Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ADR315W3.165ON49249223990.0
Ecym_52393.165ON46442614390.0
SAKL0C07414g3.165ON48244611921e-160
Kwal_33.141823.165ON46744111851e-159
KLTH0F06534g3.165ON46644011781e-158
ZYRO0B04840g3.165ON47644211601e-155
TDEL0D045803.165ON48244611161e-148
Kpol_1045.443.165ON46944310971e-145
YOL062C (APM4)3.165ON49145410741e-142
NCAS0C035803.165ON49145910731e-141
NDAI0G029203.165ON48645110661e-141
CAGL0C05203g3.165ON47544210571e-139
Smik_15.963.165ON49145410561e-139
Skud_15.913.165ON49145410551e-139
Suva_15.1033.165ON49145410461e-137
TBLA0F008403.165ON48144810421e-137
KLLA0C03894g3.165ON47543710331e-136
TPHA0P006603.165ON47343710041e-131
KNAG0K011503.165ON4744349841e-128
KAFR0C010203.165ON4284278701e-112
KLLA0D14311g7.127ON4434144902e-55
Ecym_83507.127ON4453284859e-55
ADL017C7.127ON4434264832e-54
KLTH0F12584g7.127ON4414144762e-53
SAKL0F05346g7.127ON4473384753e-53
KAFR0L004707.127ON4653974676e-52
Kwal_55.208437.127ON4413824649e-52
YPL259C (APM1)7.127ON4753474651e-51
TPHA0C043207.127ON4544104641e-51
NDAI0E036807.127ON4443744604e-51
Smik_6.4667.127ON4763484581e-50
Suva_16.457.127ON4783504572e-50
KNAG0L009507.127ON4613644543e-50
NCAS0E021407.127ON4813844553e-50
TDEL0H028907.127ON4423144516e-50
Skud_16.197.127ON4763864511e-49
Kpol_1062.567.127ON4503514431e-48
CAGL0K00539g7.127ON4563544272e-46
ZYRO0C05236g7.127ON4473144272e-46
TBLA0A009507.127ON4693674264e-46
KLTH0D07502g2.555ON5044102921e-27
SAKL0D13090g2.555ON4993002701e-24
TDEL0B064302.555ON5254042692e-24
Kwal_26.81462.555ON5053652593e-23
Ecym_45912.555ON5013852513e-22
KLLA0F25432g2.555ON5073542408e-21
KAFR0A020602.555ON5402172391e-20
ABR047W2.555ON4982752372e-20
ZYRO0E05874g2.555ON5492272274e-19
NCAS0A126502.555ON5884552266e-19
Kpol_1056.132.555ON5414732241e-18
TPHA0I023902.555ON5594512241e-18
TBLA0B067602.555ON6572292222e-18
NDAI0B016102.555ON6723212133e-17
Suva_8.332.555ON5962602098e-17
Skud_8.262.555ON5962422044e-16
CAGL0K03223g2.555ON5982502019e-16
YHL019C (APM2)2.555ON6052412001e-15
KNAG0C055502.555ON5822261972e-15
Smik_8.232.555ON6032481972e-15
KAFR0D035602.522ON4552101766e-13
KLTH0D06556g2.522ON4562281703e-12
SAKL0A09218g2.522ON4732331614e-11
Kwal_26.79572.522ON4561611571e-10
TBLA0I006202.522ON6091931553e-10
ZYRO0B01738g2.522ON4921701535e-10
TDEL0A029702.522ON4961451482e-09
AGL061W2.522ON4112491331e-07
Kpol_1018.422.522ON5751471322e-07
KLLA0E18789g2.522ON4971291268e-07
NCAS0A048702.522ON4892621205e-06
TPHA0C041302.522ON5331501181e-05
Ecym_72662.522ON5173281133e-05
Suva_4.5482.522ON4841361107e-05
Skud_2.4192.522ON4841351099e-05
NDAI0K019302.522ON6121531062e-04
Smik_2.4302.522ON4841331062e-04
YBR288C (APM3)2.522ON4831471053e-04
CAGL0L02145g2.522ON5432471036e-04
KNAG0A069702.522ON505142970.003
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADR315W
         (492 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADR315W Chr4 (1259839..1261317) [1479 bp, 492 aa] {ON} Syntenic ...   928   0.0  
Ecym_5239 Chr5 complement(492091..493485) [1395 bp, 464 aa] {ON}...   558   0.0  
SAKL0C07414g Chr3 complement(683859..685307) [1449 bp, 482 aa] {...   463   e-160
Kwal_33.14182 s33 complement(560456..561859) [1404 bp, 467 aa] {...   461   e-159
KLTH0F06534g Chr6 complement(565211..566611) [1401 bp, 466 aa] {...   458   e-158
ZYRO0B04840g Chr2 (389669..391099) [1431 bp, 476 aa] {ON} highly...   451   e-155
TDEL0D04580 Chr4 (840369..841817) [1449 bp, 482 aa] {ON} Anc_3.1...   434   e-148
Kpol_1045.44 s1045 complement(103089..104498) [1410 bp, 469 aa] ...   427   e-145
YOL062C Chr15 complement(210520..211995) [1476 bp, 491 aa] {ON} ...   418   e-142
NCAS0C03580 Chr3 complement(715761..717236) [1476 bp, 491 aa] {O...   417   e-141
NDAI0G02920 Chr7 complement(676413..677873) [1461 bp, 486 aa] {O...   415   e-141
CAGL0C05203g Chr3 (496561..497988) [1428 bp, 475 aa] {ON} highly...   411   e-139
Smik_15.96 Chr15 complement(174750..176225) [1476 bp, 491 aa] {O...   411   e-139
Skud_15.91 Chr15 complement(169608..171083) [1476 bp, 491 aa] {O...   410   e-139
Suva_15.103 Chr15 complement(183026..184501) [1476 bp, 491 aa] {...   407   e-137
TBLA0F00840 Chr6 (213915..215360) [1446 bp, 481 aa] {ON} Anc_3.1...   405   e-137
KLLA0C03894g Chr3 complement(354889..356316) [1428 bp, 475 aa] {...   402   e-136
TPHA0P00660 Chr16 (136114..137535) [1422 bp, 473 aa] {ON} Anc_3....   391   e-131
KNAG0K01150 Chr11 complement(225095..226519) [1425 bp, 474 aa] {...   383   e-128
KAFR0C01020 Chr3 (208272..209558) [1287 bp, 428 aa] {ON} Anc_3.1...   339   e-112
KLLA0D14311g Chr4 (1216574..1217905) [1332 bp, 443 aa] {ON} simi...   193   2e-55
Ecym_8350 Chr8 (700421..701758) [1338 bp, 445 aa] {ON} similar t...   191   9e-55
ADL017C Chr4 complement(679085..680416) [1332 bp, 443 aa] {ON} S...   190   2e-54
KLTH0F12584g Chr6 complement(1053944..1055269) [1326 bp, 441 aa]...   187   2e-53
SAKL0F05346g Chr6 (413830..415173) [1344 bp, 447 aa] {ON} highly...   187   3e-53
KAFR0L00470 Chr12 complement(85772..87169) [1398 bp, 465 aa] {ON...   184   6e-52
Kwal_55.20843 s55 complement(580157..581482) [1326 bp, 441 aa] {...   183   9e-52
YPL259C Chr16 complement(51244..52671) [1428 bp, 475 aa] {ON}  A...   183   1e-51
TPHA0C04320 Chr3 (932871..934235) [1365 bp, 454 aa] {ON} Anc_7.1...   183   1e-51
NDAI0E03680 Chr5 complement(794613..795947) [1335 bp, 444 aa] {O...   181   4e-51
Smik_6.466 Chr6 (768507..769937) [1431 bp, 476 aa] {ON} YPL259C ...   181   1e-50
Suva_16.45 Chr16 complement(66786..68222) [1437 bp, 478 aa] {ON}...   180   2e-50
KNAG0L00950 Chr12 complement(174410..175795) [1386 bp, 461 aa] {...   179   3e-50
NCAS0E02140 Chr5 complement(410049..411494) [1446 bp, 481 aa] {O...   179   3e-50
TDEL0H02890 Chr8 complement(481125..482453) [1329 bp, 442 aa] {O...   178   6e-50
Skud_16.19 Chr16 complement(30298..31728) [1431 bp, 476 aa] {ON}...   178   1e-49
Kpol_1062.56 s1062 (126558..127910) [1353 bp, 450 aa] {ON} (1265...   175   1e-48
CAGL0K00539g Chr11 complement(64028..65398) [1371 bp, 456 aa] {O...   169   2e-46
ZYRO0C05236g Chr3 complement(408616..409959) [1344 bp, 447 aa] {...   169   2e-46
TBLA0A00950 Chr1 complement(210799..212208) [1410 bp, 469 aa] {O...   168   4e-46
KLTH0D07502g Chr4 (650799..652313) [1515 bp, 504 aa] {ON} simila...   117   1e-27
SAKL0D13090g Chr4 (1093315..1094814) [1500 bp, 499 aa] {ON} weak...   108   1e-24
TDEL0B06430 Chr2 (1137277..1138854) [1578 bp, 525 aa] {ON} Anc_2...   108   2e-24
Kwal_26.8146 s26 (665689..667206) [1518 bp, 505 aa] {ON} YHL019C...   104   3e-23
Ecym_4591 Chr4 complement(1154444..1155949) [1506 bp, 501 aa] {O...   101   3e-22
KLLA0F25432g Chr6 complement(2365434..2366957) [1524 bp, 507 aa]...    97   8e-21
KAFR0A02060 Chr1 (428640..430262) [1623 bp, 540 aa] {ON} Anc_2.5...    97   1e-20
ABR047W Chr2 (479283..480779) [1497 bp, 498 aa] {ON} Syntenic ho...    96   2e-20
ZYRO0E05874g Chr5 (452910..454559) [1650 bp, 549 aa] {ON} simila...    92   4e-19
NCAS0A12650 Chr1 (2492345..2494111) [1767 bp, 588 aa] {ON} Anc_2...    92   6e-19
Kpol_1056.13 s1056 complement(30531..32156) [1626 bp, 541 aa] {O...    91   1e-18
TPHA0I02390 Chr9 (528997..530676) [1680 bp, 559 aa] {ON} Anc_2.5...    91   1e-18
TBLA0B06760 Chr2 (1594957..1596930) [1974 bp, 657 aa] {ON} Anc_2...    90   2e-18
NDAI0B01610 Chr2 complement(384287..386305) [2019 bp, 672 aa] {O...    87   3e-17
Suva_8.33 Chr8 complement(69735..71525) [1791 bp, 596 aa] {ON} Y...    85   8e-17
Skud_8.26 Chr8 complement(55759..57549) [1791 bp, 596 aa] {ON} Y...    83   4e-16
CAGL0K03223g Chr11 (296371..298167) [1797 bp, 598 aa] {ON} simil...    82   9e-16
YHL019C Chr8 complement(67731..69548) [1818 bp, 605 aa] {ON}  AP...    82   1e-15
KNAG0C05550 Chr3 complement(1076437..1078185) [1749 bp, 582 aa] ...    80   2e-15
Smik_8.23 Chr8 complement(51372..53183) [1812 bp, 603 aa] {ON} Y...    80   2e-15
KAFR0D03560 Chr4 complement(695693..697060) [1368 bp, 455 aa] {O...    72   6e-13
KLTH0D06556g Chr4 complement(570972..572342) [1371 bp, 456 aa] {...    70   3e-12
SAKL0A09218g Chr1 complement(802348..803734,803809..803843) [142...    67   4e-11
Kwal_26.7957 s26 complement(586544..587914) [1371 bp, 456 aa] {O...    65   1e-10
TBLA0I00620 Chr9 complement(110231..112060) [1830 bp, 609 aa] {O...    64   3e-10
ZYRO0B01738g Chr2 complement(139975..141453) [1479 bp, 492 aa] {...    64   5e-10
TDEL0A02970 Chr1 complement(532395..533885) [1491 bp, 496 aa] {O...    62   2e-09
AGL061W Chr7 (593647..594882) [1236 bp, 411 aa] {ON} Syntenic ho...    56   1e-07
Kpol_1018.42 s1018 (137162..138889) [1728 bp, 575 aa] {ON} (1371...    55   2e-07
KLLA0E18789g Chr5 (1669103..1670596) [1494 bp, 497 aa] {ON} simi...    53   8e-07
NCAS0A04870 Chr1 (973552..975021) [1470 bp, 489 aa] {ON} Anc_2.5...    51   5e-06
TPHA0C04130 Chr3 complement(886804..888405) [1602 bp, 533 aa] {O...    50   1e-05
Ecym_7266 Chr7 (559988..560022,560112..561630) [1554 bp, 517 aa]...    48   3e-05
Suva_4.548 Chr4 complement(950244..951698) [1455 bp, 484 aa] {ON...    47   7e-05
Skud_2.419 Chr2 complement(746943..748397) [1455 bp, 484 aa] {ON...    47   9e-05
NDAI0K01930 Chr11 (437535..439373) [1839 bp, 612 aa] {ON} Anc_2....    45   2e-04
Smik_2.430 Chr2 complement(763687..765141) [1455 bp, 484 aa] {ON...    45   2e-04
YBR288C Chr2 complement(778012..779463) [1452 bp, 483 aa] {ON}  ...    45   3e-04
CAGL0L02145g Chr12 (252110..253741) [1632 bp, 543 aa] {ON} simil...    44   6e-04
KNAG0A06970 Chr1 complement(1086674..1088191) [1518 bp, 505 aa] ...    42   0.003

>ADR315W Chr4 (1259839..1261317) [1479 bp, 492 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL062C (APM4)
          Length = 492

 Score =  928 bits (2399), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/492 (91%), Positives = 452/492 (91%)

Query: 1   MIDAFFVFAPRGSLIVSKLISGEAKESLSEVFRLQVINGLEIRSPVLTLGSTTFQHIRTS 60
           MIDAFFVFAPRGSLIVSKLISGEAKESLSEVFRLQVINGLEIRSPVLTLGSTTFQHIRTS
Sbjct: 1   MIDAFFVFAPRGSLIVSKLISGEAKESLSEVFRLQVINGLEIRSPVLTLGSTTFQHIRTS 60

Query: 61  GGLWMVVVVRGNADSAAIWEFLYHMNKLLDAYAINTEEALLDDFMLCYELLDVVLDSGLP 120
           GGLWMVVVVRGNADSAAIWEFLYHMNKLLDAYAINTEEALLDDFMLCYELLDVVLDSGLP
Sbjct: 61  GGLWMVVVVRGNADSAAIWEFLYHMNKLLDAYAINTEEALLDDFMLCYELLDVVLDSGLP 120

Query: 121 QDTELSHIVPLLSRKPATGESASGDDFLNSARLRRTGTKNVSVETLDHFSRDVCPWRGEG 180
           QDTELSHIVPLLSRKPATGESASGDDFLNSARLRRTGTKNVSVETLDHFSRDVCPWRGEG
Sbjct: 121 QDTELSHIVPLLSRKPATGESASGDDFLNSARLRRTGTKNVSVETLDHFSRDVCPWRGEG 180

Query: 181 IKYKKNEVYLDVIEKLSLLVNRDGTILKAYVDGTVQCTAHLSGMPLCHFGFNDXXXXXXX 240
           IKYKKNEVYLDVIEKLSLLVNRDGTILKAYVDGTVQCTAHLSGMPLCHFGFND       
Sbjct: 181 IKYKKNEVYLDVIEKLSLLVNRDGTILKAYVDGTVQCTAHLSGMPLCHFGFNDSQSLRQR 240

Query: 241 XXXXXYAPRVFGTDERESVVLEDCKFHQCVQLNKFDQERVIRFVPPDGEFELMKYHIRDD 300
                YAPRVFGTDERESVVLEDCKFHQCVQLNKFDQERVIRFVPPDGEFELMKYHIRDD
Sbjct: 241 SPRRQYAPRVFGTDERESVVLEDCKFHQCVQLNKFDQERVIRFVPPDGEFELMKYHIRDD 300

Query: 301 LRPPFKVTPVVSKVNERSIEYRITLQSLFPTKLSAKDVELYIPAPPYTISAKVNVSCGKC 360
           LRPPFKVTPVVSKVNERSIEYRITLQSLFPTKLSAKDVELYIPAPPYTISAKVNVSCGKC
Sbjct: 301 LRPPFKVTPVVSKVNERSIEYRITLQSLFPTKLSAKDVELYIPAPPYTISAKVNVSCGKC 360

Query: 361 KFVPEENAIIWKIHKFHGLTENTLSAVTIADEQGHYAQVLDQWPRPPISMKLEIMMFXXX 420
           KFVPEENAIIWKIHKFHGLTENTLSAVTIADEQGHYAQVLDQWPRPPISMKLEIMMF   
Sbjct: 361 KFVPEENAIIWKIHKFHGLTENTLSAVTIADEQGHYAQVLDQWPRPPISMKLEIMMFSTA 420

Query: 421 XXXXXXXXXXXXXXXXXXXXXXXXXRALAPTRFATDAEADASAFLSATLSSKTIALHTTT 480
                                    RALAPTRFATDAEADASAFLSATLSSKTIALHTTT
Sbjct: 421 ALSSATSRSWRKTSSTTPSSGSSTSRALAPTRFATDAEADASAFLSATLSSKTIALHTTT 480

Query: 481 THIELGCSKNVD 492
           THIELGCSKNVD
Sbjct: 481 THIELGCSKNVD 492

>Ecym_5239 Chr5 complement(492091..493485) [1395 bp, 464 aa] {ON}
           similar to Ashbya gossypii ADR315W
          Length = 464

 Score =  558 bits (1439), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/426 (61%), Positives = 329/426 (77%), Gaps = 9/426 (2%)

Query: 1   MIDAFFVFAPRGSLIVSKLISGEAKESLSEVFRLQVINGLEIRSPVLTLGSTTFQHIRTS 60
           MI A F+++PRG LI+SKLI    K  +SE+FR+QVIN L++RSP+LTLGSTTF HIR++
Sbjct: 1   MISALFLYSPRGDLIISKLIKDNIKLGVSEIFRIQVINNLDVRSPILTLGSTTFHHIRSN 60

Query: 61  GGLWMVVVVRGNADSAAIWEFLYHMNKLLDAYAINTEEALLDDFMLCYELLDVVLDSGLP 120
           GGLW+V V RGN DSA IWEFLY+ NKLL+ Y IN+E++L  DFMLCYE+LD+VLD+G+P
Sbjct: 61  GGLWLVTVSRGNTDSAGIWEFLYNFNKLLEVYDINSEDSLQGDFMLCYEILDIVLDNGIP 120

Query: 121 QDTELSHIVPLLSRKPATGESASGDDFLNS-ARLRRTGTKNVSVETLDHFSRDVCPWRGE 179
           +DTEL+HI+P +S+KP +      DD LN+ + L + G + +S E L   S+D+C WR E
Sbjct: 121 RDTELTHIMPYISKKPLSENLLGSDDILNTPSWLVKAGARGMSSENLGLTSKDMCLWRSE 180

Query: 180 GIKYKKNEVYLDVIEKLSLLVNRDGTILKAYVDGTVQCTAHLSGMPLCHFGFNDX---XX 236
           GI+YKKNEVYLDV E +S+LVN+DG ILK+YVDG+VQC AHLSGMP+C FGFND      
Sbjct: 181 GIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGSVQCVAHLSGMPVCQFGFNDYLSPSS 240

Query: 237 XXXXXXXXXYAPRVFGTDERE-----SVVLEDCKFHQCVQLNKFDQERVIRFVPPDGEFE 291
                    +A    GT   +     SV+LEDCKFHQCVQL+KFDQERVIRFVPPDG FE
Sbjct: 241 NTQSSGNDGWAEEENGTKAIKNAITGSVILEDCKFHQCVQLDKFDQERVIRFVPPDGLFE 300

Query: 292 LMKYHIRDDLRPPFKVTPVVSKVNERSIEYRITLQSLFPTKLSAKDVELYIPAPPYTISA 351
           LMKYH+RD+L  PFKVTP+V+ +  +S+EYRITL+SLFP+KL AKDVELYIPAPP T++A
Sbjct: 301 LMKYHVRDNLNLPFKVTPMVTTLKGKSVEYRITLKSLFPSKLCAKDVELYIPAPPDTVNA 360

Query: 352 KVNVSCGKCKFVPEENAIIWKIHKFHGLTENTLSAVTIADEQGHYAQVLDQWPRPPISMK 411
           K+NVS GK KF+PEENAI+WKIHK+HGLTEN  SAV +    G+ +  L+QW RPPIS++
Sbjct: 361 KINVSSGKGKFIPEENAIVWKIHKYHGLTENVFSAVIVPMGNGNDSLNLEQWSRPPISVR 420

Query: 412 LEIMMF 417
            EI MF
Sbjct: 421 FEISMF 426

>SAKL0C07414g Chr3 complement(683859..685307) [1449 bp, 482 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 482

 Score =  463 bits (1192), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 230/446 (51%), Positives = 301/446 (67%), Gaps = 31/446 (6%)

Query: 1   MIDAFFVFAPRGSLIVSKLISGEAKESLSEVFRLQVINGLEIRSPVLTLGSTTFQHIRTS 60
           M++A FVF+ +G L+VSKLI    K S++E+FR+QVIN L++RSPVLTLGSTTF HIR+S
Sbjct: 1   MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFRIQVINNLDVRSPVLTLGSTTFHHIRSS 60

Query: 61  GGLWMVVVVRGNADSAAIWEFLYHMNKLLDAYAINTEEALLDDFMLCYELLDVVLDSGLP 120
             LW+V V R NADSAAIWEFLY  N LL+AY +N+EE+L ++FM CYELLDVVL++G+P
Sbjct: 61  SNLWIVAVTRSNADSAAIWEFLYKFNALLEAYGLNSEESLKEEFMTCYELLDVVLENGVP 120

Query: 121 QDTELSHIVPLLSRKPATG--ESASGDDFLNSA--------RLRRTGTKNVSVETL---- 166
            DTELS +   +SR+P      +   D+ L SA        R+ +   K     +     
Sbjct: 121 VDTELSSVASKMSRRPVVSLENNPLTDELLMSAAANVDLGFRMPKFLNKGSRSSSSVSSP 180

Query: 167 ----DHFSRDVCPWRGEGIKYKKNEVYLDVIEKLSLLVNRDGTILKAYVDGTVQCTAHLS 222
               +H      PWR  GIKYKKNE++LDV E++++LV++DG+ILK+YVDG+V  T HLS
Sbjct: 181 ANGDEHGDPCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYVDGSVDLTTHLS 240

Query: 223 GMPLCHFGFNDXXXXXXXXXXXXY---------APRVFGTDERESVVLEDCKFHQCVQLN 273
           G PLC FG ND                        +        SV LEDCKFHQCVQLN
Sbjct: 241 GTPLCQFGLNDSLSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGSVQLEDCKFHQCVQLN 300

Query: 274 KFDQERVIRFVPPDGEFELMKYHIRDDLRPPFKVTPVVS-KVNERSIEYRITLQSLFPTK 332
           +F+ +R+IRFVPPDG FELM+YH+RD+L  PFK+TP+ S + N  ++EYR+ L+SLFP+K
Sbjct: 301 RFNTDRIIRFVPPDGSFELMRYHVRDNLNLPFKITPIFSVRSNNGAVEYRVALKSLFPSK 360

Query: 333 LSAKDVELYIPAPPYTISAKVNVSCGKCKFVPEENAIIWKIHKFHGLTENTLSAVTI-AD 391
           L+AKDV L IP PP T+  K+N S G+C+FVPEENA++WK  K+ GLTENTLSA+T+  D
Sbjct: 361 LTAKDVVLRIPVPPGTVDCKINTSNGRCRFVPEENAVLWKFAKYQGLTENTLSALTVPMD 420

Query: 392 EQGHYAQVLDQWPRPPISMKLEIMMF 417
            Q      L QW RPP+S+  EI+MF
Sbjct: 421 NQSSLN--LQQWSRPPMSLTFEILMF 444

>Kwal_33.14182 s33 complement(560456..561859) [1404 bp, 467 aa] {ON}
           YOL062C (APM4) - Clathrin associated protein, medium
           subunit [contig 105] FULL
          Length = 467

 Score =  461 bits (1185), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 223/441 (50%), Positives = 304/441 (68%), Gaps = 36/441 (8%)

Query: 1   MIDAFFVFAPRGSLIVSKLISGEAKESLSEVFRLQVINGLEIRSPVLTLGSTTFQHIRTS 60
           M++A F+++ RG L++SK + G  ++S+SE+FR+QVIN L++RSPVLTLGSTTF HI+++
Sbjct: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHIKSA 60

Query: 61  GGLWMVVVVRGNADSAAIWEFLYHMNKLLDAYAINTEEALLDDFMLCYELLDVVLDSGLP 120
             LW+V V R NADSAAIWEFLY +N+LL+A+ + +E  L + FM+CYELLD+VL+ GLP
Sbjct: 61  KNLWIVAVSRSNADSAAIWEFLYRLNELLEAFNLYSENELKERFMICYELLDIVLEDGLP 120

Query: 121 QDTELSHIVPLLSRKPATG--------ESASG--DDFLNSARLRRTGTKNVSVETLDHFS 170
            DTELS +   +S KP  G        E+  G  +  L  ++  R      +++ +   +
Sbjct: 121 VDTELSSVASKMSVKPNAGVDNFNMFAENGHGGTNRILPVSQFLRGRPSAGNLQDIASEA 180

Query: 171 RDVCPWRGEGIKYKKNEVYLDVIEKLSLLVNRDGTILKAYVDGTVQCTAHLSGMPLCHFG 230
               PWR  GIKYKKNEV+L+V E++S+LV++DG+ILK+YVDGTV+ T HLSGMP+C FG
Sbjct: 181 PSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMPVCRFG 240

Query: 231 FNDXXXXXXXXXXXXYAPRVFGTDER--------------ESVVLEDCKFHQCVQLNKFD 276
            ND                 FG D+                SV+LEDCKFHQCVQL+KF 
Sbjct: 241 LNDALSVSTP----------FGDDDEYQVTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQ 290

Query: 277 QERVIRFVPPDGEFELMKYHIRDDLRPPFKVTPVVSKVNERSIEYRITLQSLFPTKLSAK 336
            ER I F+ PDG FELMKYH+R++L  PFKVTP+V+ V   SI+Y+IT++SLFP+KL+AK
Sbjct: 291 SERTINFIAPDGSFELMKYHVRENLNLPFKVTPIVTVVRSNSIDYQITIKSLFPSKLTAK 350

Query: 337 DVELYIPAPPYTISAKVNVSCGKCKFVPEENAIIWKIHKFHGLTENTLSAVTIADEQGHY 396
           DV+L IP PP T+S  ++ S GKCKFVPEE+AI+WK  K+ GLTEN++SA  +  +    
Sbjct: 351 DVQLRIPVPPETVSCHISTSNGKCKFVPEESAIVWKFSKYQGLTENSISATAVPMKDSTL 410

