPGKNHIKNEKQRKNALLSEYKLHRFFFLLQEEFKETYEFIEMKMALTADERMEEMKRL 354

Query: 361 RDAYDAPAYSSGEPE------DVIETPQQQQNAHPDDVNPLNLPLGPMGYPIPYWLYKLQ 414
            + Y+ PAYSS E E      D+    Q+            ++PLGP G P+P+WLYKLQ
Sbjct: 355 TENYEKPAYSSDEKEGDENNADLEHDEQRSGKGQGLLEGSFDMPLGPDGLPMPFWLYKLQ 414

Query: 415 GLDIEYACEICANHVYKGRRISNAIFRTAPC--YGLRCLGIEPSPAFKDIYNIAEAQQLF 472
           GLD+EY CEIC+N ++KGRR     F TAP   Y LRCLGIEPS  FK I  I EAQ+L+
Sbjct: 415 GLDVEYPCEICSNQIFKGRRAFEKHF-TAPTHQYHLRCLGIEPSSMFKGITKIKEAQKLW 473

Query: 473 QSLQSSTGPAGLATRRAGAISSSANTRKLEVEVEDEDGNVMTHQVYEDLKKQGL 526
             + S    +              ++ +L+VEVED  GNVM+ ++Y++LKKQGL
Sbjct: 474 VDINSQKNSS----------KPMVSSIELQVEVEDSVGNVMSKKLYDELKKQGL 517

>Kpol_479.26 s479 complement(50993..52546) [1554 bp, 517 aa] {ON}
           complement(50993..52546) [1554 nt, 518 aa]
          Length = 517

 Score =  346 bits (888), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 201/540 (37%), Positives = 313/540 (57%), Gaps = 36/540 (6%)

Query: 1   MSSLEEKRAILEELEVIEGAISARIERNPEIYYSYLKELQLVN----PDEKVLDNISKDD 56
           MS +E  R++LE++EVIE AIS R +RNPE+YY Y ++L  +N      + V+ N S   
Sbjct: 1   MSYIENVRSLLEDIEVIEDAISKRFQRNPEVYYYYSQQLNDINGGGEETKTVVSNRS--- 57

Query: 57  INSNRIYVNKKARRSRKQLILQQHEIARFLQRYWKQVK-RLNAFKSDDIESLRDPN-MNF 114
             SNRIY ++K +R RKQ+ILQQ+E   F+    K ++ +LN  +  +I   ++ N +  
Sbjct: 58  --SNRIYKSRKHKRDRKQVILQQYETNEFI----KDIRSKLNEIR--EINVTKESNGIKL 109

Query: 115 ETFEADIKELQERQAEGADSESAISSLERKRREYSMFSASSGADQ--TILSNVGQFIDVN 172
           + +  ++    + + E + S++    + +   +YSMF++S+  ++   ILS+  +++++N
Sbjct: 110 DRY-VELMGSIDTKYEDSVSDNQQLPINKTIFQYSMFTSSNSKNKPNNILSDKCKYLEIN 168

Query: 173 KLFMWEEHYGEYLFLERLHQDWLNVVKDGSVTLLQFIAFLESFAGTG-YLTAPPVDRNSK 231
             F  +E YGEYL LER + +WLNV+K  + ++LQ+++ +E F  +  Y+  PP+DR ++
Sbjct: 169 DYFTRDEQYGEYLELERFYNNWLNVIKSANCSILQYMSIIEKFLDSAQYILQPPMDRKNE 228

Query: 232 RYQVFIQKLVTYLEGAFRNTYPLLNHRLLENRISQSFESYIANPVEDPPRGLLCIACGKH 291
           RY  F++ + TYL    + TY L++       +   +E      +    +G  C  CGK 
Sbjct: 229 RYLKFLEIIETYLTSFIKKTYVLIDWEEEAEVLKYDYEIECTKSLMKQGKGNFCRLCGKW 288

Query: 292 FKVGTVFAGHLLGKKHAQSVTTKVATLRAEHTLHYLVIYLATSIENTRALVERKYAFTSG 351
           FK  +VF  HL GK H ++          E  +H ++ +L+   E T+  +ERK AFTS 
Sbjct: 289 FKTESVFENHLPGKNHVKNYKKYYDEYFIEFKIHRILNWLSKEFEETKLFLERKLAFTSD 348

