Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ADR200C5.524ON2338124548130.0
Ecym_40605.524ON220155010161e-110
SAKL0G04862g5.524ON24445886165e-63
TDEL0A038805.524ON16964934535e-44
Suva_2.5975.524ON17975324491e-43
Smik_4.6955.524ON15555524454e-43
KLLA0A01826g5.524ON14645654437e-43
ZYRO0D12496g5.524ON23855384421e-42
YDR420W (HKR1)5.524ON18025193838e-36
KNAG0C032605.524ON15304573675e-34
Skud_4.6945.524ON15042202961e-25
Kwal_47.186505.524ON21592222862e-24
SAKL0H23188g4.150ON12622162682e-22
KLTH0G03696g5.524ON20854042621e-21
Kpol_363.145.524ON7612282394e-19
AGR019C4.150ON11052192342e-18
CAGL0F03003g5.524ON11852112314e-18
ZYRO0G11242g4.150ON14872112316e-18
TDEL0D030104.150ON11232102289e-18
KAFR0E033205.524ON11903102262e-17
YGR014W (MSB2)4.150ON13062162128e-16
KLLA0C17985g4.150ON9082102055e-15
Skud_7.2994.150ON11692142039e-15
Kwal_47.177034.150ON15682621966e-14
NCAS0A052304.150ON7852101948e-14
TPHA0K013904.150ON8261911903e-13
TPHA0L003605.524ON11613371886e-13
KAFR0F034704.150ON9491791867e-13
Smik_7.3024.150ON11892161851e-12
Suva_7.2964.150ON11352151795e-12
Kpol_1062.374.150ON9732111752e-11
KLTH0E08844g4.150ON1520891716e-11
NDAI0K025804.150ON9851881707e-11
TBLA0G009505.524ON22533551431e-07
KNAG0D035904.150ON994921421e-07
Ecym_73494.150ON1129931402e-07
CAGL0F08833g4.150ON936901312e-06
TBLA0G012104.150ON1825891242e-05
NDAI0F014506.242ON68770766.7
AGR092W8.257ON59678749.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADR200C
         (2338 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADR200C Chr4 complement(1051878..1058894) [7017 bp, 2338 aa] {ON...  1858   0.0  
Ecym_4060 Chr4 (125127..131732) [6606 bp, 2201 aa] {ON} similar ...   395   e-110
SAKL0G04862g Chr7 (392107..399441) [7335 bp, 2444 aa] {ON} some ...   241   5e-63
TDEL0A03880 Chr1 (690387..695477) [5091 bp, 1696 aa] {ON} Anc_5....   179   5e-44
Suva_2.597 Chr2 (1058501..1059391,1059470..1059725,1059765..1059...   177   1e-43
Smik_4.695 Chr4 (1227757..1232424) [4668 bp, 1555 aa] {ON} YDR42...   176   4e-43
KLLA0A01826g Chr1 complement(163010..167404) [4395 bp, 1464 aa] ...   175   7e-43
ZYRO0D12496g Chr4 (1047901..1055058) [7158 bp, 2385 aa] {ON} som...   174   1e-42
YDR420W Chr4 (1306267..1311675) [5409 bp, 1802 aa] {ON}  HKR1Muc...   152   8e-36
KNAG0C03260 Chr3 complement(639021..643613) [4593 bp, 1530 aa] {...   145   5e-34
Skud_4.694 Chr4 (1228095..1232609) [4515 bp, 1504 aa] {ON} YDR42...   118   1e-25
Kwal_47.18650 s47 complement(913245..919724) [6480 bp, 2159 aa] ...   114   2e-24
SAKL0H23188g Chr8 (2009677..2013465) [3789 bp, 1262 aa] {ON} som...   107   2e-22
KLTH0G03696g Chr7 (286341..292598) [6258 bp, 2085 aa] {ON} some ...   105   1e-21
Kpol_363.14 s363 (25673..27781,27783..27959) [2286 bp, 761 aa] {...    97   4e-19
AGR019C Chr7 complement(747644..750961) [3318 bp, 1105 aa] {ON} ...    95   2e-18
CAGL0F03003g Chr6 (289923..293480) [3558 bp, 1185 aa] {ON} some ...    94   4e-18
ZYRO0G11242g Chr7 (900370..904833) [4464 bp, 1487 aa] {ON} weakl...    94   6e-18
TDEL0D03010 Chr4 complement(564735..568106) [3372 bp, 1123 aa] {...    92   9e-18
KAFR0E03320 Chr5 complement(659303..662875) [3573 bp, 1190 aa] {...    92   2e-17
YGR014W Chr7 (516943..520863) [3921 bp, 1306 aa] {ON}  MSB2Mucin...    86   8e-16
KLLA0C17985g Chr3 complement(1596320..1599046) [2727 bp, 908 aa]...    84   5e-15
Skud_7.299 Chr7 (520447..523956) [3510 bp, 1169 aa] {ON} YGR014W...    83   9e-15
Kwal_47.17703 s47 (521283..525989) [4707 bp, 1568 aa] {ON} YNR04...    80   6e-14
NCAS0A05230 Chr1 (1034523..1036880) [2358 bp, 785 aa] {ON} Anc_4...    79   8e-14
TPHA0K01390 Chr11 complement(287666..290146) [2481 bp, 826 aa] {...    78   3e-13
TPHA0L00360 Chr12 complement(50396..53881) [3486 bp, 1161 aa] {O...    77   6e-13
KAFR0F03470 Chr6 (689705..692554) [2850 bp, 949 aa] {ON} Anc_4.1...    76   7e-13
Smik_7.302 Chr7 (508666..512235) [3570 bp, 1189 aa] {ON} YGR014W...    76   1e-12
Suva_7.296 Chr7 (508904..512311) [3408 bp, 1135 aa] {ON} YGR014W...    74   5e-12
Kpol_1062.37 s1062 complement(78801..81722) [2922 bp, 973 aa] {O...    72   2e-11
KLTH0E08844g Chr5 (804120..808682) [4563 bp, 1520 aa] {ON} some ...    70   6e-11
NDAI0K02580 Chr11 complement(574995..577952) [2958 bp, 985 aa] {...    70   7e-11
TBLA0G00950 Chr7 complement(232502..239263) [6762 bp, 2253 aa] {...    60   1e-07
KNAG0D03590 Chr4 (657513..660497) [2985 bp, 994 aa] {ON} Anc_4.1...    59   1e-07
Ecym_7349 Chr7 complement(722484..725873) [3390 bp, 1129 aa] {ON...    59   2e-07
CAGL0F08833g Chr6 (873849..876659) [2811 bp, 936 aa] {ON} weakly...    55   2e-06
TBLA0G01210 Chr7 (321555..327032) [5478 bp, 1825 aa] {ON} Anc_4....    52   2e-05
NDAI0F01450 Chr6 (358291..360354) [2064 bp, 687 aa] {ON} Anc_6.2...    34   6.7  
AGR092W Chr7 (908750..910540) [1791 bp, 596 aa] {ON} Syntenic ho...    33   9.5  