Query: 397 AQVLDQWPRPPISMKLEIMMF 417
              ++QWPRPPIS+K EI+MF
Sbjct: 411 N--IEQWPRPPISLKFEIVMF 429

>KLTH0F06534g Chr6 complement(565211..566611) [1401 bp, 466 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 466

 Score =  458 bits (1178), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 222/440 (50%), Positives = 300/440 (68%), Gaps = 35/440 (7%)

Query: 1   MIDAFFVFAPRGSLIVSKLISGEAKESLSEVFRLQVINGLEIRSPVLTLGSTTFQHIRTS 60
           M+ A F+F+ RG L++SK +     +S+SE+FR+QVIN L++RSPVLTLGSTTF H+++ 
Sbjct: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIFRIQVINNLDVRSPVLTLGSTTFHHVKSP 60

Query: 61  GGLWMVVVVRGNADSAAIWEFLYHMNKLLDAYAINTEEALLDDFMLCYELLDVVLDSGLP 120
           G LW+V V R NADSAAIWEFLY ++ LL+A+ +++E  L +DFM CYELLD+VL+ G+P
Sbjct: 61  GNLWIVAVSRSNADSAAIWEFLYKLSALLEAFGLHSENELKEDFMTCYELLDIVLEDGVP 120

Query: 121 QDTELSHIVPLLSRKPATG--------ESASG--DDFLNSARLRRTGTKNVSVETLDHFS 170
            DTELS +   +S KP+          ES +G  +  L  A+  R  + + ++       
Sbjct: 121 VDTELSSVASKMSVKPSASAERINTFIESGNGGTNRILPVAQFLRARSSSSNLHDSHSKV 180

Query: 171 RDVCPWRGEGIKYKKNEVYLDVIEKLSLLVNRDGTILKAYVDGTVQCTAHLSGMPLCHFG 230
               PWR  GIKYKKNEV+L+V E++S+LV++DG+ILK+YVDGTV+ T HLSGMP+C FG
Sbjct: 181 PSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMPVCRFG 240

Query: 231 FNDXXXXXXXXXXXXYAPRVFGTDERE-------------SVVLEDCKFHQCVQLNKFDQ 277
            ND                 FG +E               SV+LEDCKFHQCVQL+KF  
Sbjct: 241 LNDSLSVSTP----------FGDNESPTTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQS 290

Query: 278 ERVIRFVPPDGEFELMKYHIRDDLRPPFKVTPVVSKVNERSIEYRITLQSLFPTKLSAKD 337
           ER I F+PPDG FELMKYH+R++L  PFK+TPVV+     SI+YR+T++SLFP+KL+AKD
Sbjct: 291 ERTINFIPPDGSFELMKYHVRENLNLPFKITPVVTLFKANSIDYRVTIKSLFPSKLTAKD 350

Query: 338 VELYIPAPPYTISAKVNVSCGKCKFVPEENAIIWKIHKFHGLTENTLSAVTIADEQGHYA 397
           V+L IP PP T+   ++ S G+CKFVPEE+AIIWK  K+ GLTEN+LSA  +  +    A
Sbjct: 351 VQLRIPVPPETVDCHISTSNGRCKFVPEESAIIWKFSKYQGLTENSLSATAVPMKDS--A 408

Query: 398 QVLDQWPRPPISMKLEIMMF 417
             +DQW +PP+S+K EI+MF
Sbjct: 409 LNIDQWSKPPMSLKFEIVMF 428

>ZYRO0B04840g Chr2 (389669..391099) [1431 bp, 476 aa] {ON} highly
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 476

 Score =  451 bits (1160), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 229/442 (51%), Positives = 295/442 (66%), Gaps = 29/442 (6%)

Query: 1   MIDAFFVFAPRGSLIVSKLISGEAKESLSEVFRLQVINGLEIRSPVLTLGSTTFQHIRTS 60
           MI+A F+++ RG LIVSKL +   K S+S++FR+QVIN L++RSP+LTLGSTTF HIR++
Sbjct: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSN 60

Query: 61  GG--LWMVVVVRGNADSAAIWEFLYHMNKLLDAYAINTEEALLDDFMLCYELLDVVLDSG 118
           G   LW+V V R NA+S AIWEFLY  N +LDAY +  EE L +DFM+CYE+LDVV+ +G
Sbjct: 61  GSDSLWIVTVSRTNANSGAIWEFLYKFNAILDAYDLTKEEKLKEDFMICYEILDVVIGAG 120

Query: 119 -LPQDTELSHIVPLLSRKPATGESASGDDFLNSARLRRTGTKNVSVETLD---------- 167
            +P DTEL  I   +S KP      S +    S+ +      N+S   L           
Sbjct: 121 GIPMDTELGSIASKISVKPPKSGGTSSEP--KSSTVANFPGSNLSTSNLSMPKFLTRNNR 178

Query: 168 HFSRDVC-------PWRGEGIKYKKNEVYLDVIEKLSLLVNRDGTILKAYVDGTVQCTAH 220
             S+D+        PWR  GIKYKKNEV+L V EK+++LV+RDG+ILKAYVDGT+  T H
Sbjct: 179 SMSQDLGTNYPSNFPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDGTIDMTTH 238

Query: 221 LSGMPLCHFGFNDXXXXXX-----XXXXXXYAPRVFGTDERESVVLEDCKFHQCVQLNKF 275
           LSG P+C FG ND                 +  +        SV+LEDCKFHQCV L+KF
Sbjct: 239 LSGTPICQFGLNDSPSVEFGDSLWLDTQEFHNKKAVPKAAAGSVMLEDCKFHQCVSLDKF 298

Query: 276 DQERVIRFVPPDGEFELMKYHIRDDLRPPFKVTPVVSKVNERSIEYRITLQSLFPTKLSA 335
           ++ER+I+FVPPDG  ELMKY +RD+L  PFK+TPVV+     ++EYRITL+SLFP KLSA
Sbjct: 299 NKERIIKFVPPDGNMELMKYCVRDNLNLPFKITPVVTPCGS-TVEYRITLKSLFPNKLSA 357

Query: 336 KDVELYIPAPPYTISAKVNVSCGKCKFVPEENAIIWKIHKFHGLTENTLSAVTIADEQGH 395
           KDV L+IP PP T+  K+N+S GKCKF  EENA++W+ +K+HGLTENTLSAVT+      
Sbjct: 358 KDVALHIPVPPGTVDCKINISNGKCKFESEENAMVWRFNKYHGLTENTLSAVTVPTSDTT 417

Query: 396 YAQVLDQWPRPPISMKLEIMMF 417
               L QWPRPP+S+  EIMMF
Sbjct: 418 -QLTLQQWPRPPMSLGFEIMMF 438

>TDEL0D04580 Chr4 (840369..841817) [1449 bp, 482 aa] {ON} Anc_3.165
           YOL062C
          Length = 482

 Score =  434 bits (1116), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 225/446 (50%), Positives = 293/446 (65%), Gaps = 31/446 (6%)

Query: 1   MIDAFFVFAPRGSLIVSKLISGEAKESLSEVFRLQVINGLEIRSPVLTLGSTTFQHIRTS 60
           MI A  +F+ RG LIV+K +    K+S+S++FR+QVIN L++RSP+LTLGSTTF HIR+ 
Sbjct: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIFRIQVINNLDVRSPILTLGSTTFHHIRSD 60

Query: 61  GG--LWMVVVVRGNADSAAIWEFLYHMNKLLDAYAINTEEALLDDFMLCYELLDVVLD-S 117
           G   LW+V V R NA+S AIWEFLY +N ++D Y +  E  L ++FM CYE+LD VL+  
Sbjct: 61  GSDSLWLVAVSRSNANSGAIWEFLYKLNVIMDVYGLTKEGTLKENFMNCYEILDTVLEEG 120

Query: 118 GLPQDTELSHIVPLLSRKPA---TGESASGDDFLNSARLRRTGTKNVSVETLD------- 167
           G+P DTEL+ ++  ++ KP    +G      D L  + L  + T   S  TL        
Sbjct: 121 GIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLTMSSLNLS-TPGDSSSTLSMPKFLTR 179

Query: 168 ---HFSRDV-------CPWRGEGIKYKKNEVYLDVIEKLSLLVNRDGTILKAYVDGTVQC 217
                S+D+         WR  GIKYKKNEV L+V EK+S+LV+RDG+ILK+YVDGT+  
Sbjct: 180 NNRSMSQDLGSNYPSNLSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVDGTIDL 239

Query: 218 TAHLSGMPLCHFGFNDXXXXX----XXXXXXXYA-PRVFGTDERESVVLEDCKFHQCVQL 272
           T HLSGMP+C FG ND                +A  +         V+LEDCKFHQCV L
Sbjct: 240 TTHLSGMPICQFGLNDSLSVEFGDDSISEVEDFANKKAIPKAAAGRVMLEDCKFHQCVSL 299

Query: 273 NKFDQERVIRFVPPDGEFELMKYHIRDDLRPPFKVTPVVSKVNE-RSIEYRITLQSLFPT 331
           +KF+++RVI+FVPPDG  ELMKY +RD+L  PFKVTP+V+ +    +I+YR+TL+SLFP 
Sbjct: 300 DKFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKVTPIVTSIGRGNTIDYRVTLKSLFPG 359

Query: 332 KLSAKDVELYIPAPPYTISAKVNVSCGKCKFVPEENAIIWKIHKFHGLTENTLSAVTIAD 391
           KLSAKDV L IP PP T+  ++NVS GKCKFVPEE+A+IWK  K+ GLTENTLSAVT+  
Sbjct: 360 KLSAKDVSLRIPVPPGTVDCEINVSNGKCKFVPEESAMIWKFTKYTGLTENTLSAVTVPS 419

Query: 392 EQGHYAQVLDQWPRPPISMKLEIMMF 417
                  V  QWPRPP+S+  EIMMF
Sbjct: 420 SDTTQLTV-QQWPRPPMSLNFEIMMF 444

>Kpol_1045.44 s1045 complement(103089..104498) [1410 bp, 469 aa]
           {ON} complement(103091..104500) [1410 nt, 470 aa]
          Length = 469

 Score =  427 bits (1097), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 220/443 (49%), Positives = 298/443 (67%), Gaps = 38/443 (8%)

Query: 1   MIDAFFVFAPRGSLIVSKLISGEAKESLSEVFRLQVINGLEIRSPVLTLGSTTFQHIRTS 60
           MI+   V+  +G LIVSK     AK S+S++FR+QVIN L++RSP+LTLGSTTF HIR++
Sbjct: 1   MINGVLVYTGKGELIVSKFSKSNAKRSISDIFRVQVINNLDVRSPILTLGSTTFHHIRSN 60

Query: 61  G--GLWMVVVVRGNADSAAIWEFLYHMNKLLDAYAINTEEALLDDFMLCYELLDVVLD-S 117
               LW+V V R NA+S AIWEFLY  + LL+A+ ++ E  L ++FM CYELLD++L+  
Sbjct: 61  SRDHLWLVAVTRSNANSGAIWEFLYKFDSLLNAFGLDNETTLKEEFMTCYELLDLMLNVD 120

Query: 118 GLPQDTELSHIVPLLSRKPATGESASGDDFLNS-------ARLRRTGTKNVSVETLDHFS 170
           G+P DTELS +   +S KP    ++  D  L++       ++      +++SV+T++   
Sbjct: 121 GVPLDTELSSVSAKMSTKPLHSINSPSDSSLDNSSSPLSISKFLNRNNRSMSVDTMNTEP 180

Query: 171 RDVCPWRGEGIKYKKNEVYLDVIEKLSLLVNRDGTILKAYVDGTVQCTAHLSGMPLCHFG 230
            +  PWR  GIKYKKNE++L++ EK+S+LV++D TILKAYVDGTV  T+HLSG P C FG
Sbjct: 181 SNY-PWRPNGIKYKKNEIFLNINEKISILVSKDETILKAYVDGTVDLTSHLSGTPTCQFG 239

Query: 231 FNDXXXXXXXXXXXXYAPRVFGTDERE-------------SVVLEDCKFHQCVQLNKFDQ 277
            ND              P  + +D+               +VVLEDCKFH+CV L+KF++
Sbjct: 240 LNDSLSVD--------EPNYYNSDDNGFRNQQNIPRATAGTVVLEDCKFHECVSLDKFNR 291

Query: 278 ERVIRFVPPDGEFELMKYHIRDDLRPPFKVTPVVSKVNERS---IEYRITLQSLFPTKLS 334
           +R+I+FVPPDG  ELMKYH+RD++  PFKVTP V  +N RS   ++YRITL+SLFP+KLS
Sbjct: 292 DRIIKFVPPDGHIELMKYHVRDNINLPFKVTPNV--INSRSRTGLDYRITLKSLFPSKLS 349

Query: 335 AKDVELYIPAPPYTISAKVNVSCGKCKFVPEENAIIWKIHKFHGLTENTLSAVTIADEQG 394
           A DV L IP P  T+  K+NVS GKC+FVPEE+ IIWK  K++GLTEN LSAVT++    
Sbjct: 350 ANDVVLKIPVPSSTVDCKLNVSNGKCRFVPEESCIIWKFAKYNGLTENKLSAVTVSSNDT 409

Query: 395 HYAQVLDQWPRPPISMKLEIMMF 417
               +L QW RPPIS+  EIMMF
Sbjct: 410 T-QLMLQQWARPPISLDFEIMMF 431

>YOL062C Chr15 complement(210520..211995) [1476 bp, 491 aa] {ON}
           APM4Mu2-like subunit of the clathrin associated protein
           complex (AP-2); involved in vesicle transport
          Length = 491

 Score =  418 bits (1074), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 214/454 (47%), Positives = 298/454 (65%), Gaps = 38/454 (8%)

Query: 1   MIDAFFVFAPRGSLIVSKLISGEAKESLSEVFRLQVINGLEIRSPVLTLGSTTFQHIRTS 60
           MI    V++ RG L+++K      K S+S++FR+QVIN L++RSPVLTLGSTTF HIR+ 
Sbjct: 1   MISGVLVYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSR 60

Query: 61  GG--LWMVVVVRGNADSAAIWEFLYHMNKLLDAYAINTEEALLDDFMLCYELLDVVLD-S 117
            G  LW+V + R NA+SAAIWEFLY ++ +++AY ++ EEAL ++FM+ +E+LD++L  +
Sbjct: 61  HGDNLWLVTITRSNANSAAIWEFLYKLDAVMNAYRLDREEALKEEFMIVHEMLDIMLGGN 120

Query: 118 GLPQDTELSHIVPLLSRKPATG-----ESASGDDFLNSARL----------------RRT 156
           G+P DTEL+ ++  +S KP        +S  G+D L+S+                  R +
Sbjct: 121 GIPIDTELNSVIAQMSVKPVRNMGGLLDSPDGNDVLSSSSSPTSSAGELHFPKFLTKRSS 180

Query: 157 GTKNVSVETLDHFSRDVCPWRGEGIKYKKNEVYLDVIEKLSLLVNRDGTILKAYVDGTVQ 216
                   T D +  +   WR +GI +KK+EV+L V E++++LV+RDG+ILK+YVDGT+ 
Sbjct: 181 SFLGQGDSTSDFYDNNKITWRPKGIIHKKDEVFLYVNERINILVSRDGSILKSYVDGTID 240

Query: 217 CTAHLSGMPLCHFGFNDXXXXXXXXXXXXYAP--RVFGTD----------ERESVVLEDC 264
            T HLSG P+C FG ND             A   R  G+D             SV+LEDC
Sbjct: 241 ITTHLSGTPICRFGLNDSLGMQSEDEKKWLAQQQRHSGSDFGNKNFIPKAAAGSVLLEDC 300

Query: 265 KFHQCVQLNKFDQERVIRFVPPDGEFELMKYHIRDDLRPPFKVTPVVS-KVNERSIEYRI 323
           KFH+CV L+KF++  +I FVPPDG  ELMKYH+RD++  PFKVTP+V+    +  I+YRI
Sbjct: 301 KFHECVSLDKFNRNHIIEFVPPDGSMELMKYHVRDNINLPFKVTPIVTHSTRDNEIDYRI 360

Query: 324 TLQSLFPTKLSAKDVELYIPAPPYTISAKVNVSCGKCKFVPEENAIIWKIHKFHGLTENT 383
           TL+SLFP KLSAKDV L+IP PP T+  K++VS G CKFVPEENA+IW+ +K++GLTENT
Sbjct: 361 TLKSLFPGKLSAKDVVLHIPVPPSTVDCKISVSNGHCKFVPEENAMIWRFNKYNGLTENT 420

Query: 384 LSAVTIADEQGHYAQVLDQWPRPPISMKLEIMMF 417
           LSAVT++         L QW RPPIS++ E+MMF
Sbjct: 421 LSAVTVSTSDTTQLN-LQQWTRPPISLEFEVMMF 453

>NCAS0C03580 Chr3 complement(715761..717236) [1476 bp, 491 aa] {ON}
           Anc_3.165
          Length = 491

 Score =  417 bits (1073), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 214/459 (46%), Positives = 301/459 (65%), Gaps = 48/459 (10%)

Query: 1   MIDAFFVFAPRGSLIVSKLISGEAKESLSEVFRLQVINGLEIRSPVLTLGSTTFQHIRTS 60
           MI+A  +F  RG L+VSKL  G  K S++++FR+QVIN L++RSP+LTLGSTTF HI+++
Sbjct: 1   MINALLIFTARGELVVSKLFKGSMKRSIADIFRIQVINNLDVRSPILTLGSTTFHHIKST 60

Query: 61  GG--LWMVVVVRGNADSAAIWEFLYHMNKLLDAYAINTEEALLDDFMLCYELLDVVL--D 116
            G  LW+V V R N DSAAIWEFLY ++ LLD+Y +N EE L ++FM+ +ELLDV++   
Sbjct: 61  RGDNLWIVAVSRNNVDSAAIWEFLYKLDSLLDSYGLNHEEYLKEEFMIVHELLDVMMCGS 120

Query: 117 SGLPQDTELSHIVPLLSRKPATG-------------------ESASGDDFLNSARLRRTG 157
            G+P  TE S ++  +S KP+                      +   D  ++  +L R  
Sbjct: 121 GGIPMLTENSLVISRMSVKPSKSILEAQNSGNGSSNTNSNNNNNNVPDLLMSGPKLLRRN 180

Query: 158 TKNVS--VETLDHFSRDVCPWRGEGIKYKKNEVYLDVIEKLSLLVNRDGTILKAYVDGTV 215
           + ++S  +  L  F      WR +GI +KKNEV L V E++++LV++DG++LKAYVDG++
Sbjct: 181 SASLSQDLSILTDFK-----WRPKGIVHKKNEVILHVNERINILVSKDGSVLKAYVDGSI 235

Query: 216 QCTAHLSGMPLCHFGFNDXXXXXXXXXXXXYA---PRVFG------TDERE-------SV 259
               HLSG P+C FG ND             +      FG      TD+++       SV
Sbjct: 236 DLETHLSGTPICQFGLNDSLSVSGVDSDMYGSHNHNHHFGDVNFDKTDKKQLSMASVGSV 295

Query: 260 VLEDCKFHQCVQLNKFDQERVIRFVPPDGEFELMKYHIRDDLRPPFKVTPVVSKV-NERS 318
           +LEDCKFHQCV L+KFD++R+I+FVPPDG  ELMKYH+RD+L  PFKV+P+V+   N  +
Sbjct: 296 ILEDCKFHQCVSLDKFDKDRIIKFVPPDGSMELMKYHVRDNLNLPFKVSPIVTNTRNGTA 355

Query: 319 IEYRITLQSLFPTKLSAKDVELYIPAPPYTISAKVNVSCGKCKFVPEENAIIWKIHKFHG 378
           +EYRIT++SLFP +LSAK+V L+IP PP T+  K+NV+ G CKF+PEE+A+IW+ +KF+G
Sbjct: 356 LEYRITMKSLFPGRLSAKNVALHIPVPPNTMDCKINVTNGSCKFIPEESAMIWRFNKFNG 415

Query: 379 LTENTLSAVTIADEQGHYAQVLDQWPRPPISMKLEIMMF 417
           LTENTLSAVTI  +       L QW +PP+S+  EI+MF
Sbjct: 416 LTENTLSAVTIPTKDNTQLS-LQQWSKPPMSLDFEILMF 453

>NDAI0G02920 Chr7 complement(676413..677873) [1461 bp, 486 aa] {ON}
           Anc_3.165
          Length = 486

 Score =  415 bits (1066), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 214/451 (47%), Positives = 294/451 (65%), Gaps = 37/451 (8%)

Query: 1   MIDAFFVFAPRGSLIVSKLISGEAKESLSEVFRLQVINGLEIRSPVLTLGSTTFQHIRTS 60
           MI+   +++PRG LIVSKL  G  K S++++FR+QVIN L++RSP+LTLGSTTF HIR+S
Sbjct: 1   MINGILIYSPRGELIVSKLFKGTLKRSIADIFRIQVINNLDVRSPILTLGSTTFHHIRSS 60

Query: 61  ---GGLWMVVVVRGNADSAAIWEFLYHMNKLLDAYAINTEEALLDDFMLCYELLDVVLDS 117
                LW+V   R NA+SAAIWEFLY ++ +L  Y +N EE L ++FM+ +ELLDV+L S
Sbjct: 61  KDSDNLWLVAATRNNANSAAIWEFLYKLDSMLIEYGLNKEEYLKEEFMIVHELLDVMLGS 120

Query: 118 -GLPQDTELSHIVPLLSRKPATGESASGDDFL---------NSARLRRTGTKNVSVETLD 167
            G+P +TE S ++  +S KPA     +    L         N   + +   +N S ++ D
Sbjct: 121 CGIPLETEPSKVIAKMSVKPAKLHHNNTSSLLDGHLGSKGNNEISMPKFLKRNDSSQSHD 180

Query: 168 -HFSRDVCPWRGEGIKYKKNEVYLDVIEKLSLLVNRDGTILKAYVDGTVQCTAHLSGMPL 226
            +FS +   WR + IK+KKNEV L V EK+++LV +DG+ILKAYVDG++     LSG P+
Sbjct: 181 SNFSFNDFSWRPKDIKHKKNEVILHVNEKINILVAKDGSILKAYVDGSIDLQTRLSGTPV 240

Query: 227 CHFGFNDXXXXXXXXXXXXYAPRVFGTDERES-------------------VVLEDCKFH 267
           C FG ND            Y+ R   T   +S                   V+LEDCKFH
Sbjct: 241 CQFGLNDSLTLGSNDSE--YSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVILEDCKFH 298

Query: 268 QCVQLNKFDQERVIRFVPPDGEFELMKYHIRDDLRPPFKVTPVVSK-VNERSIEYRITLQ 326
           QCV L+KFD+ER+I+FVPPDG  ELMKYHIR++L  PFK+TP+V+  V   +++YRI L+
Sbjct: 299 QCVSLDKFDRERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIVTNSVTGDALDYRIALK 358

Query: 327 SLFPTKLSAKDVELYIPAPPYTISAKVNVSCGKCKFVPEENAIIWKIHKFHGLTENTLSA 386
           SLFP +LSAK V L+IP PP  +   ++VS G CKFVP ENA++WK +K++GLTENTLSA
Sbjct: 359 SLFPGRLSAKGVVLHIPVPPGVMDCNISVSNGTCKFVPAENAMVWKFNKYNGLTENTLSA 418

Query: 387 VTIADEQGHYAQVLDQWPRPPISMKLEIMMF 417
           VT+  ++ +    L QW RPP+S+  EI+MF
Sbjct: 419 VTVPSKEVNQT-TLQQWARPPMSLDFEILMF 448

>CAGL0C05203g Chr3 (496561..497988) [1428 bp, 475 aa] {ON} highly
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062c APM4
          Length = 475

 Score =  411 bits (1057), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 208/442 (47%), Positives = 291/442 (65%), Gaps = 29/442 (6%)

Query: 1   MIDAFFVFAPRGSLIVSKLISGEAKESLSEVFRLQVINGLEIRSPVLTLGSTTFQHIRTS 60
           MI A  VF+ RG LIVSK      K S+S++FR+QVIN L++RSP+LTLGSTTFQHIR++
Sbjct: 1   MISAVLVFSSRGELIVSKFFKNNLKRSISDIFRIQVINNLDVRSPILTLGSTTFQHIRSN 60

Query: 61  ---GGLWMVVVVRGNADSAAIWEFLYHMNKLLDAYAINTEEALLDDFMLCYELLDVVL-D 116
                LW+V V R N +  A+WEFLY  + +L+ Y +N EE L ++FM+CYELLDV+L +
Sbjct: 61  VHGDDLWLVSVTRSNINCGAVWEFLYKFDHMLELYGLNNEEFLKEEFMVCYELLDVMLGE 120

Query: 117 SGLPQDTELSHIVPLLSRKPATGESASGDDFLNSAR------------LRRTGT---KNV 161
           +G P DT+ + ++  +S KP+     + ++F  S +            LRRT +   +  
Sbjct: 121 NGTPMDTDPATVIKKMSVKPS---KETIENFAISVQNKNSTLPKIPKFLRRTSSFLNQES 177

Query: 162 SVETLDHFSR-DVCPWRGEGIKYKKNEVYLDVIEKLSLLVNRDGTILKAYVDGTVQCTAH 220
           S  +   F+     PWR +GI +KKNE++L V EK+S+LV+++G+ILK+YVDGT+    H
Sbjct: 178 SNNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSYVDGTIDLVTH 237

Query: 221 LSGMPLCHFGFNDXXXXXXXXXXXXY----APRVFGTDERESVVLEDCKFHQCVQLNKFD 276
           LSG P+C FG ND            +      +        SV+LEDCKFHQCV L KFD
Sbjct: 238 LSGTPVCQFGLNDSLSVKNDDYGDSFDYIKNKKAIPKAAAGSVLLEDCKFHQCVSLEKFD 297

Query: 277 QERVIRFVPPDGEFELMKYHIRDDLRPPFKVTPVVSKVNE-RSIEYRITLQSLFPTKLSA 335
           ++R+I+FVPPDG  ELMKYH+R ++  PFKV+P+V+  +   ++EYRITL+SLFP+KL+A
Sbjct: 298 KDRIIKFVPPDGSMELMKYHVRSNINLPFKVSPIVTYSSSGTAVEYRITLKSLFPSKLTA 357

Query: 336 KDVELYIPAPPYTISAKVNVSCGKCKFVPEENAIIWKIHKFHGLTENTLSAVTIADEQGH 395
           K+V + IP PP T+  K++VS G CKF PEE A++W  +K++GLTENTLSAVTI  +   
Sbjct: 358 KNVTMKIPVPPETLDCKIDVSNGSCKFAPEEKAMLWTFNKYNGLTENTLSAVTITSKDAP 417

Query: 396 YAQVLDQWPRPPISMKLEIMMF 417
              +  QW +PPIS+  EIMMF
Sbjct: 418 RLNI-QQWQKPPISLDFEIMMF 438

>Smik_15.96 Chr15 complement(174750..176225) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  411 bits (1056), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 210/454 (46%), Positives = 301/454 (66%), Gaps = 38/454 (8%)