Query: 352 ERNREMATIRDAYDAPAYSSGEPEDVI--ETPQQQQNAHPDDVN-PLNLPLGPMGYPIPY 408
           ER +E+  + + Y+ PAYS GEPE+    E   +  +   D +N   ++PLGP G P+PY
Sbjct: 349 ERIKEIDRMTEVYERPAYSVGEPEEGKPNENSSKTSSNKNDIINGSFDMPLGPDGLPMPY 408

Query: 409 WLYKLQGLDIEYACEICANHVYKGRRISNAIF-RTAPCYGLRCLGIEPSPAFKDIYNIAE 467
           WLYKLQGLD+ Y CEICAN +YKGRR     F  T   Y LRCLGIEPS AFK I +I E
Sbjct: 409 WLYKLQGLDMTYKCEICANTIYKGRRTFEKHFSETTHNYHLRCLGIEPSSAFKGIVSIKE 468

Query: 468 AQQLFQSLQSSTGPAGLATRRAGAISSSANTRKLEVEVEDEDGNVMTHQVYEDLKKQGLL 527
           A  L+ ++                 S  A +   E+EVED++GNV++ ++YE+LKKQGLL
Sbjct: 469 ATDLWGTMNVKDKS-----------SKHAESNNYEIEVEDKEGNVLSKEIYEELKKQGLL 517

>Suva_4.219 Chr4 (387976..389571) [1596 bp, 531 aa] {ON} YDL030W
           (REAL)
          Length = 531

 Score =  345 bits (884), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 215/540 (39%), Positives = 316/540 (58%), Gaps = 22/540 (4%)

Query: 1   MSSLEEKRAILEELEVIEGAISARIERNPEIYYSYLKELQLVNPDEKVLDNISKDDINSN 60
           M  LE KR++LE+LE+IE AI+ RI+RNPE+YY Y+ E   + PD   +       ++ N
Sbjct: 1   MDFLETKRSLLEDLEIIENAITERIQRNPELYYRYILEAGKLFPD---IKQPRPSLVSEN 57

Query: 61  RIYVNKKARRSRKQLILQQHEIARFLQRYWKQVKRLNAFKSDDIESLRDPNMNFETFEAD 120
           +IY  KK +R+RKQ+ILQQHEI  FL+ Y ++ + +N       + +++   +  +FE  
Sbjct: 58  KIYKLKKNKRNRKQVILQQHEIDLFLRDYKEKQRLINEINIP--QDVQEDEKDLRSFEQK 115

Query: 121 IKELQERQAEGADSESAISSLERKRREYSMFSASSGADQ--TILSNVGQFIDVNKLFMWE 178
           ++EL+E      ++     +L+R R  Y++FS+S+   +   ILS   + ID+N+LF  +
Sbjct: 116 LQELEEELKNEQENYQLDINLKRGR--YALFSSSAEPSKRTNILSERARDIDLNRLFTRD 173

Query: 179 EHYGEYLFLERLHQDWLNVVKDGSVTLLQFIAFLESFAG-TGYLTAPPVDRNSKRYQVFI 237
           E YGEY+ LE+ H  WLNV+K G  +LLQF   +E F     YL APP+DR + RY  F+
Sbjct: 174 EQYGEYMELEQFHSLWLNVIKRGDCSLLQFFDTVELFVDDKKYLLAPPMDRKNDRYMSFL 233

Query: 238 QKLVTYLEGAFRNTYPLLNHRLLENRISQSFE-SYIANPVEDPPRGLLCIACGKHFKVGT 296
            KL  Y+E  F  +Y L    ++E  I   F+ SY    ++   +G+ C  C K FK   
Sbjct: 234 MKLSEYVESFFYKSYALFEKEVVEGLIKSDFDNSYCRGILKSESKGIYCPLCYKWFKTQA 293

Query: 297 VFAGHLLGKKHAQSVTTKVATLRAEHTLHYLVIYLATSIENTRALVERKYAFTSGERNRE 356
           VF  H+ GK H ++   +   + +E+ LH  +  L   + +T++ VERK AFT+ ER  E
Sbjct: 294 VFENHIPGKNHKKNEAKRKRIVYSEYKLHRYLRLLKDELFHTKSFVERKLAFTANERMVE 353