>ADR200C Chr4 complement(1051878..1058894) [7017 bp, 2338 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YDR420W
            (HKR1)
          Length = 2338

 Score = 1858 bits (4813), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 945/1245 (75%), Positives = 945/1245 (75%)

Query: 1094 RLETTSIGGVISSTLTASPTDELSKSGSTSRLNSITSPASEAVSTQSSKDISYKLGYPLS 1153
            RLETTSIGGVISSTLTASPTDELSKSGSTSRLNSITSPASEAVSTQSSKDISYKLGYPLS
Sbjct: 1094 RLETTSIGGVISSTLTASPTDELSKSGSTSRLNSITSPASEAVSTQSSKDISYKLGYPLS 1153

Query: 1154 VGTYTISNPHXXXXXXXXXXXXXXXXXXPVKSYTTSEIXXXXXXXXXXXXXXXXXXXXIX 1213
            VGTYTISNPH                  PVKSYTTSEI                    I 
Sbjct: 1154 VGTYTISNPHSSESSSTFSTTTTETGTTPVKSYTTSEIDTTSGHHTSTDSQTTGTSHGIS 1213

Query: 1214 XXXXXXXXXXXXXXXXVFVPGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 1273
                            VFVPGE                                      
Sbjct: 1214 VTTSPSESSSRSSLSSVFVPGESTSSGSTISFSLPSTTEQATTATETTSHHTSSEYISSS 1273

Query: 1274 XNXXXXXXXXXXXXXXXXXXXXXXXXXXDIFWSNTISTPTTTPFLVIPSFSSVSSTNTVD 1333
             N                          DIFWSNTISTPTTTPFLVIPSFSSVSSTNTVD
Sbjct: 1274 QNIGFPTIGGSTISTTSKSFTFSAPSSSDIFWSNTISTPTTTPFLVIPSFSSVSSTNTVD 1333