Query: 1   MIDAFFVFAPRGSLIVSKLISGEAKESLSEVFRLQVINGLEIRSPVLTLGSTTFQHIRTS 60
           MI    +++ RG L+++K      K S+S++FR+QVIN L++RSPVLTLGSTTF HIR+ 
Sbjct: 1   MISGVLIYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSR 60

Query: 61  GG--LWMVVVVRGNADSAAIWEFLYHMNKLLDAYAINTEEALLDDFMLCYELLDVVLD-S 117
            G  LW+V + R NA+SAAIWEFLY ++ +++AY ++ EEAL ++FM+ +E+LD++L  +
Sbjct: 61  HGDNLWLVTITRSNANSAAIWEFLYKLDFVMNAYRLDREEALKEEFMIVHEMLDIMLGGN 120

Query: 118 GLPQDTELSHIVPLLSRKPA--TG---ESASGDDFLNSAR--------------LRRTGT 158
           G+P DTEL+ ++  +S KP   TG   +S  G+D L+S+               L+++ +
Sbjct: 121 GIPIDTELNSVIAQMSVKPVRNTGGLLDSPDGNDMLSSSSSPSSVSGELHFPKFLKKSSS 180

Query: 159 KNVSV--ETLDHFSRDVCPWRGEGIKYKKNEVYLDVIEKLSLLVNRDGTILKAYVDGTVQ 216
             +       D +  +   WR +GI +KK+EV+L V E++++LV+RDG+ILK+YVDGT+ 
Sbjct: 181 SFLGQGDSASDFYDGNKITWRPKGITHKKDEVFLYVNERMNILVSRDGSILKSYVDGTID 240

Query: 217 CTAHLSGMPLCHFGFNDXXXXXXXXXXXXYAPRVF---GTDERE---------SVVLEDC 264
            T HLSG P+C FG ND             A +     G  E +         SV+LEDC
Sbjct: 241 ITTHLSGTPICRFGLNDSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHKAAAGSVLLEDC 300

Query: 265 KFHQCVQLNKFDQERVIRFVPPDGEFELMKYHIRDDLRPPFKVTPVVS-KVNERSIEYRI 323
           KFH+CV L+KF++   I FVPPDG  ELMKYH+RD++  PFK+TP+V+    +  I+YRI
Sbjct: 301 KFHECVSLDKFNKNHTIEFVPPDGSMELMKYHVRDNINLPFKITPIVTHSTRDNEIDYRI 360

Query: 324 TLQSLFPTKLSAKDVELYIPAPPYTISAKVNVSCGKCKFVPEENAIIWKIHKFHGLTENT 383
           TL+SLFP KLSAKDV L+IP PP T+  K++VS G CKFVPEENA++W+ +K++GLTENT
Sbjct: 361 TLKSLFPGKLSAKDVTLHIPVPPSTVDCKISVSNGHCKFVPEENAMMWRFNKYNGLTENT 420

Query: 384 LSAVTIADEQGHYAQVLDQWPRPPISMKLEIMMF 417
           LSAVT++         L QW RPP+S+  E+MMF
Sbjct: 421 LSAVTVSTSDTTQLN-LQQWTRPPMSLDFEVMMF 453

>Skud_15.91 Chr15 complement(169608..171083) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  410 bits (1055), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 210/454 (46%), Positives = 296/454 (65%), Gaps = 38/454 (8%)

Query: 1   MIDAFFVFAPRGSLIVSKLISGEAKESLSEVFRLQVINGLEIRSPVLTLGSTTFQHIRTS 60
           MI    V++ RG LI++K      K S+S++FR+QVIN L++RSPVLTLGSTTF HIR+ 
Sbjct: 1   MISGVLVYSSRGELILNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSK 60

Query: 61  GG--LWMVVVVRGNADSAAIWEFLYHMNKLLDAYAINTEEALLDDFMLCYELLDVVLD-S 117
            G  LW+V + R NA+SAAIWEFLY ++ +++AY ++ EEAL ++FM+ +E+LD++L  +
Sbjct: 61  HGDNLWLVTITRSNANSAAIWEFLYKLDAVMNAYRLDREEALKEEFMIVHEMLDIMLGGN 120

Query: 118 GLPQDTELSHIVPLLSRKPA--TG---ESASGDDFLNSAR--------------LRRTGT 158
           G+P DTEL+ +V  +S KP   TG   + A G D L+S+               L+++ +
Sbjct: 121 GIPIDTELNSVVARMSVKPMRNTGGLLDGADGSDILSSSSSPSSAGGELHFPKFLKKSSS 180

Query: 159 KNVSV--ETLDHFSRDVCPWRGEGIKYKKNEVYLDVIEKLSLLVNRDGTILKAYVDGTVQ 216
             +     T D +  +   WR  GI +KK+EV+L V E++++LV+RDG+ILK+YVDGT+ 
Sbjct: 181 SFLGQGDSTSDFYDSNKITWRATGIIHKKDEVFLYVNERMNILVSRDGSILKSYVDGTID 240

Query: 217 CTAHLSGMPLCHFGFNDXXXXXXXXXXXXYAPRV------FGTDE------RESVVLEDC 264
              HL+G P+C FG ND             A +       FG           SV+LEDC
Sbjct: 241 IVTHLNGTPVCRFGLNDSLGMQSEDEKNWLAQQHQHSRSDFGNKNFLPKAAAGSVLLEDC 300

Query: 265 KFHQCVQLNKFDQERVIRFVPPDGEFELMKYHIRDDLRPPFKVTPVVS-KVNERSIEYRI 323
           KFH+CV + KF++  +I F+PPDG  ELMKYH+RD++  PFK+TP+VS    +  I+YRI
Sbjct: 301 KFHECVSIEKFNKNHIIEFIPPDGSMELMKYHVRDNINLPFKITPIVSHSTRDNEIDYRI 360

Query: 324 TLQSLFPTKLSAKDVELYIPAPPYTISAKVNVSCGKCKFVPEENAIIWKIHKFHGLTENT 383
           TL+SLFP KLSAKDV L+IP PP T+  K++VS G CKFVPEENA+IW+ +K++GLTENT
Sbjct: 361 TLKSLFPGKLSAKDVILHIPVPPSTVDCKISVSNGHCKFVPEENAMIWRFNKYNGLTENT 420

Query: 384 LSAVTIADEQGHYAQVLDQWPRPPISMKLEIMMF 417
           LSA T++           QW RPP+S+  E+MMF
Sbjct: 421 LSAATVSTSDTTQLS-FQQWTRPPMSLDFEVMMF 453

>Suva_15.103 Chr15 complement(183026..184501) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  407 bits (1046), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 209/454 (46%), Positives = 295/454 (64%), Gaps = 38/454 (8%)

Query: 1   MIDAFFVFAPRGSLIVSKLISGEAKESLSEVFRLQVINGLEIRSPVLTLGSTTFQHIRTS 60
           MI    V++ RG LI++K      K S+S++FR+QVIN L++RSPVLTLGSTTF HIR+ 
Sbjct: 1   MISGVLVYSSRGELILNKFFKNSLKRSISDIFRVQVINNLDVRSPVLTLGSTTFHHIRSM 60

Query: 61  GG--LWMVVVVRGNADSAAIWEFLYHMNKLLDAYAINTEEALLDDFMLCYELLDVVLD-S 117
            G  LW+V + R NA+SAAIWEFLY ++ +++AY ++ EEAL ++FM+ +E+LD++L  +
Sbjct: 61  RGDNLWLVTITRSNANSAAIWEFLYKLDSVMNAYRLDREEALKEEFMIVHEMLDIMLGGN 120

Query: 118 GLPQDTELSHIVPLLSRKPATG-----ESASGDDFLNSARL---------------RRTG 157
           G+P DTEL+ ++  +S KP        ES    D L+S                  +R+ 
Sbjct: 121 GIPIDTELNSVIAQMSVKPIRNVGGLLESPDSIDMLSSTSSPSSVGGELHFPKFLKKRSS 180

Query: 158 TKNVSVETLDHFSR-DVCPWRGEGIKYKKNEVYLDVIEKLSLLVNRDGTILKAYVDGTVQ 216
           +     ++   FS  +   WR +GI +KK+EV+L V E++++LV+RDG+ILK+YVDGT+ 
Sbjct: 181 SFLGQGDSHSDFSDGNKIAWRPKGIIHKKDEVFLYVNERMNILVSRDGSILKSYVDGTID 240

Query: 217 CTAHLSGMPLCHFGFNDXXXXXXXXXXXXYAPR------------VFGTDERESVVLEDC 264
            T HLSG P+C FG ND             + +             F      SV+LEDC
Sbjct: 241 ITTHLSGTPVCRFGLNDSLGMQSEDQENWLSQQDQHSHNGFENKNCFPKAAAGSVLLEDC 300

Query: 265 KFHQCVQLNKFDQERVIRFVPPDGEFELMKYHIRDDLRPPFKVTPVVS-KVNERSIEYRI 323
           KFH+CV ++KF++  +I FVPPDG  ELMKYH+RD++  PFK+TP+V+    +  ++YRI
Sbjct: 301 KFHECVSIDKFNKNHIIEFVPPDGSMELMKYHVRDNINLPFKITPIVAHSARDNEVDYRI 360

Query: 324 TLQSLFPTKLSAKDVELYIPAPPYTISAKVNVSCGKCKFVPEENAIIWKIHKFHGLTENT 383
           TL+SLFP KLSAKDV L+IP PP T+  K++VS G CKFVPEENA+IW+ +KF+GLTENT
Sbjct: 361 TLKSLFPGKLSAKDVILHIPVPPSTVDCKISVSNGNCKFVPEENAMIWRFNKFNGLTENT 420

Query: 384 LSAVTIADEQGHYAQVLDQWPRPPISMKLEIMMF 417
           LSAVT++         L QW RPP+S+  E+MMF
Sbjct: 421 LSAVTVSTSDTTQLS-LQQWTRPPMSLDFEVMMF 453

>TBLA0F00840 Chr6 (213915..215360) [1446 bp, 481 aa] {ON} Anc_3.165
           YOL062C
          Length = 481

 Score =  405 bits (1042), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 205/448 (45%), Positives = 286/448 (63%), Gaps = 36/448 (8%)

Query: 1   MIDAFFVFAPRGSLIVSKLISGEAKESLSEVFRLQVINGLEIRSPVLTLGSTTFQHIRTS 60
           MI+A  +F PRG L+V K+     K ++S++FR+QVIN   IRSP+LTLGSTTF  IRT+
Sbjct: 1   MINAVMIFTPRGELLVFKVFKSSVKRTISDIFRVQVINNDNIRSPILTLGSTTFHFIRTT 60

Query: 61  GG--LWMVVVVRGNADSAAIWEFLYHMNKLLDAYAINTEEALLDDFMLCYELLDVVLD-S 117
            G  LW+V V R NADS AIWE+LY +N L++ Y +  E+ L D+F++C+ELLD+ L  +
Sbjct: 61  AGSKLWLVAVTRSNADSGAIWEYLYKLNSLMEVYGLTHEDILKDEFIVCHELLDITLGMN 120

Query: 118 GLPQDTELSHIVPLLSRKPATGESASGD--DFLNSAR---------------LRRTGTKN 160
           GLP DTELS ++  ++ KPA   ++S D  D L S+                L R   ++
Sbjct: 121 GLPMDTELSSVIGKMTLKPAQVLTSSADRSDILASSVTTLGHNSTPISMPKFLSRNSNRS 180

Query: 161 VSVETLDHFSRDVCPWRGEGIKYKKNEVYLDVIEKLSLLVNRDGTILKAYVDGTVQCTAH 220
           V+ E    FS    PWR   IKYKKNE+ ++VIEK+++LV +D  IL+AYVDGT+  TAH
Sbjct: 181 VTQEFESQFSPSNIPWRSRDIKYKKNEMIVNVIEKINVLVGKDDNILRAYVDGTIDITAH 240

Query: 221 LSGMPLCHFGFNDXXXXXX----------XXXXXXYAPRVFGTDERESVVLEDCKFHQCV 270
           LSGMP+C  G ND                        P V G    + V+LE  KFHQCV
Sbjct: 241 LSGMPMCQIGMNDLSTIQGGENAHWTNEDRASNRDAMPDVSG----DRVILEGSKFHQCV 296

Query: 271 QLNKFDQERVIRFVPPDGEFELMKYHIRDDLRPPFKVTPVVSKVNE-RSIEYRITLQSLF 329
            L+K++++ VI F+PPDG+FELMKYH+ ++L  PF++TP V+  +   ++ Y I L+SLF
Sbjct: 297 ALDKYNKDNVIWFIPPDGQFELMKYHVSNNLNLPFRITPQVTLTSHGTALSYAIKLKSLF 356

Query: 330 PTKLSAKDVELYIPAPPYTISAKVNVSCGKCKFVPEENAIIWKIHKFHGLTENTLSAVTI 389
           P KLSA++V L IP PP T+  K+N S GKCKF+PEEN ++W  H+F+G TEN L+A T+
Sbjct: 357 PRKLSAENVVLRIPVPPGTLDCKINASDGKCKFIPEENCMVWSFHRFNGSTENHLNAQTV 416

Query: 390 ADEQGHYAQVLDQWPRPPISMKLEIMMF 417
              Q   +Q + QW RPP+S+  +++MF
Sbjct: 417 P-TQSIASQSIKQWTRPPMSLDFKVLMF 443

>KLLA0C03894g Chr3 complement(354889..356316) [1428 bp, 475 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit,
          Length = 475

 Score =  402 bits (1033), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 202/437 (46%), Positives = 277/437 (63%), Gaps = 20/437 (4%)

Query: 1   MIDAFFVFAPRGSLIVSKLISGEAKESLSEVFRLQVINGLEIRSPVLTLGSTTFQH-IRT 59
           M+ A F++  +G L++SKLI    K SL++VFR QVIN   +RSP+LTLGSTTFQH IR 
Sbjct: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVINDPHVRSPILTLGSTTFQHVIRE 60

Query: 60  SGG---LWMVVVVRGNADSAAIWEFLYHMNKLLDAYAINTEEALLDDFMLCYELLDVVLD 116
           S     +W+V V R N DS+ IWE+L+ + +L++A+ IN E+ L D+FML YE+L++ L+
Sbjct: 61  SSDNLPMWLVAVSRSNVDSSMIWEYLHKLYQLMEAFGINDEDVLKDEFMLLYEILELTLE 120

Query: 117 SGLPQDTELSHIVPLLSRKPATGESASG----DDFLNSAR-LRRTGTKNVSVETLDHFSR 171
           +G+PQ T+L+ I+P +SRKP    + S     DDFL+ +  L+       S  ++   S 
Sbjct: 121 NGIPQTTDLAQIIPRVSRKPIENNTISKSPDLDDFLSGSNILKAPKLSKRSSSSIALSSL 180

Query: 172 DVCPWRGEGIKYKKNEVYLDVIEKLSLLVNRDGTILKAYVDGTVQCTAHLSGMPLCHFGF 231
             CPWR  G+KYKKNEVYLD+ EK+++LV +DG+I+K++VDG+V C +HLSGMPLC  G 
Sbjct: 181 SECPWRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGSVDCVSHLSGMPLCQLGL 240

Query: 232 NDX-----------XXXXXXXXXXXYAPRVFGTDERESVVLEDCKFHQCVQLNKFDQERV 280
           ND                          +        SV+LEDCKFHQCVQLNK++   V
Sbjct: 241 NDTYSIHGNEKSELSIVEMMSEYDIKNKKAIPNAAAGSVILEDCKFHQCVQLNKYEANHV 300

Query: 281 IRFVPPDGEFELMKYHIRDDLRPPFKVTPVVSKVNERSIEYRITLQSLFPTKLSAKDVEL 340
           I+FVPPDG F+LM+Y + D++  PF V P V  V   ++ Y++TL+SLFP+ +SAKDV +
Sbjct: 301 IQFVPPDGPFQLMQYRVIDNINIPFNVIPEVEIVKNSTLNYKVTLRSLFPSNVSAKDVTV 360

Query: 341 YIPAPPYTISAKVNVSCGKCKFVPEENAIIWKIHKFHGLTENTLSAVTIADEQGHYAQVL 400
            IP PP TI    NVS GKCK+   E  ++WK +K+ G TENTLS         H    L
Sbjct: 361 KIPVPPTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGSTENTLSGKVAIPATSHDLSDL 420

Query: 401 DQWPRPPISMKLEIMMF 417
            +W RPPISM  EI+MF
Sbjct: 421 LRWSRPPISMGFEIVMF 437

>TPHA0P00660 Chr16 (136114..137535) [1422 bp, 473 aa] {ON} Anc_3.165
           YOL062C
          Length = 473

 Score =  391 bits (1004), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 204/437 (46%), Positives = 277/437 (63%), Gaps = 22/437 (5%)

Query: 1   MIDAFFVFAPRGSLIVSKLISGEAKESLSEVFRLQVINGLEIRSPVLTLGSTTFQHIRTS 60
           MI+   +++ RG LIV  L+    K ++S++F++QVIN LE++SP+LTLGSTTF HIR+S
Sbjct: 1   MINGVLIYSSRGDLIVCDLLKSSLKRTISDIFKIQVINSLEMKSPILTLGSTTFHHIRSS 60

Query: 61  G--GLWMVVVVRGNADSAAIWEFLYHMNKLLDAYAINTEEALLDDFMLCYELLDVVLDS- 117
               LW+V + R NA+S  IWEFLY ++ +L AY +N EE L++ FM+ YE++DV+L S 
Sbjct: 61  SESKLWIVAITRSNANSGVIWEFLYKLDSMLTAYDLNNEEKLMEKFMVYYEMIDVMLTSN 120

Query: 118 GLPQDTELSHIVPLLS-RKPATGESA-----SGDDFLNSARLRRTGTKNVSVETLDHFSR 171
            +P +TELS I   +S R P T  ++     + ++ L+  +     ++++S E   + ++
Sbjct: 121 AMPINTELSSIASKISYRLPKTISNSPTNEKNNNNGLSIPKFLTRNSRSMSQE-FSNITQ 179

Query: 172 DVCPWRGEGIKYKKNEVYLDVIEKLSLLVNRDGTILKAYVDGTVQCTAHLSGMPLCHFGF 231
              PWR  GIKYKKNEV+L V EK+++LV++D TILKAYVDG++   +HLSG P+C FG 
Sbjct: 180 SDIPWRPTGIKYKKNEVFLYVNEKINILVSKDQTILKAYVDGSIDLVSHLSGTPICQFGL 239

Query: 232 NDXXXXXXXXXXXXYAP--RVFGTDERES--------VVLEDCKFHQCVQLNKFDQERVI 281
           ND                   F  DE  S        V +EDC FHQCV L+KF+ ER+I
Sbjct: 240 NDYLSMTGNNISNRGDEFRHDFMDDEDLSTGRSSSSSVKIEDCTFHQCVSLDKFNDERLI 299

Query: 282 RFVPPDGEFELMKYHIRDDLRPPFKVTPVVSKVNER-SIEYRITLQSLFPTKLSAKDVEL 340
            FVPPDG FELM+YH+RDDL  PFKVTP VS  + R S+ Y+I L+SLFPT LSA D  L
Sbjct: 300 NFVPPDGSFELMRYHVRDDLNIPFKVTPRVSISSSRCSMRYKIILKSLFPTSLSAADAML 359

Query: 341 YIPAPPYTISAKVNVSCGKCKFVPEENAIIWKIHKFHGLTENTLSAVTIADEQGHYAQVL 400
            IP PP T+  K+N S GKC F   +N  IWK +K+ GLTEN L   T+          L
Sbjct: 360 KIPLPPGTVDCKINASSGKCNFSTSDNCAIWKFNKYKGLTENELILETVPSSSTDILS-L 418

Query: 401 DQWPRPPISMKLEIMMF 417
            QW RPP+SM  EI+MF
Sbjct: 419 QQWTRPPMSMNFEIIMF 435

>KNAG0K01150 Chr11 complement(225095..226519) [1425 bp, 474 aa] {ON}
           Anc_3.165 YOL062C
          Length = 474

 Score =  383 bits (984), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 196/434 (45%), Positives = 273/434 (62%), Gaps = 18/434 (4%)

Query: 1   MIDAFFVFAPRGSLIVSKLISGEAKESLSEVFRLQVINGLEIRSPVLTLGSTTFQHIRTS 60
           MI+A  V++ RG LIVSK+     K S+ ++FR+QVIN L++RSP+LTLGSTTF ++RT 
Sbjct: 1   MINAVLVYSARGELIVSKMFKPTLKRSVGDIFRVQVINSLDVRSPILTLGSTTFHYVRTP 60

Query: 61  G-GLWMVVVVRGNADSAAIWEFLYHMNKLLDAYAINTEEALLDDFMLCYELLDVVLDSG- 118
           G GLW+V V R N +SAA WEFLY    +L AY +++EE L ++FML +ELLD +++ G 
Sbjct: 61  GEGLWVVSVSRNNENSAATWEFLYKFATMLAAYRLDSEEVLKEEFMLAWELLDTMVEGGG 120

Query: 119 LPQDTELSHIVPLLSRKPATGESASGDDFLNSARLRRTGTKNVSVETLDHFSRD-----V 173
           +P +T+   I+  +S KPA        D         TG    +   L H + +     +
Sbjct: 121 IPSETDPHRIISAMSVKPAMSPVDVRADARQQQTTTSTGAFGHAFPQLLHRASNPGGISI 180

Query: 174 CPW-RGEGIKYKKNEVYLDVIEKLSLLVNRDGTILKAYVDGTVQCTAHLSGMPLCHFGFN 232
            P   G+G + K+NE+ + V E +S+LV++DG+ILKAYVDG +  T  L G  +C FG N
Sbjct: 181 LPHATGDGAQLKRNEIVMVVQESISILVSKDGSILKAYVDGGIDLTTKLEGAAVCQFGLN 240

Query: 233 DXXXXXXXXXXX---XYAPRVFGTD------ERESVVLEDCKFHQCVQLNKFDQERVIRF 283
           D                +    GT+         +V+L DCKFHQCV L +FD++R+IRF
Sbjct: 241 DSLSTDNSSNSKWDPLRSKETQGTNLEMKNAHVGTVLLRDCKFHQCVSLERFDRDRIIRF 300

Query: 284 VPPDGEFELMKYHIRDDLRPPFKVTPVVSKVNERSIEYRITLQSLFPTKLSAKDVELYIP 343
            PP+G  ELMKYH+RD+L  PFKVT +V        +YR+T++SLFP KLSAK+V + IP
Sbjct: 301 TPPEGTIELMKYHVRDNLNLPFKVTSMVIPTANNETDYRVTIKSLFPGKLSAKNVTMRIP 360

Query: 344 APPYTISAKVNVSCGKCKFVPEENAIIWKIHKFHGLTENTLSAVTIADEQGHYAQVLDQW 403
            PP T+  K+NVS G CKF+PEENA++WK HK++GLTEN LSA+T+   +      L QW
Sbjct: 361 VPPGTLDCKINVSNGNCKFLPEENAMVWKFHKYNGLTENKLSAITVP-TRDTTQLALQQW 419

Query: 404 PRPPISMKLEIMMF 417
            RPPIS+  EI+M+
Sbjct: 420 SRPPISLDFEILMY 433

>KAFR0C01020 Chr3 (208272..209558) [1287 bp, 428 aa] {ON} Anc_3.165
           YOL062C
          Length = 428

 Score =  339 bits (870), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 187/427 (43%), Positives = 255/427 (59%), Gaps = 48/427 (11%)

Query: 1   MIDAFFVFAPRGSLIVSKLISGEAKESLSEVFRLQVINGLEIRSPVLTLGSTTFQHIRTS 60
           MI A  ++ PRG LIVSKL     K S+SE+FR+QVIN   +RSP+LTLGSTTF HIR++
Sbjct: 1   MISAILIYTPRGELIVSKLYRNNIKRSISEIFRIQVINNFNVRSPILTLGSTTFHHIRST 60

Query: 61  GG------LWMVVVVRGNADSAAIWEFLYHMNKLLDAYAINTEEALLDDFMLCYELLD-V 113
                   LW+V V R NA+SAAIWEFL  +N +L  Y I +E  L D+FM  +E+LD +
Sbjct: 61  ANDPTDDELWLVCVNRNNANSAAIWEFLQKLNLILQQYGITSESKLKDEFMTVHEILDNM 120

Query: 114 VLDSGLPQDTELSHIVPLLSRKPA--TGESASGDDFLNSARLRRTGTKNVSVETLDHFSR 171
           +L +G+ Q+T+L  IV  +S KP   T E+ S      +  L+R  T    + T    + 
Sbjct: 121 LLGTGIIQNTDLKSIVDKMSVKPISRTNETTSTQ----TGFLKRRNT----ILTTPGANF 172

Query: 172 DVCPWRGEGIKYKKNEVYLDVIEKLSLLVNRDGTILKAYVDGTVQCTAHLSGMPLCHFGF 231
            + P       +KKNE++  V E ++LLV++DG+ILK YVDG ++  +HL+G P C F  
Sbjct: 173 SLIPTNRHD-AHKKNEIFFFVNESMNLLVSKDGSILKNYVDGKIEIKSHLNGNPTCQFEL 231

Query: 232 NDXXXXXXXXXXXXYAPRVFGTDERESVVLEDCKFHQCVQLNKFDQERVIRFVPPDGEFE 291
            D                       +   + D KF QC++     Q R +R    DGE E
Sbjct: 232 VD-----------------------DQTKITDFKFDQCIEK---VQSRTVRVAATDGELE 265

Query: 292 LMKYHIRDD-LRPPFKVTPVVSKVNERSIEYRITLQSLFPTKLSAKDVELYIPAPPYTIS 350
           ++ YH+RDD +  PFK+TP+VS V + +++YRI+L+SLFP  LSA DV L IP PP TI 
Sbjct: 266 IVNYHVRDDKINIPFKITPIVSTVKD-TVDYRISLKSLFPKNLSATDVVLTIPVPPNTID 324

Query: 351 AKVNVSCGKCKFVPEENAIIWKIHKFHGLTENTLSAVTIADEQGHYAQVLDQWPRPPISM 410
            K+NVS G CKF  E+NA+IW  +KF+G TENTLSA+TIAD  G     L+ W RP I +
Sbjct: 325 CKINVSNGHCKFKAEQNAVIWTFNKFNGSTENTLSAITIAD--GRQIMNLESWTRPSIQL 382

Query: 411 KLEIMMF 417
             EI M+
Sbjct: 383 TFEITMY 389

>KLLA0D14311g Chr4 (1216574..1217905) [1332 bp, 443 aa] {ON} similar
           to uniprot|Q00776 Saccharomyces cerevisiae YPL259C APM1
           medium subunit of the clathrin-associated protein
           complex
          Length = 443

 Score =  193 bits (490), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 121/414 (29%), Positives = 204/414 (49%), Gaps = 27/414 (6%)

Query: 11  RGSLIVSKLISGEAKESLSEVFR---LQVINGLEIRSPVLTLGSTTFQHIRTSGGLWMVV 67
           +G  ++S+    +  +S  E F+   L+      +  P        + +++ +    + +
Sbjct: 11  KGKPLLSRRYQDDVSQSAVESFQHLLLEREQESSVMPPCFHHNGIHYMYVQYNDVYVLAL 70