Query: 357 MATIRDAYDAPAYSSGEPEDVIETPQQQQNAHPDDVN----PLNLPLGPMGYPIPYWLYK 412
           M ++   Y+APAY + E ED  +   +Q++    + +      ++PLGP G P+PYWLYK
Sbjct: 354 MDSLTQKYEAPAYDATEREDDGKGGGEQKDDKLQEKHLFGKSFDMPLGPDGLPMPYWLYK 413

Query: 413 LQGLDIEYACEICANHVYKGRRISNAIF-RTAPCYGLRCLGIEPSPAFKDIYNIAEAQQL 471
           L GLD EY CEICAN +Y GRR     F      Y LRCLGIEPS  FK I  IAEAQ+L
Sbjct: 414 LHGLDREYPCEICANRIYNGRRTFERHFNEETHLYHLRCLGIEPSSVFKGITKIAEAQRL 473

Query: 472 FQSLQSSTGPAGLATRRAGAISSSANTRKL----EVEVEDEDGNVMTHQVYEDLKKQGLL 527
           +++ QS   P  +++  A       +  KL    E+E EDE GNVM+ +VY++LKKQGL+
Sbjct: 474 WKNTQSQ--PQFVSSIAAVPAEKKLSQTKLPAGMELEEEDEQGNVMSKKVYDELKKQGLV 531

>KLLA0F24662g Chr6 complement(2292807..2294399) [1593 bp, 530 aa]
           {ON} similar to uniprot|P19736 Saccharomyces cerevisiae
           YDL030W PRP9 Subunit of the SF3a splicing factor complex
           required for spliceosome assembly
          Length = 530

 Score =  328 bits (842), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 200/538 (37%), Positives = 301/538 (55%), Gaps = 30/538 (5%)

Query: 4   LEEKRAILEELEVIEGAISARIERNPEIYYSYLKELQLVNPDEKVLDNISKDDINSNRIY 63
            EE+R ILEELEVIE AIS+R+ RNPEI+Y + + L  +  +      + K D+++NRIY
Sbjct: 9   FEERRKILEELEVIEDAISSRLRRNPEIFYRFNEALHNLGVEAWA---VPKLDVSANRIY 65

Query: 64  VNKKARRSRKQLILQQHEIARFLQRYWKQVKRLNAFK--SDDIESLRDPNMNFETFEADI 121
            +KK++RSRKQ+  Q++EIA FL RY + +K L   K   + +E  RD N +FE FE   
Sbjct: 66  RSKKSKRSRKQIKAQEYEIALFLGRYRRLLKSLQKHKLSEEHLEYFRDTNASFEQFETVT 125

Query: 122 KELQERQAEGADSESAISSLERKRREYSMFSASSGADQTILSNVGQFIDVNKLFMWEEHY 181
            E+ E Q           SL   + +Y MFS    A + I+S +GQ ID+++ F  +E++
Sbjct: 126 TEVLEGQVNS-------RSLVEVKSDYEMFSGPQAASKNIISPIGQIIDLSRNFARDENF 178

Query: 182 GEYLFLERLHQDWLNVVKDGSVTLLQFIAFLESFAGTGYLTAPPVDRNSKRYQVFIQKLV 241
           G YL L    + WLN++K   +T+L F+  LESF    YL  P +DR++K Y   + +L+
Sbjct: 179 GTYLDLSEQFKKWLNIIKRADLTILSFLKMLESFETYDYLLNPSLDRDTKEYNQLVTELL 238

Query: 242 TYLEGAFRNTYPLLNHRLLENRISQSFESYIANPVEDPPR----GLLCIACGKHFKVGTV 297
            Y +  +   YPL++  +L   I   F+ Y+   + + P      +  +   + F   + 
Sbjct: 239 KYYKAYYSKAYPLVDKEILSKTIHNGFDKYVRTGITESPSKESGKMYSVVFNRWFDSQSE 298