Query: 68  VVRGNADSAAIWEFLYHMNKLLDAYAINTEE-ALLDDFMLCYELLDVVLDSGLPQDTELS 126
               + ++  ++ F+Y +  +++ Y    EE ++ D++++ YELLD ++D G+PQ TE  
Sbjct: 71  TRSVSVNATTMFAFMYKLINVVEEYVKRVEEESIRDNYIIIYELLDEMMDKGVPQVTETK 130

Query: 127 HIVPLLSRKPATGESASGDDFLNSARLRRTGTKNVSVETLDHFSRDVCPWRGEGIKYKKN 186
            +   +++K              S +L R+  K  +V        +   WR EGIKYKKN
Sbjct: 131 MLKQYITQK--------------SFKLTRSAKKQKNVARPPTELTNSVSWRPEGIKYKKN 176

Query: 187 EVYLDVIEKLSLLVNRDGTILKAYVDGTVQCTAHLSGMPLCHFGFNDXXXXXXXXXXXXY 246
           E +LDVIE +++L+ + G +L++ + GTV+  + LSGMP    G ND             
Sbjct: 177 EAFLDVIESINMLMTQQGQVLRSEILGTVKVRSRLSGMPDLKLGLNDKGIFTTNDQEDSP 236

Query: 247 APRVFGTDERESVVLEDCKFHQCVQLNKFDQERVIRFVPPDGEFELMKYHIRDDLRPPFK 306
            P V    +  ++ LED KFHQCV+L+KF+ E++I F+PPDGEF+LM Y +   ++P   
Sbjct: 237 EPVVSSKKKNSNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMTYRLSTPIKPLIW 296

Query: 307 VTPVVSKVNERSIEYRITLQSLFPTKLSAKDVELYIPAPPYTISAKVNVSCGKCKFVPEE 366
               V   +   IE     ++    K  A +VE+ IP P    S     S G  K+VPE+
Sbjct: 297 CDVKVQVHSGSRIEIHCRAKAQIKKKSVANNVEILIPIPEDADSPTFKYSRGNIKWVPEK 356

Query: 367 NAIIWKIHKFHGLTENTLSAVTIADEQGHYAQVLDQWP---RPPISMKLEIMMF 417
           NAI+WK   F G  E +++A      Q     V D  P   + P+ +K +I  F
Sbjct: 357 NAILWKFSSFQGGKEYSMAA------QLGLPSVSDAEPPKLKRPVQIKFQIPYF 404

>Ecym_8350 Chr8 (700421..701758) [1338 bp, 445 aa] {ON} similar to
           Ashbya gossypii ADL017C
          Length = 445

 Score =  191 bits (485), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 110/328 (33%), Positives = 179/328 (54%), Gaps = 18/328 (5%)

Query: 63  LWMVVVVRG-NADSAAIWEFLYHMNKLLDAY-AINTEEALLDDFMLCYELLDVVLDSGLP 120
           L+++ + R   A+ A ++ FL+ +  +L  Y  +  EE++ D+F++ YELLD V+DSG+P
Sbjct: 65  LYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDEVMDSGIP 124

Query: 121 QDTELSHIVPLLSRKPATGESASGDDFLNSARLRRTGTKNVSVETLDHFSRDVCPWRGEG 180
           Q T+   +   +++K              S +L R+  K  +V            WR EG
Sbjct: 125 QITDTKMLRQYITQK--------------SFKLIRSAKKKKNVVRPPSSLTTAVSWRPEG 170

Query: 181 IKYKKNEVYLDVIEKLSLLVNRDGTILKAYVDGTVQCTAHLSGMPLCHFGFNDXXXXXXX 240
           IKYKKNE +LDVIE +++++ + G +L++ + G V+  + LSGMP    G ND       
Sbjct: 171 IKYKKNEAFLDVIESINMMMTQQGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTQS 230

Query: 241 XXXXXYAP--RVFGTDERESVVLEDCKFHQCVQLNKFDQERVIRFVPPDGEFELMKYHIR 298
                  P  +   T ++ ++ LED KFHQCV+L+KF+ E++I F+PPDG+FELM Y + 
Sbjct: 231 NEEEEDEPSSQPSITRKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRLS 290

Query: 299 DDLRPPFKVTPVVSKVNERSIEYRITLQSLFPTKLSAKDVELYIPAPPYTISAKVNVSCG 358
             ++P       +   +   +E     ++    K +A +VE+ IP P    S K   S G
Sbjct: 291 TPIKPLIWCDAKIQVHSRSRVEVHCRAKAQIKAKSTANNVEILIPVPNDADSPKFRYSHG 350

Query: 359 KCKFVPEENAIIWKIHKFHGLTENTLSA 386
             K+VPE+NAI+WKI  F G  + +++A
Sbjct: 351 SIKWVPEKNAILWKIKSFPGGKDYSMAA 378

>ADL017C Chr4 complement(679085..680416) [1332 bp, 443 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL259C
           (APM1)
          Length = 443

 Score =  190 bits (483), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 123/426 (28%), Positives = 213/426 (50%), Gaps = 31/426 (7%)

Query: 1   MIDAFFVFAPRGSLIVSKLISGEAKESLSEVFRLQVINGLEIRS---PVLTLGSTTFQHI 57
           M    +    +G L++S+    +   +  E F   +I   +  S   P  +     +  I
Sbjct: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60

Query: 58  RTSGGLWMVVVVRGNADSAAIWEFLYHMNKLLDAY-AINTEEALLDDFMLCYELLDVVLD 116
           + +    + +    + + A ++ +L+ + ++L+ Y  +  EE++ D+F++ YELLD ++D
Sbjct: 61  QHNDLYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDEMMD 120

Query: 117 SGLPQDTELSHIVPLLSRKPATGESASGDDFLNSARLRRTGTKNVSVETLDHFSRDVCPW 176
            G+PQ T+   +   +++K              S +L R+  K  +V        +   W
Sbjct: 121 HGIPQITDTKMLRQYITQK--------------SFKLIRSAKKKKNVVRPPATLTNSVSW 166

Query: 177 RGEGIKYKKNEVYLDVIEKLSLLVNRDGTILKAYVDGTVQCTAHLSGMPLCHFGFNDXXX 236
           R EGI YKKNE +LDV+E +++L+ + G +L++ + G V+  + LSGMP    G ND   
Sbjct: 167 RPEGIVYKKNEAFLDVVESINMLLTQQGQVLRSEILGKVKVKSRLSGMPDLKLGLNDKGI 226

Query: 237 XXXXXXXXXYAPRVFGTDERESVVLEDCKFHQCVQLNKFDQERVIRFVPPDGEFELMKYH 296
                          GT ++ ++ LED KFHQCV+L KF+ E++I F+PPDG+FELM Y 
Sbjct: 227 FAQGDDDDDEEGASGGTKKKSNIELEDLKFHQCVRLTKFENEKIITFIPPDGDFELMSYR 286

Query: 297 IRDDLRPPFKVTPVVSKVNERS-IEYRITLQSLFPTKLSAKDVELYIPAPPYTISAKVNV 355
           +   ++ P     V  +V+ RS IE     ++    K +A +VE+ IP P    S K   
Sbjct: 287 LSTPIK-PLIWCDVKLQVHSRSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRY 345

Query: 356 SCGKCKFVPEENAIIWKIHKFHGLTENTLSA----VTIADEQGHYAQVLDQWPRPPISMK 411
           S G  K+VP +NAI+WKI  F G  + +++A     +++D   H         + P+ +K
Sbjct: 346 SHGTIKWVPSQNAILWKIKSFPGGKDYSMAAEMGLPSVSDNSDHKL-------KRPVQIK 398

Query: 412 LEIMMF 417
            +I  F
Sbjct: 399 FQIPYF 404

>KLTH0F12584g Chr6 complement(1053944..1055269) [1326 bp, 441 aa]
           {ON} highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259C APM1 medium subunit of the clathrin-
           associated protein complex
          Length = 441

 Score =  187 bits (476), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 128/414 (30%), Positives = 209/414 (50%), Gaps = 30/414 (7%)

Query: 11  RGSLIVSKLISGEAKESLSEVFR---LQVINGLEIRSPVLTLGSTTFQHIRTSGGLWMVV 67
           +G +I+S+    +   S  E F    L+      I  P LT     +  I+    ++++ 
Sbjct: 11  KGKVILSRRYRDDVPPSAIEKFPSLLLEAEQESSIVPPCLTHNGVQYLFIQ-HNDIYVLT 69

Query: 68  VVRG-NADSAAIWEFLYHMNKLLDAYAINTEE-ALLDDFMLCYELLDVVLDSGLPQDTEL 125
           + R  + + A ++ FLY + ++L  Y    EE ++ D+F++ YELLD +LD G+PQ TE 
Sbjct: 70  MSRSLSINVAQVFSFLYKLVEVLAEYVKTVEEESIRDNFVIIYELLDEMLDYGIPQITET 129

Query: 126 SHIVPLLSRKPATGESASGDDFLNSARLRRTGTKNVSVETLDHFSRDVCPWRGEGIKYKK 185
             +   +++K            + SA+     +KNV +      ++ V  WR EGI YKK
Sbjct: 130 KMLKQYITQK--------SYKLIKSAK----KSKNV-IRPPSQLTKSVS-WRPEGITYKK 175

Query: 186 NEVYLDVIEKLSLLVNRDGTILKAYVDGTVQCTAHLSGMPLCHFGFNDXXXXXXXXXXXX 245
           NE +LDV E +++L+   G +L++ + G V   + LSGMP    G ND            
Sbjct: 176 NEAFLDVTESINMLITASGQVLRSEILGKVNVRSRLSGMPDLKLGLNDKGIFTSVESASS 235

Query: 246 YAPRVFGTDERESVVLEDCKFHQCVQLNKFDQERVIRFVPPDGEFELMKYHIRDDLRPPF 305
                    ++ ++ LED KFHQCV+L+KF+ E++I F+PPDG+FELM Y +   ++P  
Sbjct: 236 SE---ATEGKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMNYRLSTPIKPLI 292

Query: 306 KVTPVVSKVNERSIEYRITLQSLFPTKLSAKDVELYIPAPPYTISAKVNVSCGKCKFVPE 365
                +   ++  IE     ++    K +A +VE+ IP P    S K   S G  K+VPE
Sbjct: 293 WCDAKIQVHSQSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSLKYVPE 352

Query: 366 ENAIIWKIHKFHGLTENTLSAVTIADEQGHYAQVLDQWPRP--PISMKLEIMMF 417
           ++AI+WKI  F+G  E + +A     + G  +    + PR   PI +K +I  F
Sbjct: 353 KSAILWKIKTFNGGKEYSFAA-----QLGLPSMTDAEVPRAKRPIQVKFQIPYF 401

>SAKL0F05346g Chr6 (413830..415173) [1344 bp, 447 aa] {ON} highly
           similar to uniprot|Q00776 Saccharomyces cerevisiae
           YPL259C APM1 medium subunit of the clathrin- associated
           protein complex
          Length = 447

 Score =  187 bits (475), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 111/338 (32%), Positives = 182/338 (53%), Gaps = 37/338 (10%)

Query: 63  LWMVVVVRG-NADSAAIWEFLYHMNKLLDAYA-INTEEALLDDFMLCYELLDVVLDSGLP 120
           L+++ + R  + + A ++ FLY + ++L  Y  +  EE++ D+F++ YELLD ++D G+P
Sbjct: 65  LYVLTMTRSLSTNVAQLFAFLYKVVEVLTEYVKVVEEESIRDNFVIIYELLDEMMDYGIP 124

Query: 121 QDTELSHIVPLLSRKPATGESASGDDFLNSARLRRTGTKNVSVETLDHFSRDVCPWRGEG 180
           Q TE   +   +++K              S +L ++  K+ +V        +   WR EG
Sbjct: 125 QITETKMLKQYITQK--------------SFKLMKSAKKSKNVIRPPIALTNSVSWRPEG 170

Query: 181 IKYKKNEVYLDVIEKLSLLVNRDGTILKAYVDGTVQCTAHLSGMPLCHFGFNDXXXXXXX 240
           I YKKNE +LDV+E +++L+ + G +L++ + G V+  +HLSGMP    G ND       
Sbjct: 171 IMYKKNEAFLDVVESINMLITQQGQVLRSEILGKVKVKSHLSGMPDLKLGLNDKGI---- 226

Query: 241 XXXXXYAPRVFGTDERES------------VVLEDCKFHQCVQLNKFDQERVIRFVPPDG 288
                ++  V G  E E+            + LED KFHQCV+L+KF+ E++I F+PPDG
Sbjct: 227 -----FSNHVSGGVEDEADDLSATGKKKANIELEDLKFHQCVRLSKFENEKIITFIPPDG 281

Query: 289 EFELMKYHIRDDLRPPFKVTPVVSKVNERSIEYRITLQSLFPTKLSAKDVELYIPAPPYT 348
           +FELM Y +   ++P       +   ++  IE     ++    K +A +VE+ IP P   
Sbjct: 282 DFELMSYRLTTPIKPLIWCDIKIQVHSKSRIEVHCRAKAQIKKKSTANNVEILIPVPEDA 341

Query: 349 ISAKVNVSCGKCKFVPEENAIIWKIHKFHGLTENTLSA 386
            S K   S G  K+ PE+NAI+WKI  F G  E +++A
Sbjct: 342 DSPKFRYSHGSIKWAPEKNAILWKIKSFPGGKEYSMAA 379

>KAFR0L00470 Chr12 complement(85772..87169) [1398 bp, 465 aa] {ON}
           Anc_7.127 YPL259C
          Length = 465

 Score =  184 bits (467), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 122/397 (30%), Positives = 194/397 (48%), Gaps = 42/397 (10%)

Query: 45  PVLTLGSTTFQHIRTSGGLWMVVVVRGNADSAAIWEFLYHMNKLLDAYAINTEE-ALLDD 103
           P ++     +  I+ +      +     A+ + I+ FL+ +  +LD Y    EE ++ D+
Sbjct: 48  PCISHNGIQYMFIQHNDLYLAALATSVQANISLIFAFLHKIIDVLDGYLKTVEEESIRDN 107

Query: 104 FMLCYELLDVVLDSGLPQDTELSHIVPLLSRKPATGESASGDDFLNSARLRRTGTKNVSV 163
           F++ YELLD ++D GLPQ TE   +   ++ K    E A      N+AR     T +VS 
Sbjct: 108 FIIIYELLDEMMDYGLPQITETKMLKKYITTKSFKLEKAHKKK-RNAARPPTELTNSVS- 165

Query: 164 ETLDHFSRDVCPWRGEGIKYKKNEVYLDVIEKLSLLVNRDGTILKAYVDGTVQCTAHLSG 223
                       WR EGIKYKKNE +LD+IE +++L+ + G +L++ + G V+  + LSG
Sbjct: 166 ------------WRPEGIKYKKNEAFLDIIESINMLITQKGQVLRSEIVGNVRVKSRLSG 213

Query: 224 MPLCHFGFNDXXXXXXXXXXXXYAPRVFGTDE-------------------RESVVLEDC 264
           MP    G ND                  G DE                   + ++ LED 
Sbjct: 214 MPDLKLGINDRGIFTKYLEGNNIGIAKNGDDEDADDTNNESSIVSEGSNKRKTNIELEDL 273

Query: 265 KFHQCVQLNKFDQERVIRFVPPDGEFELMKYHIRDDLRPPFKVTPVVSKVNERSIEYRIT 324
           KFHQCV+L+KF+ E++I F+PPDGEF+LM Y +   ++P   +      +    IE    
Sbjct: 274 KFHQCVRLSKFENEKIISFIPPDGEFDLMNYRLSTSIKP---LIWCDVSIQTYRIEIHCK 330

Query: 325 LQSLFPTKLSAKDVELYIPAPPYTISAKVNVSCGKCKFVPEENAIIWKIHKFHGLTENTL 384
            ++    K  A +VE+ IP P    S     S GK K++PE+N ++WKI  F G  E ++
Sbjct: 331 AKAQIKKKSIATNVEILIPVPEDADSPIFKYSHGKIKYLPEKNLLLWKISSFPGGKEYSM 390

Query: 385 SAV----TIADEQGHYAQVLDQWPRPPISMKLEIMMF 417
           +A     +I+ E     +V +Q  + P+ +K +I  F
Sbjct: 391 AAQMGLPSISGEDDLNTRVSNQ-SKKPVQVKFKIPYF 426

>Kwal_55.20843 s55 complement(580157..581482) [1326 bp, 441 aa] {ON}
           YPL259C (APM1) - medium subunit of the
           clathrin-associated protein complex [contig 138] FULL
          Length = 441

 Score =  183 bits (464), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 118/382 (30%), Positives = 200/382 (52%), Gaps = 27/382 (7%)

Query: 12  GSLIVSKLISGEAKESLSEVFRLQVINGLEIRS---PVLTLGSTTFQHIRTSGGLWMVVV 68
           G +I+S+    +   S  E F   ++   +  S   P LT     +  I+    ++++ +
Sbjct: 12  GKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFIQ-HNDIYVLTM 70

Query: 69  VRG-NADSAAIWEFLYHMNKLLDAYAINTEE-ALLDDFMLCYELLDVVLDSGLPQDTELS 126
            R  + + A ++ FLY + ++L  Y    EE ++ D+F++ YELLD +LD G+PQ TE  
Sbjct: 71  SRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDEMLDYGIPQITETK 130

Query: 127 HIVPLLSRKPATGESASGDDFLNSARLRRT--GTKNVSVETLDHFSRDVCPWRGEGIKYK 184
            +   +++K              S +L ++   +KNV V      ++ V  WR EGI YK
Sbjct: 131 MLKQYITQK--------------SYKLIKSVKKSKNV-VRPPAQLTKSVS-WRPEGITYK 174

Query: 185 KNEVYLDVIEKLSLLVNRDGTILKAYVDGTVQCTAHLSGMPLCHFGFNDXXXXXXXXXXX 244
           KNE +LDV E +++L+   G +L++ + G V+  + LSGMP    G ND           
Sbjct: 175 KNEAFLDVTESINMLITASGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTSEEGGN 234

Query: 245 XYAPRVFGTDERESVVLEDCKFHQCVQLNKFDQERVIRFVPPDGEFELMKYHIRDDLRPP 304
                  G+ ++ ++ LED +FHQCV+L+KF+ E++I F+PPDG+F+LM Y +   ++P 
Sbjct: 235 NAEG---GSGKKSNIELEDLQFHQCVRLSKFENEKIISFIPPDGDFDLMNYRLSTPIKPL 291

Query: 305 FKVTPVVSKVNERSIEYRITLQSLFPTKLSAKDVELYIPAPPYTISAKVNVSCGKCKFVP 364
                 +   ++  IE     ++    K +A +VE+ IP P    S K   S G  K+VP
Sbjct: 292 IWCDAKIQVHSQSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSLKYVP 351

Query: 365 EENAIIWKIHKFHGLTENTLSA 386
           E++AI+W+I  F+G  E + +A
Sbjct: 352 EKSAILWRIKTFNGGKEYSFAA 373

>YPL259C Chr16 complement(51244..52671) [1428 bp, 475 aa] {ON}
           APM1Mu1-like medium subunit of the clathrin-associated
           protein complex (AP-1); binds clathrin; involved in
           clathrin-dependent Golgi protein sorting
          Length = 475

 Score =  183 bits (465), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 112/347 (32%), Positives = 181/347 (52%), Gaps = 37/347 (10%)

Query: 63  LWMVVVVRG-NADSAAIWEFLYHMNKLLDAYAINTEE-ALLDDFMLCYELLDVVLDSGLP 120
           L++V +V   +A++AAI+ FL+ + ++L  Y    EE ++ D+F++ YELLD V+D G+P
Sbjct: 65  LYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMDYGIP 124

Query: 121 QDTELSHIVPLLSRKPATGESASGDDFLNSARLRRTGTKNVSVETLDHFSRDVCPWRGEG 180
           Q TE   +   +++K            + SA+ +R  T+     T      +   WR EG
Sbjct: 125 QITETKMLKQYITQKSFK--------LVKSAKKKRNATRPPVALT------NSVSWRPEG 170

Query: 181 IKYKKNEVYLDVIEKLSLLVNRDGTILKAYVDGTVQCTAHLSGMPLCHFGFNDXXXXXXX 240
           I +KKNE +LD++E +++L+ + G +L++ + G V+  + LSGMP    G ND       
Sbjct: 171 ITHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKY 230

Query: 241 XXXXXYAPRVFGT--------DERESVV-------------LEDCKFHQCVQLNKFDQER 279
                  P    T        D++ S+              LED KFHQCV+L+KF+ E+
Sbjct: 231 LDDDTNIPSASATTSDNNTETDKKPSITSSSATNKKKVNIELEDLKFHQCVRLSKFENEK 290

Query: 280 VIRFVPPDGEFELMKYHIRDDLRPPFKVTPVVSKVNERSIEYRITLQSLFPTKLSAKDVE 339
           +I F+PPDG+F+LM Y +   ++P       V   +   IE     ++    K +A +VE
Sbjct: 291 IITFIPPDGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVE 350

Query: 340 LYIPAPPYTISAKVNVSCGKCKFVPEENAIIWKIHKFHGLTENTLSA 386
           + IP P    +     S G  K+VPE++AI+WKI  F G  E ++SA
Sbjct: 351 ILIPVPDDADTPTFKYSHGSLKYVPEKSAILWKIRSFPGGKEYSMSA 397

>TPHA0C04320 Chr3 (932871..934235) [1365 bp, 454 aa] {ON} Anc_7.127
           YPL259C
          Length = 454

 Score =  183 bits (464), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 126/410 (30%), Positives = 206/410 (50%), Gaps = 32/410 (7%)

Query: 20  ISGEAKESLSEVFRLQVINGLEIRSPVLTLGSTTFQHIRTSGGLWMVVVVRGNADSAAIW 79
           IS  A ++ S++  LQ+     +  P +      +  I+ S    + +      + A I+
Sbjct: 24  ISINAIDNFSQLL-LQLEEETGVIPPCIMHKGIHYLFIKHSDIYVVALTTSYQTNVAQIF 82

Query: 80  EFLYHMNKLLDAYA-INTEEALLDDFMLCYELLDVVLDSGLPQDTELSHIVPLLSRKP-A 137
            FL+ + ++L+ Y  I  EE++ D+F++ YELLD ++D G+PQ TE   +   +++K   
Sbjct: 83  MFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEMMDFGIPQITETKMLKKYITQKSFK 142

Query: 138 TGESASGDDFLNSARLRRTGTKNVSVETLDHFSRDVCPWRGEGIKYKKNEVYLDVIEKLS 197
             ++++     N+AR     T +VS             WR EGI YKKNE +LD+IE ++
Sbjct: 143 LIKTSTSKKKKNAARPPAELTNSVS-------------WRPEGITYKKNEAFLDIIESIN 189

Query: 198 LLVNRDGTILKAYVDGTVQCTAHLSGMPLCHFGFNDXXXXXXXXXXXXYAPRVFGT---- 253
           +LV + G +L++ + G V+  + LSGMP    G ND                   T    
Sbjct: 190 MLVTQQGQVLRSEIVGAVRVRSRLSGMPDLKLGINDRGIFSNYLEENNVDGSSSSTPIPE 249

Query: 254 ---DERESVVLEDCKFHQCVQLNKFDQERVIRFVPPDGEFELMKYHIRDDLRPPFKVTPV 310
              D++  + LED KFHQCV+L+KF+ E++I F+PPDGEF+LM Y +   ++P       
Sbjct: 250 GVEDKKPQIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMNYRLTTPIKPLIWCDVN 309

Query: 311 VSKVNERSIEYRITLQSLFPTKLSAKDVELYIPAPPYTISAKVNVSCGKCKFVPEENAII 370
           +   ++  IE     ++    K  A +VE+ IP P    + +   S G  K++PE+NAI+
Sbjct: 310 IQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPDDADTPQFRYSHGSIKWLPEKNAIL 369

Query: 371 WKIHKFHGLTENTLSAVTIADEQGHYAQVLDQWP---RPPISMKLEIMMF 417
           WK+  F G  E ++SA      Q H   V    P   R P+ +K +I  F
Sbjct: 370 WKLRSFAGGKEYSMSA------QLHLPSVDGVEPPKVRRPVQVKFQIPYF 413

>NDAI0E03680 Chr5 complement(794613..795947) [1335 bp, 444 aa] {ON}
           Anc_7.127
          Length = 444

 Score =  181 bits (460), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 113/374 (30%), Positives = 187/374 (50%), Gaps = 18/374 (4%)

Query: 45  PVLTLGSTTFQHIRTSGGLWMVVVVRGNADSAAIWEFLYHMNKLLDAYAINTEE-ALLDD 103
           P LT  +T +  I+ S    + +      + A ++ FLY +  +L  Y    EE ++ D+
Sbjct: 48  PCLTYNNTQYLFIQHSDIYLVAITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDN 107

Query: 104 FMLCYELLDVVLDSGLPQDTELSHIVPLLSRKPATGESASGDDFLNSARLRRTGTKNVSV 163
           +++ YELLD ++D G+PQ TE   +   +++K              S +L +   K  + 
Sbjct: 108 YVIIYELLDELMDYGIPQITETKMLKQYITQK--------------SFKLVKAAKKKQNA 153

Query: 164 ETLDHFSRDVCPWRGEGIKYKKNEVYLDVIEKLSLLVNRDGTILKAYVDGTVQCTAHLSG 223
                   D   WR EGIKYKKNE +LD++E +++L+ + G IL++ + G V+  + LSG
Sbjct: 154 ARPPSALTDSVSWRSEGIKYKKNEAFLDIVESINMLMTQKGQILRSEILGVVKIKSRLSG 213

Query: 224 MPLCHFGFNDXXXXXXXXXXXXYAPRVFGTDERESVVLEDCKFHQCVQLNKFDQERVIRF 283
           MP    G ND                   + ++  + LED KFHQCV+L+KF+ E++I F
Sbjct: 214 MPDLKLGINDKGIFSKQLTEDDTNNNA-TSKKQNKIELEDLKFHQCVRLSKFETEKIITF 272

Query: 284 VPPDGEFELMKYHIRDDLRPPFKVTPVVSKVNERSIEYRITLQSLFPTKLSAKDVELYIP 343
           +PPDG+FELM Y +   ++P       V   +   IE     ++    K +A +VE+ IP
Sbjct: 273 IPPDGDFELMNYRLSTSIKPLIWCDMNVQVHSNSRIEIHCRAKAQIKKKSTATNVEILIP 332

Query: 344 APPYTISAKVNVSCGKCKFVPEENAIIWKIHKFHGLTENTLSAVTIADEQGHYAQVLDQW 403
            P    +     S G  K+VPE++AI+WKI  F G  E +++A          ++ +   
Sbjct: 333 VPEDADTPNFKYSHGSIKWVPEKSAILWKIRSFPGGKEYSMAAELCLPSTSSKSEEVQN- 391

Query: 404 PRPPISMKLEIMMF 417
            + P+ +K +I  F
Sbjct: 392 -KKPVQVKFQIPYF 404

>Smik_6.466 Chr6 (768507..769937) [1431 bp, 476 aa] {ON} YPL259C
           (REAL)
          Length = 476