Query: 298 FAGHLLGKKHAQSVTTKVATLRAEHTLHYLVIYLATSIENTRALVERKYAFTSGERNREM 357
           F  H+  ++   +++     L  E+T H    +L+  ++NT +  ERK AFT  E   E+
Sbjct: 299 FNTHVQTEQFNIALSRNRKRLMKEYTFHCFSKFLSKVLQNTISFTERKLAFTDEEFTEEL 358

Query: 358 ATIRDAYDAPAYSSGEPED----VIETPQQQQNAHPDDVNPLNLPLGPMGYPIPYWLYKL 413
             +++ Y++P Y+  E ED    +       Q    D  NP NLPLGP G+PIP WL K+
Sbjct: 359 EKLQEQYESPIYAKDESEDKPSYIDNAEDTAQKESMDPTNPYNLPLGPDGFPIPRWLIKV 418

Query: 414 QGLDIEYACEICANHVYKGRRISNAIFRTAP-CYGLRCLGIEPSPAFKDIYNIAEAQQLF 472
           QGLD++Y CEIC N +Y GRR     F       GL+ LGI PS AFKD+  I E  +L+
Sbjct: 419 QGLDVKYVCEICGNQIYHGRREFEKHFPLKKHSEGLKSLGITPSLAFKDVTTIVEVTELW 478

Query: 473 QSLQSSTGPAGLATRRAGAISSSANTRK---LEVEVEDEDGNVMTHQVYEDLKKQGLL 527
           ++LQ+       +T ++G   S  +T K   + +E ED +GNVM+ QVYE+LKKQGLL
Sbjct: 479 KALQAK------STLKSGEPFSKISTVKEPEMVLETEDNEGNVMSVQVYEELKKQGLL 530

>KNAG0K01120 Chr11 (218749..220332) [1584 bp, 527 aa] {ON} Anc_3.160
           YDL030W
          Length = 527

 Score =  313 bits (801), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 199/547 (36%), Positives = 301/547 (55%), Gaps = 45/547 (8%)

Query: 4   LEEKRAILEELEVIEGAISARIERNPEIYYSYLKELQLVNPDEKVLDNISKDDINSNRIY 63
           L+E+ +++ +LE++E AI+AR +RNP +YY+ +  L+ +    +      +D +  N++Y
Sbjct: 3   LDERVSLIRQLEILEDAIAARFQRNPALYYNSVPMLKKLTMQAEPKVCPPQDHVTKNKVY 62

Query: 64  VNKKARRSRKQLILQQHEIARFLQRYWKQVKRLN-AFKSDDIESLRDPNMNFETFEADIK 122
             +K+ R  KQ+  QQHEI  FLQ     + +L+ A +S   ES      N + F+  I 
Sbjct: 63  RVEKSARKVKQVATQQHEIKLFLQDRTDILNKLSRAQESGPGESQYK---NLDEFKTAIN 119

Query: 123 ELQERQAEGADSESAI---SSLERKRREYSMFSASSGADQT-ILSNVGQFIDVNKLFMWE 178
            L         +ES I   S L+ ++ +Y+MFS+S     T ILS     +D+N +F  E
Sbjct: 120 GL---------TESNIPKRSGLQSEKDQYAMFSSSIEKPPTNILSARALELDINAIFNRE 170

Query: 179 EHYGEYLFLERLHQDWLNVVKDGSVTLLQFI-----AFLESFAGTGYLTAPPVDRNSKRY 233
           E YG Y+ LE  H  WL ++K+ SVT+LQ++      FL +   T YLT+PP+DR++K+Y
Sbjct: 171 EQYGTYIQLENYHPMWLELMKEPSVTVLQYLESLERMFLNADDKTSYLTSPPIDRDNKQY 230

Query: 234 QVFIQKLVTYLEGAFRNTYPLLNHRLLENRISQSFES-YIANPVEDPPRGLLCIACGKHF 292
             F+++L  YL+      +PL++  L+E+ +   F++ Y+  PV        C  C K +
Sbjct: 231 LRFLERLGLYLKTYIAKKFPLIDQHLVEDYLLDHFKNRYVNKPVSTDQNTQFCPVCDKRY 290