 Score =  181 bits (458), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 110/348 (31%), Positives = 180/348 (51%), Gaps = 38/348 (10%)

Query: 63  LWMVVVVRG-NADSAAIWEFLYHMNKLLDAYAINTEE-ALLDDFMLCYELLDVVLDSGLP 120
           L++V +V    A++AAI+ FL+ + ++L  Y    EE ++ D+F++ YELLD V+D G+P
Sbjct: 65  LYLVAIVTSLTANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMDYGIP 124

Query: 121 QDTELSHIVPLLSRKPATGESASGDDFLNSARLRRTGTKNVSVETLDHFSRDVCPWRGEG 180
           Q TE   +   +++K            + SA+ +R  T+     T      +   WR EG
Sbjct: 125 QITETKMLKQYITQKSFK--------LVKSAKKKRNATRPPVALT------NSVSWRPEG 170

Query: 181 IKYKKNEVYLDVIEKLSLLVNRDGTILKAYVDGTVQCTAHLSGMPLCHFGFNDXXXXXXX 240
           I +KKNE +LD++E +++L+ + G +L++ + G V+  + LSGMP    G ND       
Sbjct: 171 ITHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKY 230

Query: 241 XXXXXYAPRVFG---------TDERE-------------SVVLEDCKFHQCVQLNKFDQE 278
                  P             TD++              ++ LED KFHQCV+L+KF+ E
Sbjct: 231 LDNDSNIPSAVSAATSDNNTDTDKKPSITSSSTTSKRKVNIELEDLKFHQCVRLSKFENE 290

Query: 279 RVIRFVPPDGEFELMKYHIRDDLRPPFKVTPVVSKVNERSIEYRITLQSLFPTKLSAKDV 338
           ++I F+PPDG+F+LM Y +   ++P       V   +   IE     ++    K +A +V
Sbjct: 291 KIITFIPPDGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNV 350

Query: 339 ELYIPAPPYTISAKVNVSCGKCKFVPEENAIIWKIHKFHGLTENTLSA 386
           E+ IP P    +     S G  K+VPE++AI+WK+  F G  E ++SA
Sbjct: 351 EILIPVPDDADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSA 398

>Suva_16.45 Chr16 complement(66786..68222) [1437 bp, 478 aa] {ON}
           YPL259C (REAL)
          Length = 478

 Score =  180 bits (457), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 110/350 (31%), Positives = 180/350 (51%), Gaps = 40/350 (11%)

Query: 63  LWMVVVVRG-NADSAAIWEFLYHMNKLLDAYAINTEE-ALLDDFMLCYELLDVVLDSGLP 120
           L++V +    +A++AAI+ FL+ + ++L  Y    EE ++ D+F++ YELLD V+D G+P
Sbjct: 65  LYLVAIATSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMDYGIP 124

Query: 121 QDTELSHIVPLLSRKPATGESASGDDFLNSARLRRTGTKNVSVETLDHFSRDVCPWRGEG 180
           Q TE   +   +++K            + SA+ +R  T+     T      +   WR EG
Sbjct: 125 QITETKMLKQYITQKSFK--------LVKSAKKKRNATRPPVALT------NSVSWRPEG 170

Query: 181 IKYKKNEVYLDVIEKLSLLVNRDGTILKAYVDGTVQCTAHLSGMPLCHFGFNDXXXXXXX 240
           I +KKNE +LD++E +++L+ + G +L++ + G V+  + LSGMP    G ND       
Sbjct: 171 ISHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKY 230

Query: 241 XXXXXYAPRV-----------FGTDERESVV-------------LEDCKFHQCVQLNKFD 276
                  P               TD++ S+              LED KFHQCV+L+KF+
Sbjct: 231 LDDSSNLPPAASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDLKFHQCVRLSKFE 290

Query: 277 QERVIRFVPPDGEFELMKYHIRDDLRPPFKVTPVVSKVNERSIEYRITLQSLFPTKLSAK 336
            E++I F+PPDG+F+LM Y +   ++P       V   +   IE     ++    K +A 
Sbjct: 291 NEKIITFIPPDGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTAT 350

Query: 337 DVELYIPAPPYTISAKVNVSCGKCKFVPEENAIIWKIHKFHGLTENTLSA 386
           +VE+ IP P    +     S G  K+VPE++AI+WK+  F G  E ++SA
Sbjct: 351 NVEILIPVPDDADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSA 400

>KNAG0L00950 Chr12 complement(174410..175795) [1386 bp, 461 aa] {ON}
           Anc_7.127 YPL259C
          Length = 461

 Score =  179 bits (454), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 116/364 (31%), Positives = 181/364 (49%), Gaps = 43/364 (11%)

Query: 76  AAIWEFLYHMNKLLDAYAINTEE-ALLDDFMLCYELLDVVLDSGLPQDTELSHIVPLLSR 134
           A ++ FL+ +  +L  Y    EE ++ D+F++ YEL+D ++D G+PQ TE   +   +++
Sbjct: 79  AEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMMDYGIPQITEPRMLKKYITQ 138

Query: 135 KPATGESASGDDFLNSARLRRTGTKNVSVETLDHFSRDVCPWRGEGIKYKKNEVYLDVIE 194
           K    E A      N+AR       +VS             WR EGIKYKKNE +LD++E
Sbjct: 139 KSFKLEKAHKKK-RNAARPPSELNNSVS-------------WRAEGIKYKKNEAFLDIVE 184

Query: 195 KLSLLVNRDGTILKAYVDGTVQCTAHLSGMPLCHFGFNDXXXXXXXXXXXXYA-----PR 249
            +++L+ + G +L++ + G V+  + LSGMP    G ND                   P+
Sbjct: 185 SINMLITQKGQVLRSEIIGAVKIKSRLSGMPDLKLGINDRGIFTKYLEGNNIGVNIPDPQ 244

Query: 250 VFGTDERESVV------------LEDCKFHQCVQLNKFDQERVIRFVPPDGEFELMKYHI 297
             G+   ES +            LED KFHQCV+L+KF+ E++I F+PPDGEF+LM Y +
Sbjct: 245 EHGSGVAESSITNDGKKRKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMNYRL 304

Query: 298 RDDLRPPFKVTPVVSKVNERSIEYRITLQSLFPTKLSAKDVELYIPAPPYTISAKVNVSC 357
              ++P       +   ++  IE R   ++    K  A +V++ IP P    +     S 
Sbjct: 305 TTSIKPLIWCDVSIQVHSKSRIEIRCRAKAQIKKKSVAANVQILIPVPDDADTPSFKYSH 364

Query: 358 GKCKFVPEENAIIWKIHKFHGLTENTLSAVTIADEQGHYAQVLDQWPRP----PISMKLE 413
           G  K+VPE++AI+WKI  F G  E  + A     E G     +D +  P    P+ +K E
Sbjct: 365 GSIKYVPEQSAILWKIKSFPGGKEYAMFA-----EMG--LPSMDSYEEPKVKRPVQVKFE 417

Query: 414 IMMF 417
           I  F
Sbjct: 418 IPYF 421

>NCAS0E02140 Chr5 complement(410049..411494) [1446 bp, 481 aa] {ON}
           Anc_7.127
          Length = 481

 Score =  179 bits (455), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 116/384 (30%), Positives = 193/384 (50%), Gaps = 32/384 (8%)

Query: 45  PVLTLGSTTFQHIRTSGGLWMVVVVRGNADSAAIWEFLYHMNKLLDAYAINTEE-ALLDD 103
           P L+     +  I+ +    + +    +A++A I+ FLY +  +L  Y    EE ++ D+
Sbjct: 79  PCLSYNGMQYLFIQHNDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDN 138

Query: 104 FMLCYELLDVVLDSGLPQDTELSHIVPLLSRKPATGESASGDDFLNSARLRRTGTKNVSV 163
           F++ YELLD  +D G+PQ TE   +   +++K              S +L +   K  + 
Sbjct: 139 FVIIYELLDETMDYGIPQITETKMLKQYITQK--------------SFKLVKAAKKKRNA 184

Query: 164 ETLDHFSRDVCPWRGEGIKYKKNEVYLDVIEKLSLLVNRDGTILKAYVDGTVQCTAHLSG 223
                   +   WR   IKYKKNE +LD+IE +++L+ + G IL++ + G V+  + LSG
Sbjct: 185 ARPPEALTNSVSWRSADIKYKKNEAFLDIIESINMLMTQKGQILRSEIIGEVKVKSRLSG 244

Query: 224 MPLCHFGFNDXXXXXX-----XXXXXXYAPRVFGTDERES-VVLEDCKFHQCVQLNKFDQ 277
           MP    G ND                  +     TD++++ + LED KFHQCV+L+KF+ 
Sbjct: 245 MPDLKLGINDKGIFSKHMDDDSLNNEGASVASSTTDKKKNNIELEDLKFHQCVRLSKFET 304

Query: 278 ERVIRFVPPDGEFELMKYHIRDDLRPPFKVTPVVSKVNERSIEYRITLQSLFPTKLSAKD 337
           E++I F+PPDG+FELM Y +   ++P       +   ++  IE     ++    K +A +
Sbjct: 305 EKIITFIPPDGDFELMNYRLSTSIKPLIWCDMNIQVHSQSRIEIHCRAKAQIKKKSTATN 364

Query: 338 VELYIPAPPYTISAKVNVSCGKCKFVPEENAIIWKIHKFHGLTENTLSAV----TIADEQ 393
           V++ IP P    + +   S G  K+VPE+N IIWKI  F G  E ++SA     +I + +
Sbjct: 365 VQIIIPVPEDADTPEFKYSHGSIKYVPEKNVIIWKIRSFPGGKEYSMSAQMQLPSIGNIE 424

Query: 394 GHYAQVLDQWPRPPISMKLEIMMF 417
            H A       + P+ +K +I  F
Sbjct: 425 EHKA-------KRPVQIKFQIPYF 441

>TDEL0H02890 Chr8 complement(481125..482453) [1329 bp, 442 aa] {ON}
           Anc_7.127 YPL259C
          Length = 442

 Score =  178 bits (451), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 106/314 (33%), Positives = 168/314 (53%), Gaps = 17/314 (5%)

Query: 74  DSAAIWEFLYHMNKLLDAYAINTEE-ALLDDFMLCYELLDVVLDSGLPQDTELSHIVPLL 132
           ++A ++ FL+ + + L  Y    EE ++ D+F++ YELLD ++D G+PQ TE   +   +
Sbjct: 77  NAAQVFTFLHKLVEALGDYLKTVEEESVRDNFVIIYELLDEMMDYGIPQITETKMLKQYI 136

Query: 133 SRKPATGESASGDDFLNSARLRRTGTKNVSVETLDHFSRDVCPWRGEGIKYKKNEVYLDV 192
           ++K      A       +AR     T +VS             WR +GI YKKNE +LD+
Sbjct: 137 TQKSFKLIKAV-KKVKATARPPTGLTNSVS-------------WRADGITYKKNEAFLDI 182

Query: 193 IEKLSLLVNRDGTILKAYVDGTVQCTAHLSGMPLCHFGFNDXXXXXXXXXXXXYAPRVFG 252
           +E +++++N+ G +L++ + G V   + LSGMP    G ND               +V  
Sbjct: 183 VESINMVMNQQGQVLRSEIIGQVIVRSRLSGMPDLKLGINDKGIFTRDPETG--ESQVTA 240

Query: 253 TDERESVVLEDCKFHQCVQLNKFDQERVIRFVPPDGEFELMKYHIRDDLRPPFKVTPVVS 312
             ++ S  LED KFHQCV+L+KF+ E++I F+PPDGEFELM Y +   ++P       V 
Sbjct: 241 GKKKSSAELEDLKFHQCVRLSKFENEKIITFIPPDGEFELMSYRLTTPVKPLIWCDVNVQ 300

Query: 313 KVNERSIEYRITLQSLFPTKLSAKDVELYIPAPPYTISAKVNVSCGKCKFVPEENAIIWK 372
             ++  IE     ++    K  A +VE+ IP P    +     S G  K+VPE+NAI+WK
Sbjct: 301 VHSKSRIEIHCRAKAQIKKKSVANNVEILIPVPDDADTPSFRYSHGSIKWVPEKNAILWK 360

Query: 373 IHKFHGLTENTLSA 386
           I  F+G  E +++A
Sbjct: 361 IRSFYGGKEYSMAA 374

>Skud_16.19 Chr16 complement(30298..31728) [1431 bp, 476 aa] {ON}
           YPL259C (REAL)
          Length = 476

 Score =  178 bits (451), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 117/386 (30%), Positives = 199/386 (51%), Gaps = 45/386 (11%)

Query: 63  LWMVVVVRG-NADSAAIWEFLYHMNKLLDAYAINTEE-ALLDDFMLCYELLDVVLDSGLP 120
           L++V +V    A++AAI+ FL+ + ++L  Y    EE ++ D+F++ YELLD V+D G+P
Sbjct: 65  LYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMDYGIP 124

Query: 121 QDTELSHIVPLLSRKPATGESASGDDFLNSARLRRTGTKNVSVETLDHFSRDVCPWRGEG 180
           Q  E   +   +++K            + SA+ +R  T+     T      +   WR EG
Sbjct: 125 QICETKMLKQYITQKSFK--------LVKSAKKKRNATRPPVALT------NSVSWRPEG 170

Query: 181 IKYKKNEVYLDVIEKLSLLVNRDGTILKAYVDGTVQCTAHLSGMPLCHFGFNDXXXXXXX 240
           I +KKNE +LD++E +++L+ + G +L++ + G V+  + LSGMP    G ND       
Sbjct: 171 IIHKKNEAFLDIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKY 230

Query: 241 XXXXXYAP---------RVFGTDERE-------------SVVLEDCKFHQCVQLNKFDQE 278
                  P          +  TD++              ++ LED KFHQCV+L+KF+ E
Sbjct: 231 LDDDSNTPPPTSAATSDNITDTDKKPSITSSSTTSKRKVNIELEDLKFHQCVRLSKFENE 290

Query: 279 RVIRFVPPDGEFELMKYHIRDDLRPPFKVTPVVSKVNERSIEYRITLQSLFPTKLSAKDV 338
           ++I F+PPDG+F+LM Y +   ++P       V   +   IE     ++    K +A +V
Sbjct: 291 KIITFIPPDGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNV 350

Query: 339 ELYIPAPPYTISAKVNVSCGKCKFVPEENAIIWKIHKFHGLTENTLSA----VTIADE-Q 393
           E+ IP P    +     S G  K+VPE++AI+WK+  F G  E ++SA     +I+++ +
Sbjct: 351 EIIIPVPDDADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNDIE 410

Query: 394 GHYA--QVLDQWPRPPISMKLEIMMF 417
           GH A  +   +  + P+ +K +I  F
Sbjct: 411 GHRAIPKSNAEILKGPVQIKFQIPYF 436

>Kpol_1062.56 s1062 (126558..127910) [1353 bp, 450 aa] {ON}
           (126558..127910) [1353 nt, 451 aa]
          Length = 450

 Score =  175 bits (443), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 109/351 (31%), Positives = 178/351 (50%), Gaps = 23/351 (6%)

Query: 45  PVLTLGSTTFQHIRTSGGLWMVVVVRGNADSAAIWEFLYHMNKLLDAYAINTEE-ALLDD 103
           P L      +  I+ S    + +      + A I+ FL+ +  +L  Y  + EE ++ D+
Sbjct: 48  PCLLYQGIHYLFIQHSDIYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDN 107

Query: 104 FMLCYELLDVVLDSGLPQDTELSHIVPLLSRKPATGESASGDDFLNSARLRRTGTKNVSV 163
           F++ YELLD ++D G+PQ TE   +   +++K              S +L +   K  + 
Sbjct: 108 FVIIYELLDEMMDYGIPQITETKMLKQYITQK--------------SFKLIKAAKKKRNA 153

Query: 164 ETLDHFSRDVCPWRGEGIKYKKNEVYLDVIEKLSLLVNRDGTILKAYVDGTVQCTAHLSG 223
                   +   WR EGIKYKKNE YLD+IE +++L+N+ G +L++ + G V+  + LSG
Sbjct: 154 ARPPVALTNSVSWRQEGIKYKKNEAYLDIIESINMLMNQQGQVLRSEIIGEVKVKSRLSG 213

Query: 224 MPLCHFGFNDX---XXXXXXXXXXXYAPRVFGTD-----ERESVVLEDCKFHQCVQLNKF 275
           MP    G ND                  ++   D     ++ ++ LED KFHQCV+L+KF
Sbjct: 214 MPDLKLGINDKGIFSKYLENEEDFSKPVQIINDDSTTNGKKSNIELEDLKFHQCVRLSKF 273

Query: 276 DQERVIRFVPPDGEFELMKYHIRDDLRPPFKVTPVVSKVNERSIEYRITLQSLFPTKLSA 335
           + E++I F+PPDGEFELM Y +   ++P       +   ++  IE     ++    K  A
Sbjct: 274 ENEKIITFIPPDGEFELMNYRLTTPIKPLIWCDINIQVHSKSRIEIHCRAKAQIKKKSIA 333

Query: 336 KDVELYIPAPPYTISAKVNVSCGKCKFVPEENAIIWKIHKFHGLTENTLSA 386
            +VE+ IP P    +     S G  K++PE+NAI+WK+  F G  E +++A
Sbjct: 334 NNVEILIPVPDDADTPTFKYSHGSIKWLPEKNAILWKLRSFAGGKEYSMTA 384

>CAGL0K00539g Chr11 complement(64028..65398) [1371 bp, 456 aa] {ON}
           highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259c Clathrin coat assembly protein
          Length = 456

 Score =  169 bits (427), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 112/354 (31%), Positives = 183/354 (51%), Gaps = 26/354 (7%)

Query: 45  PVLTLGSTTFQHIRTSGGLWMVVVVRGNADSAAIWEFLYHMNKLLDAY-AINTEEALLDD 103
           P +      F  I+ +    + +    + ++A I+ FL+ + ++L  Y     EE++ D+
Sbjct: 48  PCIEHNGIQFLFIQHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDN 107

Query: 104 FMLCYELLDVVLDSGLPQDTELSHIVPLLSRKPATGESASGDDFLNSARLRRTGTKNVSV 163
           F++ YELLD ++D G+PQ TE   +   +++K +     +     N+AR   + T +VS 
Sbjct: 108 FVIIYELLDEMMDYGIPQITEPKMLKQYITQK-SFKLKKAAKKKRNAARPPTSLTNSVS- 165

Query: 164 ETLDHFSRDVCPWRGEGIKYKKNEVYLDVIEKLSLLVNRDGTILKAYVDGTVQCTAHLSG 223
                       WR EGIK+KKNE +LD+IE +++L+ + G +L++ + G V+  + LSG
Sbjct: 166 ------------WRPEGIKHKKNEAFLDIIESINMLMTQKGQVLRSEIIGEVKVKSKLSG 213

Query: 224 MPLCHFGFNDXXXXXXX----XXXXXYAPRVFGTDERE-------SVVLEDCKFHQCVQL 272
           MP    G ND                 AP     DE +       ++ LED KFHQCV+L
Sbjct: 214 MPDLKLGINDKGLFSKYLEGDENGVPIAPDDSSVDESKPKKKRSNNMELEDLKFHQCVRL 273

Query: 273 NKFDQERVIRFVPPDGEFELMKYHIRDDLRPPFKVTPVVSKVNERSIEYRITLQSLFPTK 332
           +KF+ E+ I F+PPDG+FELM Y +   ++P       +   ++  IE     ++    K
Sbjct: 274 SKFENEKQITFIPPDGDFELMSYRLSTAIKPLIWCDVNIKTHSKSRIEIFCRAKAQIKKK 333

Query: 333 LSAKDVELYIPAPPYTISAKVNVSCGKCKFVPEENAIIWKIHKFHGLTENTLSA 386
            +A +VE+ IP P    +     S G  K+VPE+NAI+WKI  F G  E +++A
Sbjct: 334 STATNVEILIPVPEDADTPVFKYSHGSIKYVPEKNAILWKIRTFPGDKEYSMAA 387

>ZYRO0C05236g Chr3 complement(408616..409959) [1344 bp, 447 aa] {ON}
           highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259C APM1 medium subunit of the clathrin-
           associated protein complex
          Length = 447

 Score =  169 bits (427), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 97/314 (30%), Positives = 165/314 (52%), Gaps = 17/314 (5%)

Query: 76  AAIWEFLYHMNKLLDAYAINTEE-ALLDDFMLCYELLDVVLDSGLPQDTELSHIVPLLSR 134
           A ++ FL+ + ++L+ Y  + EE ++ D+F++ YELLD ++D G+PQ TE   +   +++
Sbjct: 79  AQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDEMMDYGIPQITETKMLKQYITQ 138

Query: 135 KPATGESASGDDFLNSARLRRTGTKNVSVETLDHFSRDVCPWRGEGIKYKKNEVYLDVIE 194
           K              S +L +   K+ +         +   WR   I +KKNE +LD++E
Sbjct: 139 K--------------SFKLMKAVKKSKAAPRPPTEVTNSVSWRAPNIVHKKNEAFLDIVE 184

Query: 195 KLSLLVNRDGTILKAYVDGTVQCTAHLSGMPLCHFGFNDXXXXXXXXXXXX--YAPRVFG 252
            +++L+N+ G +L++ + G ++  + LSGMP    G ND                  V  
Sbjct: 185 SINMLMNQQGQVLRSEIIGQIKVKSKLSGMPDLKLGINDKGIFSKYVEGDSDPVTTAVTE 244

Query: 253 TDERESVVLEDCKFHQCVQLNKFDQERVIRFVPPDGEFELMKYHIRDDLRPPFKVTPVVS 312
             ++ ++ LED KFHQCV+L+KF+ E++I F+PPDG FELM Y +   ++P       V 
Sbjct: 245 GKKKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGAFELMNYRLSMPVKPLIWCDVNVQ 304

Query: 313 KVNERSIEYRITLQSLFPTKLSAKDVELYIPAPPYTISAKVNVSCGKCKFVPEENAIIWK 372
             ++  IE     ++    +  A  VE+ IP P    +     + G  K+VP++NAI+WK
Sbjct: 305 VHSQSRIEIHCRARAQIKKRSIANSVEILIPVPDDADTPSFKYTHGSVKWVPQKNAILWK 364

Query: 373 IHKFHGLTENTLSA 386
           I  F G  E ++SA
Sbjct: 365 IRSFTGGKEYSMSA 378

>TBLA0A00950 Chr1 complement(210799..212208) [1410 bp, 469 aa] {ON}
           Anc_7.127 YPL259C
          Length = 469

 Score =  168 bits (426), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 108/367 (29%), Positives = 180/367 (49%), Gaps = 39/367 (10%)

Query: 45  PVLTLGSTTFQHIRTSGGLWMVVVVRGNADSAAIWEFLYHMNKLLDAYAINTEE-ALLDD 103
           P LT     +  I+ +    + +    + +++ ++ FL+ + +++  Y  + EE ++ D+
Sbjct: 48  PCLTHNGIHYLFIQHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDN 107

Query: 104 FMLCYELLDVVLDSGLPQDTELSHIVPLLSRKPATGESASGDDFLNSARLRRTGTKNVSV 163
           F++ YELLD ++D G+PQ TE   +   +++K              S +L +   K  + 
Sbjct: 108 FVIIYELLDEMMDYGIPQITETKMLKQYITQK--------------SFKLVKAAKKKRNA 153

Query: 164 ETLDHFSRDVCPWRGEGIKYKKNEVYLDVIEKLSLLVNRDGTILKAYVDGTVQCTAHLSG 223
                   +   WR EGIKYKKNE +LD++E +++L+ + G +L++ + G V+  + LSG
Sbjct: 154 ARPPQALTNSVSWRPEGIKYKKNEAFLDIVESINMLMTQQGQVLRSEIIGEVKVRSRLSG 213

Query: 224 MPLCHFGFNDX------------------XXXXXXXXXXXYAPR-VFGTDERES-----V 259
           MP    G ND                                P+   G DE  S     V
Sbjct: 214 MPDLKLGINDKGIFSKYLESTSSNSNSNDDNSNEVNSSKSSTPQPSTGQDEGSSRKTSNV 273

Query: 260 VLEDCKFHQCVQLNKFDQERVIRFVPPDGEFELMKYHIRDDLRPPFKVTPVVSKVNERSI 319
            LED KFHQCV+L+KF+ E++I F+PPDG FELM Y +   ++P       +   ++  +
Sbjct: 274 ELEDLKFHQCVRLSKFENEKIITFIPPDGNFELMSYRLTTPIKPLIWCDVNIHVHSKSRV 333

Query: 320 EYRITLQSLFPTKLSAKDVELYIPAPPYTISAKVNVSCGKCKFVPEENAIIWKIHKFHGL 379
           E     ++    K  A +VE+ IP P    +     S G  K+VPE+NAI+WKI  F G 
Sbjct: 334 EIHCRAKAQIKKKSIANNVEILIPVPDDADTPSFRYSHGSIKWVPEKNAILWKIRSFAGG 393

Query: 380 TENTLSA 386
            E +++A
Sbjct: 394 KEYSMAA 400

>KLTH0D07502g Chr4 (650799..652313) [1515 bp, 504 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019C APM2
           homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 504

 Score =  117 bits (292), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 107/410 (26%), Positives = 188/410 (45%), Gaps = 66/410 (16%)

Query: 43  RSPVLTLGSTTFQHIRTSGGLWMVVVVRGNA--DSAAIWEFLYHMNKLLDAY-AINTEE- 98
           R PV+      + +I    GL+ V V  G    +   I  +L   + LL  Y  +N  + 
Sbjct: 41  RGPVIYSKGIIYIYI-LRDGLYFVSVSNGGLRFNLMGILAYLNDFHALLVKYLKVNKVDR 99

Query: 99  -ALLDDFMLCYELLDVVLDSGLPQDTELSHI---------VPLL-SRKPATGESASGDDF 147
             ++D+F L YEL D  LD G+PQ T+ + I         VP + S   A  +  SG + 
Sbjct: 100 TGIIDNFNLIYELFDESLDYGIPQLTDYNIIRDSIKIEANVPKVPSNSQADSDEESGPEI 159

Query: 148 LNSARLR--------RTGTKNVSVETLDHFSRDVCPWRGEGIKYKKNEVYLDVIEKLSLL 199
           L S   +        R   + ++   L   ++ +  WR +GI Y KNE+++D+IE+ S L
Sbjct: 160 LQSKENKDKADIHGFRDDEQYINSFVLRTTTQAIS-WRPKGIYYTKNELFVDIIERQSYL 218

Query: 200 VN-RDGTILKAYVDGTVQCTAHLSGMPLCHFGFNDXXXXXXXXXXXXYAPRVFGTDERES 258
           ++ ++  + + +V G + C ++LSGMP+     N                      + + 
Sbjct: 219 MDFKNSQVRQTFVYGKINCRSYLSGMPIVRVCINKML-------------------KDKD 259