Query: 293 KVGTVFAGHLLGKKHAQSVTTKVATLRAEHTLHYLVIYLATSIENTRALVERKYAFTSGE 352
           +   +F  HLL K HAQ    ++  L+AE  +   +  L+   ++++  +ERK AFT  E
Sbjct: 291 EGMQLFNDHLLNKFHAQQRGKRLPLLQAEFRVSVYLTALSKEFKDSKNFMERKLAFTYAE 350

Query: 353 RNREMATIRDAYDAPAYSSG-EPEDVIETPQQQQNAHPDDVNP---------LNLPLGPM 402
           R  E+  +   Y+AP Y+   E ED      + +N      N           N+PLGP 
Sbjct: 351 RQEELQRLTTEYEAPNYNPALEHEDNPAETDKNKNGKTHSENKQTAELESMFTNMPLGPD 410

Query: 403 GYPIPYWLYKLQGLDIEYACEICANHVYKGRRISNAIFRTAPC--YGLRCLGIEPSPAFK 460
           G PIP WLYKLQGLD++Y CEIC N  +KGRR     F   P   Y L+CLGI  S AF 
Sbjct: 411 GMPIPLWLYKLQGLDVKYTCEICGNAEFKGRRAYQKHFH-EPLHEYRLKCLGITRSKAFD 469

Query: 461 DIYNIAEAQQLFQSLQSSTGPAGLATRRAGAISSSANTRKLEVEVEDEDGNVMTHQVYED 520
            I  I EAQ+L+         A ++ +   A + S ++ KLE+EVEDEDGNVM+  VY+D
Sbjct: 470 GIALIEEAQELW---------AKISGKSTSARAGSDDSLKLEIEVEDEDGNVMSQTVYQD 520

Query: 521 LKKQGLL 527
           LK+QGLL
Sbjct: 521 LKRQGLL 527

>CAGL0K01573g Chr11 (139809..141359) [1551 bp, 516 aa] {ON} similar
           to uniprot|P19736 Saccharomyces cerevisiae YDL030w
           Pre-mRNA splicing factor PRP9
          Length = 516

 Score =  296 bits (757), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 191/545 (35%), Positives = 289/545 (53%), Gaps = 52/545 (9%)

Query: 4   LEEKRAILEELEVIEGAISARIERNPEIYYSYLKELQLVNPDEKVLDNISK----DDINS 59
           L+  R++LE++EVIE AIS+R +RNPE+YY Y   L      E + D+I K    DD   
Sbjct: 3   LDTVRSLLEDIEVIEDAISSRFQRNPELYYDYRIHL------EGIRDDIPKLGLDDDRMV 56

Query: 60  NRIYVNKKARRSRKQLILQQHEIARFLQRYWKQVKRL----NAFKSDDIESLRDPNMNFE 115
           N+IY  +K +R+ KQ   QQ+EI  FL   +K+ K +    N  KSD ++  +D    FE
Sbjct: 57  NKIYKARKHKRTLKQKRTQQYEINTFLDDIFKKNKYILKVRNQLKSDGLK-YKDSECKFE 115

Query: 116 TFEADIKELQERQAEGADSESAISS-----LERKRREYSMFSASSGADQTILSNVGQFID 170
             +  + +      +  DS S  +S     ++     Y+M    +  +  ++S     +D
Sbjct: 116 LLKKLLGDEPTEDEDEDDSISKSNSSRLLDIDETINRYNM----NLGNGKLVSERCSLLD 171

Query: 171 VNKLFMWEEHYGEYLFLERLHQDWLNVVKDGSVTLLQFIAFLESFAG-TGYLTAPPVDRN 229
           +N +F  +E  G  +  E L++ WLN+VKDG++T  +FI+ LE F     YL  P +DR 
Sbjct: 172 INTIFQKDEQDGFIIDFEPLYRRWLNIVKDGTLTYPKFISNLEKFIDDKKYLLDPVMDRK 231

Query: 230 SKRYQVFIQKLVTYLEGAFRNTYPLLNHRLLENRISQSFESYIANPVEDPPRGLLCIACG 289
           +K Y  F+ +   ++E  +     LLN   ++ ++ + FE+++   +        C+ C 
Sbjct: 232 TKGYCEFVVEACDFVETQYFKRNILLNEEQIKGKLHRDFENHVTKAIITESGIYYCLYCD 291