Query: 259 VVLEDCKFHQCVQLNKFDQERVIRFVPPDGEFELMKYHIRDDLRPPFKVTPVVSKVNERS 318
           + L   KFHQCV L     +  I F+PPDG+F+L +Y ++  +     +  +  K+NER 
Sbjct: 260 LFLGSSKFHQCVSLESLSSQDYIEFIPPDGDFQLCEYKLKRHINDSPIIKLIDYKINERQ 319

Query: 319 IEYR----ITLQSLFPTKLSAKDVELYIPAPPYTISAKVNVS------C--GKCKFVPEE 366
            ++R    +T+Q  F  + SA  ++++IP      + K++++      C  G   F   +
Sbjct: 320 KKHRLHLSVTIQPHFKAQNSATALKIHIPTRDLFQNYKIDLTKAPRFKCDHGSVFFNLSD 379

Query: 367 NAIIWK---IHKFHGLTENTLSA-VTIADEQGHYAQVLDQWPR----PPI 408
             ++W    I   HG T  ++     + DE+ H A+ L+Q  +    PP+
Sbjct: 380 ELLLWDAQGIKGGHGETSYSMHVEFALFDEEEH-ARKLEQIKKSMDPPPL 428

>SAKL0D13090g Chr4 (1093315..1094814) [1500 bp, 499 aa] {ON} weakly
           similar to uniprot|P38700 Saccharomyces cerevisiae
           YHL019C APM2 homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 499

 Score =  108 bits (270), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 91/300 (30%), Positives = 142/300 (47%), Gaps = 65/300 (21%)

Query: 45  PVLTLGSTTFQHIRTSGGLWMVVV--------VRGNADSAAIWEFLYHMNKLLDAYAINT 96
           PV       F +IR  G  ++  V         + + +  AI  +L +   LL  Y  N+
Sbjct: 44  PVFHYKGIHFVYIRRDGFYFISAVELVAEASNKKSHFNVMAILTYLENFYTLLKRY-FNS 102

Query: 97  EEA----LLDDFMLCYELLDVVLDSGLPQDTELSHIVPLL-------------SRKPATG 139
           ++     ++D+F L YELLD  LD G+PQ T+ + I   +             S+K +  
Sbjct: 103 QKLNRWLIVDNFHLIYELLDESLDFGVPQLTDYNIIQDYIKVQVNLHDELADSSKKISKK 162

Query: 140 ESASG--DD--FLNSARLRRTGTKNVSVETLDHFSRDVCPWRGEGIKYKKNEVYLDVIEK 195
           E   G  DD  ++NS  + RT T  +S             WR +GI Y KNE +LDVIE+
Sbjct: 163 EDLHGFEDDESYMNSF-IARTTTSAIS-------------WRPKGIHYTKNEFFLDVIEE 208

Query: 196 LSLLVNRDGT-ILKAYVDGTVQCTAHLSGMPLCHFGFNDXXXXXXXXXXXXYAPRVFGTD 254
           +   ++ + + I K +V G ++C ++LSGMP    G +               P+     
Sbjct: 209 IEYCMDFNKSKIRKNFVHGRIRCRSYLSGMPKLKIGLSKITSS---------LPK----- 254

Query: 255 ERESVVLEDCKFHQCVQLNKFDQERVIRFVPPDGEFELMKYHIRDDLRPPFKVTPVVSKV 314
           ERE   + + KFHQCV L    Q+ ++ F+PPDGEF+L +Y ++  +R P    PV+  V
Sbjct: 255 EREQF-MNNAKFHQCVSLEDL-QKNIVSFIPPDGEFQLCEYKLKRHVRDP----PVIKLV 308

>TDEL0B06430 Chr2 (1137277..1138854) [1578 bp, 525 aa] {ON}
           Anc_2.555 YHL019C
          Length = 525

 Score =  108 bits (269), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 105/404 (25%), Positives = 175/404 (43%), Gaps = 84/404 (20%)

Query: 45  PVLTLGSTTFQHIRTSGGLWMVVV--VRGNADSAAIWEFLYHMNKLLDAY-AINT--EEA 99
           PV++  S  F HI+ S  L++ V+     +A+   I  FL   + LL  Y A++   +  
Sbjct: 43  PVISASSFHFVHIKRSSLLYVSVIHAYDASANVMLIATFLDQFHSLLKKYLAVSALDKNM 102

Query: 100 LLDDFMLCYELLDVVLDSGLPQDTELSHIVPLLSRKPATGESASGDDFL----------N 149
           +LD+ +L  EL+D  +D G+ Q T+ S +   +  K    E+ + DD            N
Sbjct: 103 VLDNVLLIMELIDESIDFGVIQITDASIMRDYIRVKVNMPENKTIDDLSLGDSDTDEEDN 162

Query: 150 SARLRRTGTKNV------------SVETLDHFSRD---------------VCP--WRGEG 180
               RR+G  N+              E  D  +++               + P  WR +G
Sbjct: 163 KKTKRRSGKPNLYKFLRGAKDGTHKAEHTDTAAKEDDVEDSYNSYIAKATIMPVSWRAKG 222

Query: 181 IKYKKNEVYLDVIEKLSLLVN-RDGTILKAYVDGTVQCTAHLSGMPLCHFGFNDXXXXXX 239
           I Y +NE +LDV+E++  L++   G I K  + G + C ++LSGMP     FN       
Sbjct: 223 IHYARNEFFLDVVEQVQYLMDFNSGIIKKNLIHGKIICKSYLSGMPKLKIAFNKLS---- 278

Query: 240 XXXXXXYAPRVFGTDERESVVLEDCKFHQCVQLNKFDQERVIRFVPPDGEFELMKY---- 295
                          +++   +   KFHQCV       E+ I F+PPDG+F L +Y    
Sbjct: 279 ---------------QKDEQFISHSKFHQCVTWPS-SNEKEIEFIPPDGDFVLCQYELKR 322

Query: 296 HIRDDLRPPFKVTP--VVSKVNERSIEYRITLQSLFPTKLSAKDVELYIPAP----PYTI 349
           H++D  +P  K+    V  K+ +  I+   T+++ F  + S   + L IP       Y I
Sbjct: 323 HVKD--QPMLKLVSFGVKPKLKKYKIQMSCTIETHFKARNSTSTLNLKIPLARLFQEYQI 380

Query: 350 S----AKVNVSCGKCKFVPEENAIIWKIHKF---HGLTENTLSA 386
                A+     GK  F   ++ ++W I      HG T+ +++A
Sbjct: 381 DLKKPARFKSDSGKVLFNISDDFLLWDIEVMKGGHGDTQLSMAA 424

>Kwal_26.8146 s26 (665689..667206) [1518 bp, 505 aa] {ON} YHL019C
           (APM2) - Similiar to clathrin coat proteins [contig 55]
           FULL
          Length = 505

 Score =  104 bits (259), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 95/365 (26%), Positives = 163/365 (44%), Gaps = 57/365 (15%)

Query: 62  GLWMVVVVRGNADSAAIWEFLY----HM--NKLLDAYAINTEEALLDDFMLCYELLDVVL 115
           GL+ V +  G+  S+ +   +Y    HM   K L   A++    ++D+F L YELLD  L
Sbjct: 59  GLYFVSMSVGSLRSSIMSTLVYLNDFHMLLKKYLRVNALDRTR-IVDNFNLIYELLDESL 117

Query: 116 DSGLPQDTELS------HIVPLLSRKPATGESASGDDFL-----NSARLRRTGTKNV--- 161
           D G+PQ T+ +       I P +   P    S S DD       N A  +    K+    
Sbjct: 118 DFGIPQLTDFNIIRDSIKIQPNIPPDPKIARSNSDDDESEQEESNVAETQEKSNKHGFQD 177

Query: 162 SVETLDHF----SRDVCPWRGEGIKYKKNEVYLDVIEKLSLLVN-RDGTILKAYVDGTVQ 216
             E ++ F    +     WR +GI Y KNE+++DVIE  + +++ +   + K ++ G + 
Sbjct: 178 DEEYINSFVLRTTTQAISWRPKGIYYAKNELFVDVIESQAYVMDFKHHQVRKNFIFGRII 237

Query: 217 CTAHLSGMPLCHFGFNDXXXXXXXXXXXXYAPRVFGTDERESVVLEDCKFHQCVQLNKFD 276
           C ++LSGMP+     N                      +R+   L   KFHQCV L    
Sbjct: 238 CRSYLSGMPVVKICINKMLK------------------DRDQF-LSSAKFHQCVSLESLS 278

Query: 277 QERVIRFVPPDGEFELMKYHIRDDL--RPPFKVT--PVVSKVNERSIEYRITLQSLFPTK 332
            +  I F+PPDG+F+L +Y I+  +   P  K+    VV K  +  ++  + +Q  F  +
Sbjct: 279 SQDFIEFIPPDGDFQLCEYKIKRHISDSPVIKLIEYKVVEKPKKHKLQISMKIQPHFKAQ 338

Query: 333 LSAKDVELYIPAPPYTISAKVNVS------C--GKCKFVPEENAIIWKIHKFHGLTENTL 384
            SA  +++ +P      + K++++      C  G   F   +  ++WK +   G    T 
Sbjct: 339 NSATFLDIRVPIQDIFETYKIDLTKQPRFKCDFGSILFNLSDGYLLWKANGMKGGHGETY 398

Query: 385 SAVTI 389
            ++ +
Sbjct: 399 HSMQV 403

>Ecym_4591 Chr4 complement(1154444..1155949) [1506 bp, 501 aa] {ON}
           similar to Ashbya gossypii ABR047W
          Length = 501

 Score =  101 bits (251), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 95/385 (24%), Positives = 163/385 (42%), Gaps = 82/385 (21%)

Query: 43  RSPVLTLGSTTFQHIRTSGGLWMVVVVR-GNADSAAIWEFLYHMNKLLDAY-AINTEEAL 100
           +SP+L      +  I+  G  ++ +  +  N     ++ +L  ++ L   Y   N  + L
Sbjct: 39  KSPILQNMDYDYIFIQRDGLYFLSLSYQLTNVYPMVVFSYLNQLHMLFQKYLGENLNKVL 98

Query: 101 LD-DFMLCYELLDVVLDSGLPQDTELSHIVPLL-------SRKPATGES----------- 141
           +  +F L +EL+D  +  G PQ T+ + I   +       S +PAT E+           
Sbjct: 99  ITGNFHLIHELIDESIFMGTPQLTDYNIIRDYIKVQVVKDSPEPATREATVTNTKKNKKK 158

Query: 142 ----------ASGDDFLNSARLRRTGTKNVSVETLDHFSRDVCPWRGEGIKYKKNEVYLD 191
                     A+ ++++NS  + RT T  +S             WR +GI Y KNE YLD
Sbjct: 159 DSKKKEEDTEATDENYMNSY-IARTTTSAIS-------------WRPKGIHYNKNEFYLD 204

Query: 192 VIEKLSLLVNRDGTILKA-YVDGTVQCTAHLSGMPLCHFGFNDXXXXXXXXXXXXYAPRV 250
           VIE L  LV+     +K+  V G +QC ++LSGMP+   G N                  
Sbjct: 205 VIEHLEYLVDFQCMNIKSNTVYGYIQCRSYLSGMPMLTIGLNKL---------------- 248

Query: 251 FGTDERESVVLEDCKFHQCVQLNKFDQERVIRFVPPDGEFELMKYHIRDDLRPP------ 304
              +      +    FHQCV L++   +++I F PPDGEF+L  Y +  ++  P      
Sbjct: 249 ---NSENEYFMRRANFHQCVNLDQLTTDKLISFTPPDGEFQLCNYKLTRNMSDPPMIKLE 305

Query: 305 ---FKVTPVVSKVNERSIEYRITLQSLFPTKLSAKDVELYIPAPPYTISAKVNVS----- 356
               K+ P  +K     +   +T+ + F  + S   + + +P         V++S     
Sbjct: 306 DCKVKLKPRKTKDGLDRLILAVTISTYFKLQDSTSLLNIKVPLSKVFRDWDVDLSYQPRF 365

Query: 357 -C--GKCKFVPEENAIIWKIHKFHG 378
            C  GK  F   ++ ++W++ K  G
Sbjct: 366 KCEQGKVMFNITDDYLLWEVGKVKG 390

>KLLA0F25432g Chr6 complement(2365434..2366957) [1524 bp, 507 aa]
           {ON} some similarities with uniprot|P38700 Saccharomyces
           cerevisiae YHL019C APM2 homologous to the medium chain
           of mammalian clathrin-associated protein complex Similar
           to clathrin coat proteins
          Length = 507

 Score = 97.1 bits (240), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 100/354 (28%), Positives = 152/354 (42%), Gaps = 85/354 (24%)

Query: 102 DDFMLCYELLDVVLDSGLPQDTELSHI-----VPLLSRKPATGESAS-------GDD--- 146
           D+F L +E+++   D G+ Q T  + I     V ++     +  +AS       GD    
Sbjct: 106 DNFHLIFEVIEESSDYGIIQVTNYNIIHDFIKVEVIKPDDDSENTASEKHELPPGDQDET 165

Query: 147 FLNSARLRRTGTKNVSVETLDHFSRDVCPWRGEGIKYKKNEVYLDVIEKLSLLVN-RDGT 205
           F+NS  LR T T  VS             WR +GI Y KNE +LDVIEKL  +++  +G 
Sbjct: 166 FINSYILR-TMTSAVS-------------WRPKGIHYGKNEFFLDVIEKLEFIMDFEEGV 211

Query: 206 ILKAYVDGTVQCTAHLSGMPLCHFGFNDXXXXXXXXXXXXYAPRVFGTDERESVVLEDCK 265
           +    ++GT+ C ++LSGMP    G N                      ++    ++  K
Sbjct: 212 VRNNVINGTIICRSYLSGMPQLSIGLNKLM-------------------QKNVHFMKRLK 252

Query: 266 FHQCVQLNKFDQER--VIRFVPPDGEFELMKYHIRDDLRPPFKVTPVVS----------K 313
           FH+CV L+   +E   VI+F+PPDGEFEL  Y     L  P    PV+           +
Sbjct: 253 FHECVDLHTLIKEESPVIKFIPPDGEFELCNY----KLNRPLLDEPVIKLQSFGLSQKPR 308

Query: 314 VNERSIEYRITLQSLFPTKLSAKDV--ELYIPAPPYTISAKVNV----------SCGKCK 361
            N+ + + ++ L++   T   A+D   EL I  P  ++  K N+            G   
Sbjct: 309 KNQETQD-KLLLKAAITTHFKAQDSAKELLIKIPIKSVIRKWNIDLEKPPLFKSDIGDVV 367

Query: 362 FVPEENAIIWKIHKFHGLTENTLSAVT----IADEQGHYA---QVLDQWPRPPI 408
           F     +IIWKI+   G   N    +     I D Q H A   Q+ +    PP+
Sbjct: 368 FDITAGSIIWKINNLKGGHGNKNYGLKCMFEIWDRQIHEALEVQLRNSMDPPPL 421

>KAFR0A02060 Chr1 (428640..430262) [1623 bp, 540 aa] {ON} Anc_2.555
           YHL019C
          Length = 540

 Score = 96.7 bits (239), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 66/217 (30%), Positives = 105/217 (48%), Gaps = 34/217 (15%)

Query: 176 WRGEGIKYKKNEVYLDVIEKLSLLVNRDGTILKA-YVDGTVQCTAHLSGMPLCHFGFNDX 234
           WR +GI+Y KNE +LDVIEK+   ++    I+K   + G + C + LSGMP      N  
Sbjct: 225 WRAKGIQYAKNEFFLDVIEKVEYFMDFSNNIIKKNLIHGEIICKSFLSGMPTLKVSLN-- 282

Query: 235 XXXXXXXXXXXYAPRVFGTDERESVVLEDCKFHQCVQLNKFDQERVIRFVPPDGEFELMK 294
                         ++   D++    L  CKFHQCV  +  D+ +V+ FVPPDG+F L K
Sbjct: 283 --------------KIIYQDKQ---FLSSCKFHQCVMPDSVDEGKVLEFVPPDGDFVLCK 325

Query: 295 YHIR---DDLRPPFKVTP--VVSKVNERSIEYRITLQSLFPTKLSAKDVELYIPAP---- 345
           Y ++   +DL P  K+    V  K+++  ++  +T++S F    S   + + IP      
Sbjct: 326 YELKRHVNDL-PLLKLISYEVKPKLDKYKLKLFVTIESTFKKTNSTTKLNIKIPLKVLLE 384

Query: 346 PYTISAKVNVSC----GKCKFVPEENAIIWKIHKFHG 378
            Y I    N+      GK  F   ++ ++W+I    G
Sbjct: 385 KYDIDLSKNIKSRCDEGKILFNVSDDFLLWEIGAMKG 421

>ABR047W Chr2 (479283..480779) [1497 bp, 498 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHL019C (APM2)
          Length = 498

 Score = 95.9 bits (237), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 75/275 (27%), Positives = 124/275 (45%), Gaps = 43/275 (15%)

Query: 43  RSPVLTLGSTTFQHIRTSGGLWMVVVVRG--NADSAAIWEFLYHMNKLLDAYAIN--TEE 98
           R PVL+     + +I+  G L+ + +  G        ++ +L  + +L   Y       +
Sbjct: 39  RLPVLSHRGYDYIYIQRDG-LYFLSLSYGVETVVPMTVFAYLGQLYQLFKKYLGERLNRQ 97

Query: 99  ALLDDFMLCYELLDVVLDSGLPQDTELS----HIVPLLSRKPATGESASGDDFLNSARLR 154
            ++D+F L YEL+D  +D G+PQ T+ +    ++   + R+   GE  +G    + A+  
Sbjct: 98  LIMDNFHLVYELMDESIDMGIPQLTDHNIIRDYVKVQVVRRAEDGEKHAGK---HKAKRD 154

Query: 155 RTGTKNVSVE---TLDHF--------SRDVCPWRGEGIKYKKNEVYLDVIEKLSLLVNRD 203
           + G +    +     +HF        +     WR  GI Y KNE +LDV+E+L  L++ +
Sbjct: 155 KAGKEEEEADPGAADEHFMNSYIAKTTTSAISWRPRGIYYSKNEFFLDVVEELEYLMDFE 214

Query: 204 GTILK-AYVDGTVQCTAHLSGMPLCHFGFNDXXXXXXXXXXXXYAPRVFGTDERESVVLE 262
              ++   V G + C ++LSGMP    G N                R F +         
Sbjct: 215 RAQVRLNQVHGAINCRSYLSGMPQLTVGLNKMVAQD----------RDFTS--------- 255

Query: 263 DCKFHQCVQLNKFDQERVIRFVPPDGEFELMKYHI 297
              FHQCV L +   +R I FVPPDGEF+L  Y +
Sbjct: 256 QVHFHQCVDLERLATDRHITFVPPDGEFQLCHYKL 290

>ZYRO0E05874g Chr5 (452910..454559) [1650 bp, 549 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019C APM2
           homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 549

 Score = 92.0 bits (227), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 62/227 (27%), Positives = 108/227 (47%), Gaps = 36/227 (15%)

Query: 176 WRGEGIKYKKNEVYLDVIEKLSLLVN-RDGTILKAYVDGTVQCTAHLSGMPLCHFGFNDX 234
           WR +GI Y KNE +LDV+EK+  L + ++  + K  + G + C ++LSGMP      N  
Sbjct: 238 WRAKGIHYGKNEFFLDVVEKVQYLADFKEKVVRKNLIHGKIYCKSYLSGMPKLKIALNKL 297

Query: 235 XXXXXXXXXXXYAPRVFGTDERESVVLEDCKFHQCVQLNKFDQERVIRFVPPDGEFELMK 294
                               +R++  +   KFHQCV L   + E+ + F+PPDGEF L +
Sbjct: 298 L-------------------QRDAQFMSHSKFHQCVALETLN-EKELEFIPPDGEFILCE 337

Query: 295 YHIRDDLR--PPFKVTPVVSKVNERSIEYRI--TLQSLFPTKLSAKDVELYIPAPPYTIS 350
           Y ++  +   P  K+T    K   +  + RI  T+++ F T+ S   + + IP       
Sbjct: 338 YELKRHVNDTPILKITSFEIKPQLKKFKLRILLTIETHFKTRNSTSILNVKIPLAKLFAD 397

Query: 351 AKVNVS--------CGKCKFVPEENAIIWKIHKF---HGLTENTLSA 386
             +++S         G+  F   ++ ++W+I +    HG T+ ++ A
Sbjct: 398 YNIDLSKPTRFKSAAGQVLFNLSDDFLLWEIGQMRGGHGETQFSMVA 444

>NCAS0A12650 Chr1 (2492345..2494111) [1767 bp, 588 aa] {ON}
           Anc_2.555 YHL019C
          Length = 588

 Score = 91.7 bits (226), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 113/455 (24%), Positives = 179/455 (39%), Gaps = 131/455 (28%)

Query: 45  PVLTLGSTTFQHIRTSGGLWMVVVVRGN-ADSAAIWEFLYHMNKLLDAY---AINTEEAL 100
           P+L      F HI+    +++ VV   +  +   ++ +L    KLL  Y    I     L
Sbjct: 46  PILNDIDWQFLHIKRDSLVFLSVVENNSRCNLLGVFTYLEEFYKLLKDYLHVGILNRNLL 105

Query: 101 LDDFMLCYELLDVVLDSGLPQDTELSHI---------VPLLSRKPAT---GESASGDD-- 146
           +D+F++  EL+D  LD G+ Q T+ S I         +P L+   A+    ESAS DD  
Sbjct: 106 IDNFLVVIELIDESLDFGVVQFTDSSLIKDYVRVKVNLPELNPDVASIPDEESASDDDED 165

Query: 147 ----------------------------------------------FLNSARLRRTGTK- 159
                                                          LN  R R  GT  
Sbjct: 166 IKRKHKHKHKSKHKKKSKATKLLEKENLQEALRKNKAKVVDSIKENILNEERWRFGGTDE 225

Query: 160 --NVSVETLDHFSRD------VCP--WRGEGIKYKKNEVYLDVIEKLSLLVN-RDGTILK 208
             N   +  D +         + P  WR +GI Y KNE +LDVIEK+   ++ + G I K
Sbjct: 226 EINDDEDINDRYMNSYIAKTTIMPISWRTKGIHYGKNEFFLDVIEKVEYFMDFKSGVIRK 285

Query: 209 AYVDGTVQCTAHLSGMPLCHFGFNDXXXXXXXXXXXXYAPRVFGTDERESVVLEDCKFHQ 268
             + G + C ++LSGMP      N                ++   D +    L + KFHQ
Sbjct: 286 NLIHGEIICRSYLSGMPKLKISIN----------------KILKQDVQ---FLSNVKFHQ 326

Query: 269 CVQLN----------------KFDQER-------VIRFVPPDGEFELMKY----HIRDDL 301
           CV L+                K ++E         I F+PPDGEF L KY    H++D  
Sbjct: 327 CVSLDSIRARSNPPAVEEDGKKKNEEADTLGNKGEIEFIPPDGEFLLCKYELKRHVKDQP 386

Query: 302 RPPFKVTPVVSKVNERSIEYRITLQSLFPTKLSAKDVELYIPAPPYTISAKVNVS----- 356
               +   ++ K+++  I+  + +++ F T  S   + L IP      S ++++S     
Sbjct: 387 MIKLRNFEIIPKLHKFKIKIHVIIETHFKTTNSTSKLNLRIPITNLFQSYRIDLSKQPKF 446

Query: 357 -C--GKCKFVPEENAIIWKIHKFH-GLTENTLSAV 387
            C  G   F   +  ++W++   + G  ENTLS +
Sbjct: 447 KCEQGTVLFNLSDKFLLWEVGTMNGGHGENTLSMM 481

>Kpol_1056.13 s1056 complement(30531..32156) [1626 bp, 541 aa] {ON}
           complement(30531..32156) [1626 nt, 542 aa]
          Length = 541

 Score = 90.9 bits (224), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 113/473 (23%), Positives = 190/473 (40%), Gaps = 123/473 (26%)

Query: 19  LISGEAK--ESLSEVFRLQVINGLEIRSPVLTLGSTTFQHIRTSGGLWMVVVVRGNADS- 75
           LIS   K   +L+ +     +N  E   PV T+    +  I+    LW +  +    D  
Sbjct: 15  LISKNVKSVRNLTGILEFFKLNYKENGPPVFTVLEWHYVFIK-RDSLWFMTAIHETDDRI 73

Query: 76  ---AAIWEFLYHMNKLLDAYAINT---EEALLDDFMLCYELLDVVLDSGLPQ-------- 121
               A+  +L  +  LL  Y   +      +LD+ +L  EL+D  +D G+ Q        
Sbjct: 74  TNLMALTFYLDQLYLLLKTYFNRSSLDRNIVLDNVLLIIELIDESMDFGIVQLTDPSIIK 133

Query: 122 --------------------DTELSH------------IVPLLSRKPAT----GESASGD 145
                               DTE  H            IV L   +PA     G+S   D
Sbjct: 134 DYIRVKVNSPITHLTSDDDSDTEEKHKGLSTYIPGKTDIVKLWKGQPAVTANEGKSNEQD 193

Query: 146 D--------FLNSARLRRTGTKNVSVETLDHFSRDVCPWRGEGIKYKKNEVYLDVIEKLS 197
           +        F+NS  + +T    VS             WR +GI Y KNE +LDVIEK+ 
Sbjct: 194 NYDDDDDENFINSY-IAKTTIMPVS-------------WRTKGIYYAKNEFFLDVIEKVQ 239

Query: 198 LLVN-RDGTILKAYVDGTVQCTAHLSGMPLCHFGFNDXXXXXXXXXXXXYAPRVFGTDER 256
            L++   G I K  + G ++C  +LSGMP      N                ++   DE+
Sbjct: 240 YLMDFSTGRIRKNLIHGEIKCKCYLSGMPTLKVALN----------------KLIKNDEQ 283

Query: 257 ESVVLEDCKFHQCVQLNKFDQE------------RVIRFVPPDGEFELMKYHIRDDLR-- 302
               + + KFHQCV +N   +E            + I F+PPDGEF L KY ++  +R  
Sbjct: 284 ---FISNSKFHQCVSINSLKREINNEEEENTYHGKEIEFIPPDGEFVLCKYELKRHVRDV 340

Query: 303 PPFKVT--PVVSKVNERSIEYRITLQSLFPTKLSAKDVELYIPAPPYTISAKVNVS---- 356
           P  K++   +  K+ +  I+  +T+++ F  + S   + + IP        K++++    
Sbjct: 341 PVIKLSNIEIKPKLKKYKIQIHVTIETHFKKQNSTSVLTIKIPLRMVFSQYKIDLTKQPR 400

Query: 357 ----CGKCKFVPEENAIIWKIHKF---HGLTENTLSAVTIADEQGHYAQVLDQ 402
                G+  F   ++ +IW++      +G ++N + A      Q  Y ++ ++
Sbjct: 401 FKSDFGEVLFNISDDFLIWEVGSMKGGNGESKNNMVAEFFIFNQEEYDRLQEE 453

>TPHA0I02390 Chr9 (528997..530676) [1680 bp, 559 aa] {ON} Anc_2.555
           YHL019C
          Length = 559