Query: 290 KHFKVGTVFAGHLLGKKHAQSVTTKVATLRAEHTLHYLVIYLATSIENTRALVERKYAFT 349
           K F    ++  H  GK H++SV+    + RAE  LH  V  +    ENT+  V+RK AFT
Sbjct: 292 KMFNSAHIYDSHRTGKAHSKSVSNYHDSFRAEFKLHVYVSCMREEFENTKEYVDRKMAFT 351

Query: 350 SGERNREMATIRDAYDAPAYSSGEPEDVIETPQQQQNAHPDDVNPL-----NLPLGPMGY 404
           + ER  EM  +   Y  P Y   E E  +E    +     D++  +     ++PLGP G 
Sbjct: 352 NKERLEEMEKLTQEYHRPVYDPTEKEGDVEEDNSKSKT-KDELKEMLGLGEDMPLGPDGL 410

Query: 405 PIPYWLYKLQGLDIEYACEICANHVYKGRRISNAIFRTAP--CYGLRCLGIEPSPAFKDI 462
           PIPYWLYKLQGLD+   CEIC N VYKG +  +  F + P   Y L+CLGIEPS AF+ I
Sbjct: 411 PIPYWLYKLQGLDVGQECEICGNQVYKGHKNFDKHF-SGPTHTYHLKCLGIEPSSAFQGI 469

Query: 463 YNIAEAQQLFQSLQSSTGPAGLATRRAGAISSSANTRKLEVEVEDEDGNVMTHQVYEDLK 522
             I EAQ L++ +Q +T                  T++L  EVED++GNVM+  +YE+LK
Sbjct: 470 TKIKEAQALWKQMQRNT------------------TQELAEEVEDKEGNVMSKDIYEELK 511

Query: 523 KQGLL 527
           KQGL+
Sbjct: 512 KQGLV 516

>TBLA0B01600 Chr2 (352382..353842) [1461 bp, 486 aa] {ON} Anc_3.160
           YDL030W
          Length = 486

 Score = 69.3 bits (168), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 77/308 (25%), Positives = 122/308 (39%), Gaps = 34/308 (11%)

Query: 169 IDVNKLFM-WEEHYGEYLFLERLHQDWLN-----VVKDGSVTLLQFIA-FLESFAGTGYL 221
           ID+N ++   EE YG  + L+R +  W+         +   TL++F     + F    ++
Sbjct: 112 IDINSVYRDPEEEYGTSISLDRFYNLWIGHLTKRKTSESPPTLVEFYGQVTKQFLHDRWI 171

Query: 222 --TAPPVDRNSKRYQVFIQKLVTYLEGAFRNTYPLLNHRLLENRISQSFESYIA------ 273
             TA P           I  ++ YL G F+    ++  +     I++    +IA      
Sbjct: 172 DETAFPPS--------LIAGMLEYLTG-FQERVDIVKPQDSSAAITRRLRRHIALSSSSC 222

Query: 274 -----NPVEDPPRGLLCIACG-KHFKVGTVFAGHLLGKKHAQSVTTKVATLRAEHTLHYL 327
                +     P  L CI CG K F    VF  HL   +H +   +++  +    ++   
Sbjct: 223 SSSSSSASSPSPWPLTCIVCGPKKFATEQVFHHHLNSNRHLKREASRLPIMIPIQSVREK 282

Query: 328 VIYLATSIENTRALVERKYAFTSGERNREMATIRDAYDAPAYSSGEPEDVIETPQQQQNA 387
           +  LA  + +  A VER+   T  ER  E A  +    A     G   D   TP    +A
Sbjct: 283 LQTLAAELASGAARVERQLNMTPQERFAEHAAQQRIRTAVQGRGGG--DTTATPSATPSA 340

Query: 388 HPDDVNPLNLPLGPM-GYPIPYWLYKLQGLDIEYACEICANHVYKGR-RISNAIFRTAPC 445
            P    P +     + G  +P WLY+LQGL   + CE+C    + GR R       T   
Sbjct: 341 TPAATTPASASTVEVDGRHVPRWLYRLQGLSSIFTCELCDGREFHGRTRYERHFTSTQHR 400

Query: 446 YGLRCLGI 453
             L CLG+
Sbjct: 401 TRLVCLGV 408

>KLTH0G19096g Chr7 complement(1649335..1649814) [480 bp, 159 aa]
           {ON} highly similar to uniprot|Q08004 Saccharomyces
           cerevisiae YLR074C BUD20 Protein involved in bud-site
           selection diploid mutants display a random budding
           pattern instead of the wild-type bipolar pattern
          Length = 159

 Score = 35.0 bits (79), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 26/54 (48%), Gaps = 3/54 (5%)

Query: 261 ENRISQSFESYIANPVEDPPRGL---LCIACGKHFKVGTVFAGHLLGKKHAQSV 311
           E R  +  +  +  P+++   GL    CI C K+F+ G     HL GK H + V
Sbjct: 24  ELRSQEQIQKLMNQPLDETKPGLGQHYCIHCAKYFETGVALKTHLKGKVHKRRV 77

>CAGL0K12804g Chr11 complement(1269506..1270024) [519 bp, 172 aa]
           {ON} similar to uniprot|Q08004 Saccharomyces cerevisiae
           YLR074c
          Length = 172

 Score = 33.9 bits (76), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 24/49 (48%), Gaps = 3/49 (6%)

Query: 266 QSFESYIANPVEDPPRGL---LCIACGKHFKVGTVFAGHLLGKKHAQSV 311
           +  +  +  P+++   GL    CI C K+F+ G     HL GK H + V
Sbjct: 29  EKIQQLLNQPLDETKPGLGQHYCIHCAKYFETGIALKTHLKGKIHRRRV 77

>SAKL0F16214g Chr6 complement(1312909..1313382) [474 bp, 157 aa]
           {ON} similar to uniprot|Q06580 Saccharomyces cerevisiae
           YPR188C MLC2 Regulatory light chain for the type II
           myosin Myo1p binds to an IQ motif of Myo1p localization
           to the bud neck depends on Myo1p involved in the
           disassembly of the Myo1p ring
          Length = 157

 Score = 32.0 bits (71), Expect = 1.7,   Method: Composition-based stats.
 Identities = 19/66 (28%), Positives = 34/66 (51%), Gaps = 2/66 (3%)

Query: 4   LEEKRAILEELEVIEGAISARIERNPEIYYSYLKELQLVNPDE--KVLDNISKDDINSNR 61
           L E+  I++ L V  G+ S+ +  N +    YL+ + + N  E  KVL N +   ++  R
Sbjct: 85  LPEEEEIVKALRVFSGSDSSELNVNVDELKEYLRSVGMNNEKELEKVLKNFTSQQVSGER 144

Query: 62  IYVNKK 67
           ++  KK
Sbjct: 145 VFKGKK 150

>Ecym_1531 Chr1 complement(1094489..1095004) [516 bp, 171 aa] {ON}
           similar to Ashbya gossypii ABR234C
          Length = 171

 Score = 32.3 bits (72), Expect = 1.9,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 3/49 (6%)

Query: 266 QSFESYIANPVEDPPRGL---LCIACGKHFKVGTVFAGHLLGKKHAQSV 311
           Q  +  +  PV++   GL    CI C K+F+       HL GK H + V
Sbjct: 29  QKIQQLLNQPVDETKPGLGQHYCIHCAKYFETAVALKTHLKGKIHKRRV 77

>TPHA0F02630 Chr6 complement(583511..587299) [3789 bp, 1262 aa] {ON}
           Anc_6.75 YLR278C
          Length = 1262

 Score = 32.3 bits (72), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 37/80 (46%), Gaps = 8/80 (10%)

Query: 220 YLTAPPVDRNSKRYQVFIQKLVTYLEGAFRNTYPLLNHRLLENRISQSFESYIANPVEDP 279
           YL  P  D + K  + F+    T L+  F+  YPLL+    EN I Q  ESYI N +   
Sbjct: 340 YLYDPAFDFDEKLSRSFLDIFFTRLQ--FK--YPLLD----ENEIYQFHESYINNDIYSI 391