 Score = 90.9 bits (224), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 107/451 (23%), Positives = 179/451 (39%), Gaps = 116/451 (25%)

Query: 45  PVLTLGSTTFQHIRTSGGLWMVVVVRGNADSAA----IWEFLYHMNKLLDAY---AINTE 97
           P++T+ +  + +++    LW V  +    +       I  +L  +  LL  Y    + T+
Sbjct: 43  PIITVSNWHYVYVK-RDALWFVAAIHYMDEKCMNLMMILFYLDQLYYLLKNYFKKELLTK 101

Query: 98  EALLDDFMLCYELLDVVLDSGLPQDTELS----HIVPLLSRKPATG------------ES 141
             ++D+ +L  EL+D  +D G+ Q T+ S    +I   ++   ATG            ES
Sbjct: 102 LLIIDNALLVTELMDESIDFGIIQMTDPSIIRDYIRVKINNSIATGNNSNDDSDDSDTES 161

Query: 142 ASGD-------DFLNSARLRRTGTKNVSV--ETL-------------------DHFSRDV 173
           AS          ++ SA       K  S   ETL                    H +R  
Sbjct: 162 ASSKKNAKSLGSYMPSANNLTNLWKGYSTKDETLNENVNNDNFENNDDETYINSHIARTT 221

Query: 174 ---CPWRGEGIKYKKNEVYLDVIEKLSLLVN-RDGTILKAYVDGTVQCTAHLSGMPLCHF 229
                WR +GI Y KNE +LDV+E +  L+N +D  I +  + G ++C ++LSGMP    
Sbjct: 222 TMAVSWRTKGIYYAKNEFFLDVVESVQYLMNFKDKVIRRNLIHGQIKCKSYLSGMPTLRI 281

Query: 230 GFNDXXXXXXXXXXXXYAPRVFGTDERESVVLEDCKFHQCVQLN---------------- 273
             N                ++   D++    L   KFHQCV LN                
Sbjct: 282 ALN----------------KILQDDKQ---FLGHAKFHQCVSLNSINIKDLEKDLEGPND 322

Query: 274 ----KFDQERVIRFVPPDGEFELMKYHIRDDLRPP-------FKVTPVVSKVNERSIEYR 322
                F  ++ I F+PPDGEF L +Y +R  ++ P       F + P   K     ++  
Sbjct: 323 ISNKNFVNKKEIEFIPPDGEFVLCQYELRRHVKDPPVINMTSFDIKPNFKKF---RVQIS 379

Query: 323 ITLQSLFPTKLSAKDVELYIPAPPYTISAKVNVS--------CGKCKFVPEENAIIWKIH 374
           + +++ F  + S   + + IP        K+++S         GK  F   E+ +IW+I 
Sbjct: 380 LKIETHFKRQNSTSLMTIKIPLLQLFNDYKIDLSKQPRFKSDVGKVLFNISEDFLIWEID 439

Query: 375 KF---HGLTENTLSAVTIADEQGHYAQVLDQ 402
                HG  E  + A      Q  Y ++ ++
Sbjct: 440 ALKGGHGENEKGMVAEFFLFNQEEYDRLQEE 470

>TBLA0B06760 Chr2 (1594957..1596930) [1974 bp, 657 aa] {ON}
           Anc_2.555 YHL019C
          Length = 657

 Score = 90.1 bits (222), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 63/229 (27%), Positives = 105/229 (45%), Gaps = 39/229 (17%)

Query: 176 WRGEGIKYKKNEVYLDVIEKLSLLVN-RDGTILKAYVDGTVQCTAHLSGMPLCHFGFNDX 234
           WR +GI Y KNE +LDV+EK   +++ ++  I K  + G + C   LSGMP      N  
Sbjct: 289 WRTKGIYYAKNEFFLDVLEKQEYIMDFKNDLIRKNLIQGKIICRCFLSGMPKLKIALN-- 346

Query: 235 XXXXXXXXXXXYAPRVFGTDERESVVLEDCKFHQCVQLNKFDQERVIRFVPPDGEFELMK 294
                         ++   D++    L   +FHQCV L    Q + I F+PPDGEF L +
Sbjct: 347 --------------KLLQKDQQ---FLSQLRFHQCVSLETI-QNKEIEFIPPDGEFILCE 388

Query: 295 YHIRDDLRPP-------FKVTPVVSKVNERSIEYRITLQSLFPTKLSAKDVELYIPAPP- 346
           Y ++  ++ P       F++ P + K     I+  +++ + F  + S   + L IP    
Sbjct: 389 YELKRHVKDPPNIKLISFEIKPKLKKF---KIQINLSITTFFKVQNSTSILNLKIPLEKL 445

Query: 347 ---YTI----SAKVNVSCGKCKFVPEENAIIWKIHKFHGLTENTLSAVT 388
              Y I    S +   + G+ KF   ++ ++W+I    G     + A+T
Sbjct: 446 FNDYKIDLKKSPRFKSNIGQVKFNLSDDFLLWEIGSMKGGHGENIKAMT 494

>NDAI0B01610 Chr2 complement(384287..386305) [2019 bp, 672 aa] {ON}
           Anc_2.555 YHL019C
          Length = 672

 Score = 86.7 bits (213), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 80/321 (24%), Positives = 127/321 (39%), Gaps = 78/321 (24%)

Query: 117 SGLPQDTELSHIVPLLSRKPATGESASGDDFLNSARLRRTGTK--------NVSVETLDH 168
           +G      LS++  L   K       + D  L+  RLR  G          ++ + TL  
Sbjct: 217 TGAGAGLNLSNLTKLEKDKILETIKKNKDKVLDGTRLRIGGGNRQDTDTDTDIELGTLGE 276

Query: 169 FSRDV-------------CPWRGEGIKYKKNEVYLDVIEKLSLLVN-RDGTILKAYVDGT 214
            + D+               WR +GI Y KNE +LDVIEK+   ++   G I K  + G 
Sbjct: 277 GNNDIYMNSYIAKTTIMPISWRTKGIHYAKNEFFLDVIEKVEYFMDFEKGLIRKNLIHGE 336

Query: 215 VQCTAHLSGMPLCHFGFNDXXXXXXXXXXXXYAPRVFGTDERESVVLEDCKFHQCVQLNK 274
           + C  +LSGMP      N                ++   D   S  L +  FHQCV L+ 
Sbjct: 337 IVCKCYLSGMPKLKISIN----------------KILQND---SQFLSNAHFHQCVSLDS 377

Query: 275 F-------------------------DQERVIRFVPPDGEFELMKY----HIRDDLRPPF 305
                                     D+++ I F+PPDG+F L KY    H++D      
Sbjct: 378 LHLQSAEDDDGDDNANVNENENHDERDRKKEIEFIPPDGDFLLCKYELKRHVKDLPVIKL 437

Query: 306 KVTPVVSKVNERSIEYRITLQSLFPTKLSAKDVELYIPA----PPYTI--SAKVNVSC-- 357
           K+  +  K+++  ++  + +++ F T  +   + L IP       Y I  S ++   C  
Sbjct: 438 KLFDIKPKLSKYKLKIHVIIETHFKTTNNTSKLNLKIPIERLFQEYRIDLSKQIKFKCDQ 497

Query: 358 GKCKFVPEENAIIWKIHKFHG 378
           GK  F   +N +IW+I    G
Sbjct: 498 GKVLFNLSDNFLIWEIGSMKG 518

 Score = 35.0 bits (79), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 43/79 (54%), Gaps = 4/79 (5%)

Query: 54  FQHIRTSGGLWMVVVVRGNADS-AAIWEFLYHMNKLLDAYAINTE---EALLDDFMLCYE 109
           F HI+    +++ ++   + +S   I+ +L    KLL +Y   T+     L+D+F+L  E
Sbjct: 78  FLHIKRDSLIFVSIIENNSMNSLMIIFSYLEEFYKLLKSYLNVTKLDKGLLIDNFLLVME 137

Query: 110 LLDVVLDSGLPQDTELSHI 128
           LLD  LD G+ Q T+ S I
Sbjct: 138 LLDESLDFGIVQFTDSSLI 156

>Suva_8.33 Chr8 complement(69735..71525) [1791 bp, 596 aa] {ON}
           YHL019C (REAL)
          Length = 596

 Score = 85.1 bits (209), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 65/260 (25%), Positives = 106/260 (40%), Gaps = 50/260 (19%)

Query: 176 WRGEGIKYKKNEVYLDVIEKLSLLVN-RDGTILKAYVDGTVQCTAHLSGMPLCHFGFNDX 234
           WR +GI Y KNE +LDVIE++  L++   G I K  + G + C  +LSGMP      N  
Sbjct: 254 WRTKGIHYSKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRCYLSGMPKLKISINKL 313

Query: 235 XXXXXXXXXXXYAPRVFGTDERESVVLEDCKFHQCVQLNKFD------------------ 276
                                R+   + + KFHQCV L+  +                  
Sbjct: 314 L-------------------NRDPQFMSNSKFHQCVSLDSINIIEEEGRDTDDAGSQTAT 354

Query: 277 QERVIRFVPPDGEFELMKY----HIRDDLRPPFKVTPVVSKVNERSIEYRITLQSLFPTK 332
             + I F+PPDGEF L +Y    H++D      +   +  K+ +  I+    +Q+ F   
Sbjct: 355 DTKEIEFIPPDGEFVLCQYELKRHVKDAPMIKLQGFEIKPKLKKFKIQIITKIQTNFKPT 414

Query: 333 LSAKDVELYIPAPPYTISAKVNVS--------CGKCKFVPEENAIIWKIHKFHGLTENTL 384
            S   + + IP        K+++S         GK  F   ++ ++W+I    G  E   
Sbjct: 415 NSTSKLNVKIPLTKVFQDYKIDLSKQIRFKANLGKVVFNLSDDFLLWEIGTMKGHRERNT 474

Query: 385 SAVTIADEQGHYAQVLDQWP 404
             V   D+    A ++ ++P
Sbjct: 475 GTVPQEDDASTLASMVAEFP 494

 Score = 32.0 bits (71), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 45/90 (50%), Gaps = 6/90 (6%)

Query: 45  PVLTLGSTTFQHIRTSGGLWMVVV---VRGNADSAAIWEFLYHMNKLLDAY-AIN--TEE 98
           P+L+     F H++     ++ V+    + N D  +I  FL     LL  Y  IN  ++ 
Sbjct: 43  PILSQNGWFFIHLKRDFLHFISVIHATDKPNIDLMSILAFLEQFYHLLKKYFEINVLSKN 102

Query: 99  ALLDDFMLCYELLDVVLDSGLPQDTELSHI 128
            +LD+ +L  EL+D  +D G+ Q T+ S I
Sbjct: 103 IILDNVLLVLELVDECIDFGIVQVTDPSII 132

>Skud_8.26 Chr8 complement(55759..57549) [1791 bp, 596 aa] {ON}
           YHL019C (REAL)
          Length = 596

 Score = 83.2 bits (204), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 66/242 (27%), Positives = 100/242 (41%), Gaps = 51/242 (21%)

Query: 176 WRGEGIKYKKNEVYLDVIEKLSLLVN-RDGTILKAYVDGTVQCTAHLSGMPLCHFGFNDX 234
           WR +GI Y KNE +LDVIE++  L++   G I K  + G + C ++LSGMP      N  
Sbjct: 255 WRTKGIHYAKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRSYLSGMPKLKISINKI 314

Query: 235 XXXXXXXXXXXYAPRVFGTDERESVVLEDCKFHQCVQLNKFD-----QE----------- 278
                                R+   + +  FHQCV L+  +     QE           
Sbjct: 315 L-------------------NRDPQFMSNSNFHQCVSLDSINTIEKGQEKEQNTGDSQAA 355

Query: 279 ---RVIRFVPPDGEFELMKY----HIRDDLRPPFKVTPVVSKVNERSIEYRITLQSLFPT 331
              R I FVPPDGEF L +Y    H++D      K   +  K+ +  I+    +Q+ F  
Sbjct: 356 ADAREIEFVPPDGEFVLCQYELKRHVKDAPMIKLKDFEIKPKLKKSKIQILTKIQTNFKP 415

Query: 332 KLSAKDVELYIPAPPYTISAKVNVS--------CGKCKFVPEENAIIWKIHKFHGLTENT 383
             S   + + IP        K+++S         GK  F   ++ ++W+I    G  E  
Sbjct: 416 TNSTSKLNVKIPLTRVFQDYKIDLSKQIRFKANNGKVVFNLSDDFLLWEIQTMKGHRERN 475

Query: 384 LS 385
            S
Sbjct: 476 AS 477

 Score = 32.0 bits (71), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 44/91 (48%), Gaps = 8/91 (8%)

Query: 45  PVLTLGSTTFQHIRTSGGLWMVVVV----RGNADSAAIWEFLYHMNKLLDAY---AINTE 97
           P+L      F H++    L +V V+    + N D   I  FL     LL  Y    + ++
Sbjct: 43  PILFQNDWFFIHLKRDF-LHLVSVIHTTDKPNIDLMTILAFLEQFYHLLQKYFEIKVLSK 101

Query: 98  EALLDDFMLCYELLDVVLDSGLPQDTELSHI 128
           + +LD+ +L  EL+D  +D G+ Q T+ S I
Sbjct: 102 DLILDNVLLVLELMDECIDFGIVQVTDPSII 132

>CAGL0K03223g Chr11 (296371..298167) [1797 bp, 598 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019c
           involved in clathrin-independent transport
          Length = 598

 Score = 82.0 bits (201), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 64/250 (25%), Positives = 107/250 (42%), Gaps = 65/250 (26%)

Query: 176 WRGEGIKYKKNEVYLDVIEKLSLLVN-RDGTILKAYVDGTVQCTAHLSGMPLCHFGFNDX 234
           WR +GI Y KNE +LDVIEKL  LV+   G + ++ + G + C ++LSGMP      N  
Sbjct: 251 WRAKGIHYAKNEFFLDVIEKLQYLVDLESGMVRRSLIHGQIVCRSYLSGMPKLKMSLN-- 308

Query: 235 XXXXXXXXXXXYAPRVFGTDERESVVLEDCKFHQCVQLNKFDQ----------------- 277
                         ++   D++    +   +FHQCV L+  ++                 
Sbjct: 309 --------------KLLQNDKQ---FISQVQFHQCVSLDSIEKVIKYAEEHSDELKTLKH 351

Query: 278 -----ERVIRFVPPDGEFELMKYHIRDDLRPP-------FKVTPVVSKVNERSIEYRITL 325
                E  I F+PPDG+F L  Y ++  +R P       F++TP   K  +  ++    +
Sbjct: 352 TEHNAESEIEFIPPDGDFTLCSYELKRHIRDPPMVKLCSFEITP---KWKKYKLKISAAV 408

Query: 326 QSLFPTKLSAKDVELYIPAPP----YTIS----AKVNVSCGKCKFVPEENAIIWKI---- 373
           ++ F    S   +++ IP       Y I      K   S G+  +   ++ ++W+I    
Sbjct: 409 ETHFKPTNSTSKLDVKIPISKVFKDYQIDLKKPIKFKTSNGRVVYNISDDFLLWEIGVIK 468

Query: 374 -HKFHGLTEN 382
             K HG  E+
Sbjct: 469 GGKMHGSKED 478

 Score = 31.2 bits (69), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 63/133 (47%), Gaps = 10/133 (7%)

Query: 1   MIDAFFVFAPRGSLIVSKLISGEAK-ESLSEVFRLQVINGLEIRSPVLTLGSTTFQHIRT 59
           M  + ++F      +VSK + G      L ++FR  V    + ++P++ + +  F +I+ 
Sbjct: 1   MSSSIYIFDETLEPLVSKSVKGLPNVNELGDLFRYHV---RQSQNPIIDVYNWRFVYIKR 57

Query: 60  SGGLWMVVVVRGN---ADSAAIWEFLYHMNKLLDAYA---INTEEALLDDFMLCYELLDV 113
               ++ VV   +   A+  AI  +L  + +L   Y    +     +LD+ +L  EL+D 
Sbjct: 58  DTLYFVAVVDAADDAIANYLAILTYLEQLYQLFRDYVGVKVLDRNLVLDNTLLVMELIDE 117

Query: 114 VLDSGLPQDTELS 126
            LD G+ Q TE S
Sbjct: 118 TLDYGIVQLTEPS 130

>YHL019C Chr8 complement(67731..69548) [1818 bp, 605 aa] {ON}
           APM2Protein of unknown function, homologous to the
           medium chain of mammalian clathrin-associated protein
           complex; involved in vesicular transport
          Length = 605

 Score = 81.6 bits (200), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 64/241 (26%), Positives = 100/241 (41%), Gaps = 52/241 (21%)

Query: 176 WRGEGIKYKKNEVYLDVIEKLSLLVN-RDGTILKAYVDGTVQCTAHLSGMPLCHFGFNDX 234
           WR +GI Y KNE +LDVIE++  L++   G I K  + G + C  +LSGMP      N  
Sbjct: 260 WRTKGIHYAKNEFFLDVIERVQYLMDFEKGVIRKNLIHGEIVCRCYLSGMPKLKISINKI 319

Query: 235 XXXXXXXXXXXYAPRVFGTDERESVVLEDCKFHQCVQLNKF-----DQE----------- 278
                                R+   + +  FHQCV L+       D+E           
Sbjct: 320 L-------------------NRDPQFMSNSSFHQCVSLDSINTIEKDEEKNSDDDAGLQA 360

Query: 279 ----RVIRFVPPDGEFELMKY----HIRDDLRPPFKVTPVVSKVNERSIEYRITLQSLFP 330
               R I F+PPDGEF L +Y    H++D      K   +  K+ +  I+    +Q+ F 
Sbjct: 361 ATDAREIEFIPPDGEFVLCQYELKRHVKDAPMVRLKDFEIKPKLKKFKIQIVTKIQTNFK 420

Query: 331 TKLSAKDVELYIPAPPYTISAKVNVS--------CGKCKFVPEENAIIWKIHKFHGLTEN 382
              S   + + IP        K+++S         GK  F   ++ ++W+I    G  E+
Sbjct: 421 PTNSTSKLNVRIPLTKVFQEYKIDLSKQIRFKANIGKVVFNLSDDFLLWEIQTMKGHREH 480

Query: 383 T 383
           +
Sbjct: 481 S 481

 Score = 33.9 bits (76), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 43/91 (47%), Gaps = 8/91 (8%)

Query: 45  PVLTLGSTTFQHIRTSGGLWMVVVV----RGNADSAAIWEFLYHMNKLLDAY---AINTE 97
           P+L+     F H++    L  V V+    + N D   I  FL     LL  Y    + T+
Sbjct: 43  PILSQNDWFFIHLK-RDFLHFVSVIHTTDKPNIDLMTILAFLEQFYHLLQKYFEIEVLTK 101

Query: 98  EALLDDFMLCYELLDVVLDSGLPQDTELSHI 128
             +LD+ +L  EL+D  +D G+ Q T+ S I
Sbjct: 102 NVILDNILLVLELIDECIDFGIVQVTDPSII 132

>KNAG0C05550 Chr3 complement(1076437..1078185) [1749 bp, 582 aa]
           {ON} Anc_2.555 YHL019C
          Length = 582

 Score = 80.5 bits (197), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 62/226 (27%), Positives = 102/226 (45%), Gaps = 50/226 (22%)

Query: 176 WRGEGIKYKKNEVYLDVIEKLSLLVN-RDGTILKAYVDGTVQCTAHLSGMPLCHFGFNDX 234
           WR +GI Y KNE +L+VIEK+   ++     I K  + G ++C   LSGMP      N  
Sbjct: 255 WRTKGIHYAKNEFFLNVIEKVEYFMDFTQNVIKKNLIHGEIRCKCFLSGMPNLKVSIN-- 312

Query: 235 XXXXXXXXXXXYAPRVFGTDERESVVLEDCKFHQCVQLNKFDQ--ERVIRFVPPDGEFEL 292
                         ++   D++    L +CKFHQCV L   +    + + FVPPDGEF L
Sbjct: 313 --------------KIVNEDKQ---FLANCKFHQCVSLASLESSDHKDVEFVPPDGEFTL 355

Query: 293 MKY----HIRDDLRPPFKVTPVVSKVN--------ERSIEYRITLQSLFPTKLSAKDVEL 340
            +Y    H+RD+        P+V  VN        +  ++  +T+++ F T  +   + L
Sbjct: 356 CRYELKRHVRDE--------PMVKLVNFEVKPKLKKFKLKLLLTIETHFKTTNATSKLAL 407

Query: 341 YIPAPPYTISAKVNVS------C--GKCKFVPEENAIIWKIHKFHG 378
            +P        +V++S      C  G   F   ++ ++W++    G
Sbjct: 408 RVPIKQLFREYRVDLSKNLKSKCDRGAILFNISDDFLLWEVGSMSG 453

>Smik_8.23 Chr8 complement(51372..53183) [1812 bp, 603 aa] {ON}
           YHL019C (REAL)
          Length = 603

 Score = 80.5 bits (197), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 64/248 (25%), Positives = 103/248 (41%), Gaps = 51/248 (20%)

Query: 176 WRGEGIKYKKNEVYLDVIEKLSLLVN-RDGTILKAYVDGTVQCTAHLSGMPLCHFGFNDX 234
           WR +GI Y KNE +LDVIE++  L++   G I K  + G + C  +LSGMP      N  
Sbjct: 262 WRTKGIHYAKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRCYLSGMPKLKISINKI 321

Query: 235 XXXXXXXXXXXYAPRVFGTDERESVVLEDCKFHQCVQLN----------KFDQE------ 278
                                R++  L +  FHQCV L+          K D +      
Sbjct: 322 L-------------------NRDAQFLSNSSFHQCVSLDSIKTIEKREEKEDDDTGLQAA 362

Query: 279 ---RVIRFVPPDGEFELMKY----HIRDDLRPPFKVTPVVSKVNERSIEYRITLQSLFPT 331
              + + FVPPDGEF L +Y    H++D      K   +  K+ +  I+    +Q+ F  
Sbjct: 363 ADAKELEFVPPDGEFVLCQYELKRHVKDAPMIKLKDFQIKPKLKKFKIQIETKIQTNFKP 422

Query: 332 KLSAKDVELYIPAPPYTISAKVNVS--------CGKCKFVPEENAIIWKIHKFHGLTENT 383
             S   + + IP        ++++S         GK  F   ++ ++W+I    G  E+ 
Sbjct: 423 TNSTSKLNVKIPLTKVFQEYRIDLSKQIRFKSNIGKVVFNLSDDFLLWEIQAMKGHREHN 482

Query: 384 LSAVTIAD 391
            +  +  D
Sbjct: 483 TNKTSQDD 490

 Score = 34.3 bits (77), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 44/91 (48%), Gaps = 8/91 (8%)

Query: 45  PVLTLGSTTFQHIRTSGGLWMVVVV----RGNADSAAIWEFLYHMNKLLDAY---AINTE 97
           P+L+     F H++    L  V V+    + N D   I  FL     LL  Y    + T+
Sbjct: 43  PILSQNDWFFIHLK-RDFLHFVSVIHTTDKPNIDLMTILAFLEQFYHLLQEYFEIKVLTK 101

Query: 98  EALLDDFMLCYELLDVVLDSGLPQDTELSHI 128
           + +LD+ +L  EL+D  +D G+ Q T+ S I
Sbjct: 102 DVILDNVLLVLELMDECIDFGIVQVTDPSII 132

>KAFR0D03560 Chr4 complement(695693..697060) [1368 bp, 455 aa] {ON}
           Anc_2.522 YBR288C
          Length = 455

 Score = 72.4 bits (176), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 53/210 (25%), Positives = 103/210 (49%), Gaps = 39/210 (18%)

Query: 96  TEEALLDDFMLCYELLDVVLDSGLPQDTELSHIVPLLSRKPATGESASGDDFLNSARLRR 155
           T   +++++     L D+++D G+       ++  L ++ P   + +   +F+N A  + 
Sbjct: 103 TTTKIMNNYDRMTILFDLLIDGGIIDGNNF-YMNKLRNQIPLKNDFS---NFINDA-AKS 157

Query: 156 TGTKNVSVETLDHFSRDVCPWRGEGIKYKKNEVYLDVIEKLSLLV---NRDG---TILKA 209
                   +T+D+   +V PWR + IK  +NE+Y+DV E L + +   NR      +L  
Sbjct: 158 LQKGQAPSKTVDN---EVVPWRSKEIKTVRNEIYVDVKETLYVTLIKSNRASHRLKLLNG 214

Query: 210 YVDGTVQCTAHLSGMPLCHFGFNDXXXXXXXXXXXXYAPRVFGTDERESVVLEDCKFHQC 269
           Y++G+V   + + G+P+    F                    G D ++ +     KFH C
Sbjct: 215 YINGSVSVDSSIGGVPMLEVSFG-------------------GCDFKDIIP----KFHDC 251

Query: 270 VQLNKF--DQERVIRFVPPDGEFELMKYHI 297
           V++N+F  +   +I+F+PPDG+F+LM+Y +
Sbjct: 252 VEVNEFLTNDGNIIKFIPPDGKFQLMEYSM 281

>KLTH0D06556g Chr4 complement(570972..572342) [1371 bp, 456 aa] {ON}
           similar to uniprot|P38153 Saccharomyces cerevisiae
           YBR288C APM3 Mu3-like subunit of the yeast AP-3 complex
           which functions in transport of alkaline phosphatase to
           the vacuole via the alternate pathway clathrin
           associated protein medium chain
          Length = 456

 Score = 70.1 bits (170), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 58/228 (25%), Positives = 102/228 (44%), Gaps = 34/228 (14%)

Query: 110 LLDVVLDSGLPQDTELSHIVPLLSRKPATGESASGDDFLNSARLRRTGTK---NVSVETL 166
           LL+ ++D+  P  T+ +H+  ++  +    +  +      S R+ +  T    N+     
Sbjct: 118 LLNCMVDANEPAVTDFNHLRDMVPSREDLSKVINSTASSLSNRISQRNTSQVLNIGDPAK 177

Query: 167 DHFSRD-VCPWRGEGIKYKKNEVYLDVIEKLSLLVNRDG-----TILKAYVDGTVQCTAH 220
              +++ + PWR  G+KY  NE+Y+DV+E + +++ ++      T ++  +DG V   +H
Sbjct: 178 GPAAKEKLVPWRSAGVKYSNNELYVDVVETVHVILRKNEKTGELTSVRGVLDGVVDFRSH 237

Query: 221 LSGMPLCHFGFNDXXXXXXXXXXXXYAPRVFGTDERESVVLEDCKFHQCVQLNKFDQERV 280
           LSG P+                      R+ G D      L     HQC   +   +   
Sbjct: 238 LSGNPVIALNL-----------------RLRGHD------LGMPALHQCCLDSYQGRPDQ 274

Query: 281 IRFVPPDGEFELMKYHIRDDLRPPFKVTPVVSKVNERSIEYRITLQSL 328
           +RFVPPDG+F+LM Y I  DL      + + S +   S +YR  L  L
Sbjct: 275 LRFVPPDGKFQLMHYSI--DLDSLQSKSKLFSNIGLVSPDYRTELGDL 320

>SAKL0A09218g Chr1 complement(802348..803734,803809..803843) [1422
           bp, 473 aa] {ON} similar to uniprot|P38153 Saccharomyces
           cerevisiae YBR288C APM3 Mu3-like subunit of the yeast
           AP-3 complex which functions in transport of alkaline
           phosphatase to the vacuole via the alternate pathway
           clathrin associated protein medium chain
          Length = 473

 Score = 66.6 bits (161), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 66/233 (28%), Positives = 108/233 (46%), Gaps = 43/233 (18%)

Query: 110 LLDVVLDSGLPQDTELSH---IVPL---LSRKPATGESASGDDFLNSA--RLRRTGTKNV 161
           L + ++D+G P  T+L+    IVPL    +R   +  S+ G    N+   ++    + N 
Sbjct: 130 LFNSMVDAGEPDITDLNRLKEIVPLKNNFARVINSTASSIGKTISNAEGNQMFSKHSSNS 189

Query: 162 SV-ETLDHFSRD-VCPWRGEGIKYKKNEVYLDVIEKLSLLV--NRDGTIL---KAYVDGT 214
            +  ++ + +RD   PWR  G+KY  NE+Y+D+ E +++++   R+ T L      +DG 
Sbjct: 190 RIGSSVSYANRDRTVPWRSAGVKYTNNELYVDMAETVNIILAKTRNSTSLVPISGSIDGE 249

Query: 215 VQCTAHLSGMPLCHFGFNDXXXXXXXXXXXXYAPRVFGTDERESVVLEDCKFHQCVQLNK 274
           V    +LS  PL     N                   G D      L    FH+CV+   
Sbjct: 250 VGFKCYLSENPLVELDLNTN-----------------GHD------LGIPAFHRCVRTEG 286

Query: 275 FD-QERVIRFVPPDGEFELMKYHIR-DDLRPPFKVTPVVSKVNERSIEYRITL 325
            D     +RF+PPDG+F LM+Y+I  D LR   K   ++S +   S++Y   L
Sbjct: 287 SDFHPGTLRFIPPDGDFCLMEYNIDLDSLRNRNK---ILSNLGLVSVDYHTGL 336

>Kwal_26.7957 s26 complement(586544..587914) [1371 bp, 456 aa] {ON}
           YBR288C (APM3) - clathrin associated protein medium
           chain [contig 55] FULL
          Length = 456

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 45/161 (27%), Positives = 73/161 (45%), Gaps = 30/161 (18%)

Query: 173 VCPWRGEGIKYKKNEVYLDVIEKLSLLVN---RDGTI--LKAYVDGTVQCTAHLSGMPLC 227
           + PWR  G+KY  NE+Y+DV+E + +++    + G +  ++  +DG V   +HL+G P+ 
Sbjct: 185 LVPWRTAGLKYSNNELYVDVVETIHVILRKTEKSGQLVPVRGLIDGYVDFRSHLTGNPVV 244

Query: 228 HFGFNDXXXXXXXXXXXXYAPRVFGTDERESVVLEDCKFHQCVQLNKFDQERVIRFVPPD 287
               N                 + G D      L     H C Q         ++FVPPD
Sbjct: 245 ALKLN-----------------LHGHD------LGVPALHPCCQAQYTGSPENLQFVPPD 281

Query: 288 GEFELMKYHIRDDLRPPFKVTPVVSKVNERSIEYRITLQSL 328
           G+F LM+Y I  DL      + + S +   S++Y + L  L
Sbjct: 282 GKFRLMQYTI--DLEALQTKSKLFSNMGLVSLDYFVGLGDL 320

>TBLA0I00620 Chr9 complement(110231..112060) [1830 bp, 609 aa] {ON}
           Anc_2.522 YBR288C
          Length = 609

 Score = 64.3 bits (155), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 85/193 (44%), Gaps = 38/193 (19%)

Query: 133 SRKPATGESASGDDFLNSARLRRTGTKNVSVETLDH---FSRDVCPWRGEGIKYKKNEVY 189
           S +  T    SG +  ++  +   G  N S     +    +  V PWR   +KY  NE+Y
Sbjct: 212 STRSITSNLLSGSNNTSNVSISGNGMGNNSSSGFGNSGTINNKVVPWRSGNVKYTNNEIY 271

Query: 190 LDVIEKLSLLVNRDGT------------------ILKAYVDGTVQCTAHLSGMPLCHFGF 231
           +DVIE++ ++  R  +                  +++A + G +   ++LS  P+     
Sbjct: 272 IDVIEEIHVVYQRRNSKRYHKINQFNRNDNSPMKLIRADIIGELNVRSYLSDNPMVEVTL 331

Query: 232 NDXXXXXXXXXXXXYAPRVFGTDERE---SVVLEDCKFHQCVQLN---KFDQE-RVIRFV 284
            D            Y+ +  G  E +    + L    FH CV+++     +Q+ R I+F+
Sbjct: 332 VD----------RNYSDQKTGWSENDLFKQLNLGLPMFHDCVEIDYEKGINQDFRHIKFI 381

Query: 285 PPDGEFELMKYHI 297
           PPDG+F LMKY+I
Sbjct: 382 PPDGKFSLMKYNI 394

>ZYRO0B01738g Chr2 complement(139975..141453) [1479 bp, 492 aa] {ON}
           similar to uniprot|P38153 Saccharomyces cerevisiae
           YBR288C APM3 Mu3-like subunit of the yeast AP-3 complex
           which functions in transport of alkaline phosphatase to
           the vacuole via the alternate pathway clathrin
           associated protein medium chain
          Length = 492

 Score = 63.5 bits (153), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 72/170 (42%), Gaps = 31/170 (18%)

Query: 150 SARLRRTGTKNVSVETLDHFSRDVCPWRGEGIKYKKNEVYLDVIEKLSLLV-----NRDG 204
           + R  R G    + E L+  S +V PWR   +KY  +E+Y+D+IE + ++      N   
Sbjct: 170 AVRQPRQGILAATPEILE--SEEVVPWRSGHLKYTSDEIYVDIIETVHVIYQTHHRNNSV 227

Query: 205 TILKAYVDGTVQCTAHLSGMPLCHFGFNDXXXXXXXXXXXXYAPRVFGTDERESVVLEDC 264
            ++   ++G V   ++LSG P      +             YAP                
Sbjct: 228 QMVSGTINGQVNVKSYLSGNPTVEMDMD-------LAGNEMYAP---------------- 264

Query: 265 KFHQCVQLNKFDQERVIRFVPPDGEFELMKYHIRDDLRPPFKVTPVVSKV 314
             HQCV++ +     +  F+PPDG   L+ Y I  D+ P  KVT  V  V
Sbjct: 265 SMHQCVEMPQGSPSSLC-FIPPDGNCNLLNYTIDLDMNPKVKVTSPVGLV 313

>TDEL0A02970 Chr1 complement(532395..533885) [1491 bp, 496 aa] {ON}
           Anc_2.522 YBR288C
          Length = 496

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 62/145 (42%), Gaps = 37/145 (25%)

Query: 172 DVCPWRGEGIKYKKNEVYLDVIEKLSLLVNRDGT----------ILKAYVDGTVQCTAHL 221
           DV PWR  G+KY  NE+Y+D+ E + ++  + G           ++   ++G      +L
Sbjct: 209 DVVPWRTAGLKYSNNELYVDLTESIHVVYQKAGKRSRRTSSKLEMICGTINGQASVKCYL 268

Query: 222 SGMPLCHFGFNDXXXXXXXXXXXXYAPRVFGTDERESVVLEDCKFHQCVQLNKFDQERV- 280
           SG P      +                 + G D      L    FH+CV+L+        
Sbjct: 269 SGNPTVDLQLD-----------------LAGND------LGVPAFHECVELDNHQNPSNC 305

Query: 281 -IRFVPPDGEFELMKYHIRDDLRPP 304
            +RF+PPDG F LM+Y I  DL  P
Sbjct: 306 DLRFIPPDGRFNLMQYSI--DLDTP 328

>AGL061W Chr7 (593647..594882) [1236 bp, 411 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR288C (APM3)
          Length = 411

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 58/249 (23%), Positives = 98/249 (39%), Gaps = 43/249 (17%)

Query: 63  LWMVVVVRGNADSAAIWEFLYHMNKLLDAY---AINTEEALLDDFMLCYELLDVVLDSG- 118
           LW   + +   D      FL   +++L  Y      T + L+++      LL  +LD+G 
Sbjct: 23  LWYWALCQACGDPLEPQMFLAQYHQVLIEYFDKEALTVKKLVNNADRLALLLHAMLDAGE 82

Query: 119 --LPQDTELSHIVPLLSR-----KPATGESASGDDFLNSARLRRTGTKNVSVETLDHFSR 171
             +     L  +VPL +        AT   A+   + +S +L         VE     + 
Sbjct: 83  VAVTDSNRLRQLVPLRNDLSTILNSATKTLANTVKYADSKQLFGAPVATGKVE-----AG 137

Query: 172 DVCPWRGEGIKYKKNEVYLDVIEKLSLLVNRDG---TILKAYVDGTVQCTAHLSGMPLCH 228
              PWR    +Y  NE+Y+D++E ++  + + G   T++   + G +    +LSG P   
Sbjct: 138 QTVPWRTADCRYVNNEIYVDLVETVNATLRQKGSSLTLINGSLSGKIDVKCYLSGNPTVQ 197

Query: 229 FGFNDXXXXXXXXXXXXYAPRVFGTDERESVVLEDCKFHQCVQLNKFDQERVIRFVPPDG 288
                               R  G        L++   H+CV+L +      + FVPPDG
Sbjct: 198 LKL-----------------RTSGHP------LDNSALHRCVELGEAGVA-TMNFVPPDG 233

Query: 289 EFELMKYHI 297
            F L +Y I
Sbjct: 234 RFTLAEYAI 242

>Kpol_1018.42 s1018 (137162..138889) [1728 bp, 575 aa] {ON}
           (137162..138889) [1728 nt, 576 aa]
          Length = 575

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/147 (24%), Positives = 63/147 (42%), Gaps = 43/147 (29%)

Query: 174 CPWRGEGIKYKKNEVYLDVIEKLSLL----VNRDG----------TILKAYVDGTVQCTA 219
            PWR + +K+  NE+Y+D++E + ++    + R             I+  Y+ GT    +
Sbjct: 201 APWRSQNVKHNNNEIYIDLVESVHVVYQTKIRRSNELTRSKQSIKKIVNGYLKGTAYVQS 260

Query: 220 HLSGMPLCHFGFNDXXXXXXXXXXXXYAPRVFGTDERESVVLEDCKFHQCVQLNKF---- 275
            L+G PL                       + G D      +    FH+CV ++++    
Sbjct: 261 FLNGNPLVELQL-----------------ELSGND------IGHPSFHECVDIDEYLKNI 297

Query: 276 DQERV--IRFVPPDGEFELMKYHIRDD 300
           D   +  ++F+PPDG+F LM Y I  D
Sbjct: 298 DNSSISSLKFIPPDGKFTLMDYTITLD 324

>KLLA0E18789g Chr5 (1669103..1670596) [1494 bp, 497 aa] {ON} similar
           to uniprot|P38153 Saccharomyces cerevisiae YBR288C APM3
           Mu3-like subunit of the yeast AP-3 complex which
           functions in transport of alkaline phosphatase to the
           vacuole via the alternate pathway clathrin associated
           protein medium chain
          Length = 497

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 59/129 (45%), Gaps = 30/129 (23%)

Query: 175 PWRGEGIKYKKNEVYLDVIEKLSLLVNRDGTILKAYVDGTVQCTAHLSGMPLCHFGFNDX 234
           PWR  GI Y  NE+++D+ E+++ +V + G +L  ++ G +    HLSG PL        
Sbjct: 211 PWRMSGINYANNEIFIDMSEEINAIVEK-GKLLTGHIKGCIDLNNHLSGQPLVEM----- 264

Query: 235 XXXXXXXXXXXYAPRVFGTDERESVVLEDCKFHQCVQLNKFD--------QERVIRFVPP 286
                         ++   D + S +  +  FH+C+  +K +        +   + FVPP
Sbjct: 265 --------------KLGLLDHKLSHL--NTTFHRCILEDKANSINDLIAGKFTKLTFVPP 308

Query: 287 DGEFELMKY 295
           DG   L +Y
Sbjct: 309 DGRTRLCQY 317

>NCAS0A04870 Chr1 (973552..975021) [1470 bp, 489 aa] {ON} Anc_2.522
           YBR288C
          Length = 489

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 61/262 (23%), Positives = 105/262 (40%), Gaps = 61/262 (23%)

Query: 74  DSAAIWEFLYHMNKLLDAYAINTE---EALLDDFMLCYELLDVVLDSG-----LPQDTEL 125
           DS  +  FL ++++L+  Y    E   + L+++F     LL  V++ G        +  +
Sbjct: 79  DSVEVDCFLEYLDELILEYFDKDEVSVKKLVNNFDRLSLLLHSVVNGGEINVGFLYNNRI 138

Query: 126 SHIVP-LLSRKPATGESASGDDFLNSARLRRTGTKNVSVETLDHFSRD-VCPWRGEGIKY 183
            ++VP +   +    E+A      +S  +R  G+      +      D V PWR  GIK 
Sbjct: 139 QNVVPPVHDLRKILNETAHTIMNQSSGAMRSAGSGVAFNASSSSRGEDMVVPWRRNGIKD 198

Query: 184 KKNEVYLDVIEKLSLLV-------NRDGT--------ILKAYVDGTVQCTAHLSGMPLCH 228
            K E+Y+D+ E++ +          RDG         ++  ++ GT+    +L+G P   
Sbjct: 199 AKEELYVDLKEEVYVTYRKSDRHHGRDGIRTSNPSMELVSGHIKGTIDVRCYLNGNPTVS 258

Query: 229 FGFNDXXXXXXXXXXXXYAPRVFGTDERESVVLEDCKFHQCVQLN-------------KF 275
             F+                   G D      L    FH CV+                F
Sbjct: 259 LMFD-----------------TMGND------LGIPSFHACVEQEDQVQEQKQEQEPESF 295

Query: 276 DQERVIRFVPPDGEFELMKYHI 297
             +R++RF+PPDG+F L +Y I
Sbjct: 296 QGKRLLRFLPPDGKFRLAQYVI 317

>TPHA0C04130 Chr3 complement(886804..888405) [1602 bp, 533 aa] {ON}
           Anc_2.522 YBR288C
          Length = 533

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/150 (22%), Positives = 64/150 (42%), Gaps = 29/150 (19%)

Query: 160 NVSVETLDHFSRDVCPWRGEGIKYKKNEVYLDVIEKLSLLV----------NRDGTILKA 209
           N   + ++  S    PWR   + +  NE+YLD++E + +++          N    I+  
Sbjct: 188 NFPYQDMNFDSNVAVPWRMRNVDHVNNELYLDLVESIHVVLETKKRKSSYANSTMKIVTG 247

Query: 210 YVDGTVQCTAHLSGMPLCHFGFNDXXXXXXXXXXXXYAPRVFGTDERESVVLEDC-KFHQ 268
            + G     + L+G P+     +                     ++ ES+ L +C K   
Sbjct: 248 NIIGKALVKSVLNGNPIVEMKID------------------MAGNDLESIFLHECVKSKD 289

Query: 269 CVQLNKFDQERVIRFVPPDGEFELMKYHIR 298
             +  +F+  ++I+F+PPDG F+L  Y+I 
Sbjct: 290 VDKDQEFENTKLIKFLPPDGSFKLFDYNIN 319

>Ecym_7266 Chr7 (559988..560022,560112..561630) [1554 bp, 517 aa]
           {ON} similar to Ashbya gossypii AGL061W
          Length = 517

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 69/328 (21%), Positives = 123/328 (37%), Gaps = 53/328 (16%)

Query: 1   MIDAFFVFAPRGSLIVSKLISGEA---KESLSEVFRLQVINGLEIRSPVLTLGSTTFQHI 57
           M  +F++     +LI   L S  A   K+   ++ + Q  NG       ++     + H 
Sbjct: 1   MFTSFYITDSNRNLIFEYLTSSFAPTFKQINHKIAKQQENNGNNASVVRVSRDVALYGHF 60

Query: 58  RTSGGLWMVVVVRGNADSAAIWEFLYHMNKLLDAY---AINTEEALLDDFMLCYELLDVV 114
            +   L+   +     D      FL   + LL  Y    + T   L+++      LL+ +
Sbjct: 61  SSVNRLYYWALCEQCDDPLKPLVFLSRFDGLLMEYFDRDVLTATKLMNNQDRLALLLNSI 120

Query: 115 LDSG-------------LPQDTELSHI----VPLLSRKPATGESASGDDFLNSARLRRTG 157
           +D+G             LP  T+LS +       L+R     ES++     NS+ +    
Sbjct: 121 IDAGEIVMSDTNKLRYLLPLHTDLSTVFSSATKTLTRTIKNRESSNFLGSSNSSNINGGP 180

Query: 158 TKNVSVETLDHFSRDVCPWRGEGIKYKKNEVYLDVIEKLSLLVNRDGT----ILKAYVDG 213
           T N S ++       V PWR   +    NE+Y+D++E L+L + +       +    + G
Sbjct: 181 TINRSSDS--PLDAQVVPWRIPNLSNVNNEIYVDMVETLTLNLKQSRPNSFHVFHGVISG 238

Query: 214 TVQCTAHLSGMPLCHFGFNDXXXXXXXXXXXXYAPRVFGTDERESVVLEDCKFHQCVQ-L 272
            +    +L G P      +              A   F          +    H+C+   
Sbjct: 239 KIDLKCYLRGNPTMQINLHS-------------AGHAF----------KPSALHRCLDPS 275

Query: 273 NKFDQERVIRFVPPDGEFELMKYHIRDD 300
           +       +RF+PPDG+F L++Y I  D
Sbjct: 276 SSSFDSSSLRFIPPDGKFTLLEYTIDLD 303

>Suva_4.548 Chr4 complement(950244..951698) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 62/136 (45%), Gaps = 31/136 (22%)

Query: 172 DVCPWR-GEGIKYKKNEVYLDVIEKLSLLVNRDGTILK---AYVDGTVQCTAHLSGMPLC 227
           D+ PWR  +  K++ NE+Y+D++E   +++ +  T L+     + G V   ++L+  PL 
Sbjct: 197 DIVPWRTSKTSKHENNELYVDLLETFHVVLEKKKTRLRLVNGDICGAVDVRSYLNDNPLV 256

Query: 228 HFGFNDXXXXXXXXXXXXYAPRVFGTDERESVVLEDCKFHQCVQLNKFDQERV---IRFV 284
               N                   G +      +     H+CV++N  D E     I F+
Sbjct: 257 SVKLN-----------------TMGNE------IGIPSLHECVEIND-DGEFTPSNITFI 292

Query: 285 PPDGEFELMKYHIRDD 300
           PPDG+F L++Y I  D
Sbjct: 293 PPDGKFRLLEYSINLD 308

>Skud_2.419 Chr2 complement(746943..748397) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 35/135 (25%), Positives = 62/135 (45%), Gaps = 31/135 (22%)

Query: 170 SRDVCPWR-GEGIKYKKNEVYLDVIEKLSLLVNRDGTILK---AYVDGTVQCTAHLSGMP 225
           + +V PWR  +  K++ NE+Y+D++E   ++     + L+     + GTV   ++L+  P
Sbjct: 195 NEEVVPWRTSKASKHENNELYVDLLETFHVVFETKKSRLRLVNGNIHGTVDVRSYLNNNP 254

Query: 226 LCHFGFNDXXXXXXXXXXXXYAPRVFGTDERESVVLEDCKFHQCVQLNKFDQERV---IR 282
           L     N                   G D      +     H+CV++ K D E +   I 
Sbjct: 255 LVSVKLN-----------------TMGND------IGVPTLHECVEI-KDDGEFLPSNIT 290

Query: 283 FVPPDGEFELMKYHI 297
           F+PPDG+F L++Y +
Sbjct: 291 FIPPDGKFRLLEYSV 305

>NDAI0K01930 Chr11 (437535..439373) [1839 bp, 612 aa] {ON} Anc_2.522
           YBR288C
          Length = 612

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/153 (23%), Positives = 60/153 (39%), Gaps = 53/153 (34%)

Query: 173 VCPWRGEGIKYKKNEVYLDVIEKLSL-----LVNRDG-------------------TILK 208
           + PWR   IK  KNE+Y+D+ E + +     + NR G                    ++ 
Sbjct: 258 IVPWRNGNIKNAKNELYIDMKEDIHVNFRNQIKNRKGRTYDNNNSNGIRVNNPSCMKLMN 317

Query: 209 AYVDGTVQCTAHLSGMPLCHFGFNDXXXXXXXXXXXXYAPRVFGTDERESVVLEDCKFHQ 268
            Y+ G +   ++L+G P+     N                   G D      +     H 
Sbjct: 318 GYITGVIDVRSYLNGNPIVEMKLN-----------------TCGND------MGTPSLHP 354

Query: 269 CVQLN---KFDQERV---IRFVPPDGEFELMKY 295
           CV+L      D ++V   ++F+PPDG+F L +Y
Sbjct: 355 CVELEGDMNGDDDKVMDSLKFIPPDGKFCLARY 387

>Smik_2.430 Chr2 complement(763687..765141) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 59/133 (44%), Gaps = 31/133 (23%)

Query: 170 SRDVCPWR-GEGIKYKKNEVYLDVIEKLSLLVNRDGT---ILKAYVDGTVQCTAHLSGMP 225
           + ++ PWR     K++ NE+YLD++E   ++  +  +   ++   + GT+   ++L+  P
Sbjct: 195 NEEIVPWRTSRASKHENNELYLDLLETFHVVFEKKKSHIRLVNGNIHGTLDVRSYLNDTP 254

Query: 226 LCHFGFNDXXXXXXXXXXXXYAPRVFGTDERESVVLEDCKFHQCVQLNK---FDQERVIR 282
           L     N                   G D      +     H+CV++N    F     I 
Sbjct: 255 LVLVKLN-----------------TMGND------IGIPSLHECVEINDGGVFSPSN-IT 290

Query: 283 FVPPDGEFELMKY 295
           F+PPDG+F L++Y
Sbjct: 291 FIPPDGKFRLLEY 303

>YBR288C Chr2 complement(778012..779463) [1452 bp, 483 aa] {ON}
           APM3Mu3-like subunit of the clathrin associated protein
           complex (AP-3); functions in transport of alkaline
           phosphatase to the vacuole via the alternate pathway
          Length = 483

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 36/147 (24%), Positives = 63/147 (42%), Gaps = 32/147 (21%)

Query: 170 SRDVCPWR-GEGIKYKKNEVYLDVIEKLSLLVNRDGT---ILKAYVDGTVQCTAHLSGMP 225
           + ++ PWR     K++ NE+Y+D++E   ++  +  +   +L   + G V   ++L+  P
Sbjct: 195 NEEIVPWRTSRASKHENNELYVDLLETFHVVFEKKKSHLRLLTGSIHGIVDVRSYLNDNP 254

Query: 226 LCHFGFNDXXXXXXXXXXXXYAPRVFGTDERESVVLEDCKFHQCVQLNK--FDQERVIRF 283
           L     N                   G D      +     H CV++N   F     I F
Sbjct: 255 LVAVKLN-----------------TMGND------IGIPSLHDCVEINDGVFSPSN-ITF 290

Query: 284 VPPDGEFELMKYHIRDDLRPPFKVTPV 310
           +PPDG+F L++Y +  DL    K + V
Sbjct: 291 IPPDGKFRLLEYSV--DLSSQVKQSGV 315

>CAGL0L02145g Chr12 (252110..253741) [1632 bp, 543 aa] {ON} similar
           to uniprot|P38153 Saccharomyces cerevisiae YBR288c APM3
           AP-3 complex subunit mu3 subunit
          Length = 543

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 60/247 (24%), Positives = 95/247 (38%), Gaps = 58/247 (23%)

Query: 173 VCPWR-GEGIKYKKNEVYLDVIEKLSLLVN-----------------RDGTI--LKAYVD 212
           V PWR G+ I   +NE+Y DV E + ++                   R G +  ++  + 
Sbjct: 224 VAPWRNGKNIHNDRNELYADVREVIQVVYQKKYSSKKNDSRRKIFGRRSGHLEYVRGNIS 283

Query: 213 GTVQCTAHLSGMPLCHFGFNDXXXXXXXXXXXXYAPRVFGTDERESVVLEDCKFHQCV-Q 271
           G+V     L+G PL                    A +  G D      +    FH CV +
Sbjct: 284 GSVDMRCFLTGNPLVEI-----------------ALKQGGLD------IGIPGFHDCVDK 320

Query: 272 LNKFDQERV--IRFVPPDGEFELMKYHIRDDLRPPFKVTPVVSKVNER----SIEYRITL 325
            +   QE++  + F+PPDG F LM+Y+I  D      V  V + + +       E+ +TL
Sbjct: 321 TSLLKQEKISKLSFIPPDGRFTLMQYNINLDQGKRHSVGLVHADIEDHLGTLGDEFEVTL 380

Query: 326 QSLFPTKLSAKDVE-----LYIPAPPYTISAKVNVSCGKCKFVPEENAIIWKIHKFHGLT 380
                +  S K +E     LY            ++S  + +F  E+   I  +   HG  
Sbjct: 381 N--ISSSTSVKHIEDMEVMLYFGLSHGNRKKDTHLSSDEEEFSVEQ-FRIKPLQITHGRL 437

Query: 381 ENTLSAV 387
           EN  S V
Sbjct: 438 ENMSSGV 444

>KNAG0A06970 Chr1 complement(1086674..1088191) [1518 bp, 505 aa]
           {ON} Anc_2.522 YBR288C
          Length = 505

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 60/142 (42%), Gaps = 39/142 (27%)

Query: 172 DVCPWRGEGIKYKKNEVYLDVIEKLSLLV-------NRDGT-----ILKAYVDGTVQCTA 219
           ++ PWR   +  ++NE Y+DV E + ++V          GT     ++   + G V C  
Sbjct: 204 EIVPWRSAKVNSRRNEFYVDVRESVEVVVERAAHRSTSRGTPAPLQLVTGCITGVVDCRC 263

Query: 220 HLSGMPLCHFGFNDXXXXXXXXXXXXYAPRVFGTDERESVVLEDCKFHQCVQLNKFDQ-- 277
           +LS  P+    FN+                  G D      L     H CV+L+   +  
Sbjct: 264 YLSRDPIVEVTFNN-----------------HGCD------LGTPALHDCVELDGVPEGP 300

Query: 278 --ERVIRFVPPDGEFELMKYHI 297
                ++F+PPDG+F LM+Y +
Sbjct: 301 ADHTTLKFIPPDGKFRLMEYSV 322

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.136    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 45,674,959
Number of extensions: 1835797
Number of successful extensions: 4879
Number of sequences better than 10.0: 82
Number of HSP's gapped: 4767
Number of HSP's successfully gapped: 107
Length of query: 492
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 378
Effective length of database: 40,409,475
Effective search space: 15274781550
Effective search space used: 15274781550
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 68 (30.8 bits)