Query: 280 PRGLLCIACGKHFKVGTVFA 299
           P       C + + + ++ A
Sbjct: 392 PEDKFHFCCARMWLIFSISA 411

>CAGL0H02387g Chr8 (212116..215460) [3345 bp, 1114 aa] {ON} similar
           to uniprot|P38426 Saccharomyces cerevisiae YMR261c
           TPS3alpha or uniprot|P38427 Saccharomyces cerevisiae
           YML100w TSL1
          Length = 1114

 Score = 32.3 bits (72), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 48/97 (49%), Gaps = 17/97 (17%)

Query: 111 NMNFETFEADIKELQERQ-----AEGADSE--SAISSLERKRREYSMFSASSGADQTILS 163
           N+ FETF  D  +  +R      +E  +S   S ++ L  K R Y M S S   ++++ S
Sbjct: 839 NLRFETFSDDYNDTSKRLFIFKISEPPNSRMISVLNELSSKNRVYIMNSFSKVVNESLYS 898

Query: 164 NVGQFIDVNKLFMWEEHYGEYLFLERLHQDWLNVVKD 200
            V      N + +  E+ G ++   RL+ DW N+V+D
Sbjct: 899 RV------NNIGLIAEN-GAFV---RLNGDWYNIVED 925

>NCAS0A09330 Chr1 (1844122..1847805) [3684 bp, 1227 aa] {ON} Anc_1.295
            YJL074C
          Length = 1227

 Score = 32.0 bits (71), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 37/67 (55%), Gaps = 5/67 (7%)

Query: 93   VKRLNAFKSDDIESLRDPNM----NFETFEADIKELQERQAEGADSESAISSLERKRREY 148
            +KRLN+  S+DI  L++ N     NF  F+   KEL ER  E  +S+++I  L  + R+ 
Sbjct: 976  LKRLNSV-SEDISGLKNVNKRAYENFRKFDEKQKELVERATELDESKTSIQDLITRLRQQ 1034

Query: 149  SMFSASS 155
             + +  S
Sbjct: 1035 KVTAVDS 1041

>Kwal_14.1064 s14 (178979..179467) [489 bp, 162 aa] {ON} YLR074C
           (BUD20) -  [contig 244] FULL
          Length = 162

 Score = 30.8 bits (68), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 25/54 (46%), Gaps = 3/54 (5%)

Query: 261 ENRISQSFESYIANPVEDPPRGL---LCIACGKHFKVGTVFAGHLLGKKHAQSV 311
           E +  +  +  +  P+++   GL    CI C K+F+       HL GK H + V
Sbjct: 24  ELKSQEQIQKLLNQPIDETKPGLGQHYCIHCAKYFETRIALKTHLKGKVHKRRV 77

>KLLA0B02673g Chr2 (235478..236803) [1326 bp, 441 aa] {ON} similar
           to uniprot|P08432 Saccharomyces cerevisiae YKL184W SPE1
           Rate limiting step of polyamine biosynthesis pathway
           Ornithine decarboxylase
          Length = 441

 Score = 31.6 bits (70), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 48/107 (44%), Gaps = 11/107 (10%)

Query: 75  LILQQHEIARFLQRYWKQV-KRLNAFKS-------DDIESLRDPNMNFETFEADIKELQE 126
            +    EI+R L+ YW Q+  R+  F +       + I+ L   + NF+   A   E+++
Sbjct: 69  FVCDLGEISR-LRNYWTQILPRVTPFYAVKCNPNIEIIKRLASMSTNFDC--ASKSEIEK 125

Query: 127 RQAEGADSESAISSLERKRREYSMFSASSGADQTILSNVGQFIDVNK 173
             A G D E  I +   K   +  F+A +G  ++   N+ +   + K
Sbjct: 126 VLACGVDPERIIYANPCKASSFIRFAAKNGVKKSTFDNIDELYKIKK 172

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 55,518,963
Number of extensions: 2474030
Number of successful extensions: 9778
Number of sequences better than 10.0: 84
Number of HSP's gapped: 10005
Number of HSP's successfully gapped: 85
Length of query: 527
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 413
Effective length of database: 40,409,475
Effective search space: 16689113175
Effective search space used: 16689113175
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)