Query: 1334 SGLRQTNTVSSQPFVXXXXXXXXXXXXXXXXXXXXXXXXXXYIPSSAETASASIARTSTF 1393
            SGLRQTNTVSSQPFV                          YIPSSAETASASIARTSTF
Sbjct: 1334 SGLRQTNTVSSQPFVSSTLSLATTSNTLVLPSSPLSQQEPSYIPSSAETASASIARTSTF 1393

Query: 1394 QISTFXXXXXXXXXXXXXXXXXXITVGVLSYSSVPNTENFSTDSDFRXXXXXXXXXXXXX 1453
            QISTF                  ITVGVLSYSSVPNTENFSTDSDFR             
Sbjct: 1394 QISTFSHPPSTTKPASTATNAATITVGVLSYSSVPNTENFSTDSDFRSTAPPSISPGSGT 1453

Query: 1454 XXXXVTAFNTEIPTTRNSIASAPTPXXXXXXXXXXXXKVFEKTDWLPATIITESVQQHLP 1513
                VTAFNTEIPTTRNSIASAPTP            KVFEKTDWLPATIITESVQQHLP
Sbjct: 1454 PTNTVTAFNTEIPTTRNSIASAPTPAAGSSNAVAASSKVFEKTDWLPATIITESVQQHLP 1513

Query: 1514 NAASTTGGVSTTLLPAAIHPQSLVEGSDGYDLISIGFLKGLNYVFVTSFALSSAQIFTFL 1573
            NAASTTGGVSTTLLPAAIHPQSLVEGSDGYDLISIGFLKGLNYVFVTSFALSSAQIFTFL
Sbjct: 1514 NAASTTGGVSTTLLPAAIHPQSLVEGSDGYDLISIGFLKGLNYVFVTSFALSSAQIFTFL 1573

Query: 1574 PPVLTYPFESHTEETVKIHDPTEKRQLERPPPVSFYSRASRDTTTLSSFTHSQVIAVQKE 1633
            PPVLTYPFESHTEETVKIHDPTEKRQLERPPPVSFYSRASRDTTTLSSFTHSQVIAVQKE
Sbjct: 1574 PPVLTYPFESHTEETVKIHDPTEKRQLERPPPVSFYSRASRDTTTLSSFTHSQVIAVQKE 1633

Query: 1634 TSDVPDLSFVKVKQLAPDVSEERGYIATLAHVYFPSKLVPKLQELILDSESPLYNNPDVN 1693
            TSDVPDLSFVKVKQLAPDVSEERGYIATLAHVYFPSKLVPKLQELILDSESPLYNNPDVN
Sbjct: 1634 TSDVPDLSFVKVKQLAPDVSEERGYIATLAHVYFPSKLVPKLQELILDSESPLYNNPDVN 1693

Query: 1694 LKIFASLIDPTIKVRIIQHDRSNPRPAQGGGTSGSDGYSPSGYANHGDGSLDNSKSPKIT 1753
            LKIFASLIDPTIKVRIIQHDRSNPRPAQGGGTSGSDGYSPSGYANHGDGSLDNSKSPKIT
Sbjct: 1694 LKIFASLIDPTIKVRIIQHDRSNPRPAQGGGTSGSDGYSPSGYANHGDGSLDNSKSPKIT 1753

Query: 1754 FKITKRLLIFLTVLTFGXXXXXXXXXXXXXXXXXINKVKSKIVLGEKKIPPSLGLFYSHQ 1813
            FKITKRLLIFLTVLTFG                 INKVKSKIVLGEKKIPPSLGLFYSHQ
Sbjct: 1754 FKITKRLLIFLTVLTFGVFLWRLVFLYLFRRLYRINKVKSKIVLGEKKIPPSLGLFYSHQ 1813

Query: 1814 FNNRLSDLKPSALYEGDPEKQDGTATDGSSGSVHGYATDDDIIVTGENTVYSLSQGIAYH 1873
            FNNRLSDLKPSALYEGDPEKQDGTATDGSSGSVHGYATDDDIIVTGENTVYSLSQGIAYH
Sbjct: 1814 FNNRLSDLKPSALYEGDPEKQDGTATDGSSGSVHGYATDDDIIVTGENTVYSLSQGIAYH 1873

Query: 1874 IDEEGNYYYAGIDPFTDAFEQEADCLYHESEVESVNVNNLDHLSSDIKEENIDLDGNIEL 1933
            IDEEGNYYYAGIDPFTDAFEQEADCLYHESEVESVNVNNLDHLSSDIKEENIDLDGNIEL
Sbjct: 1874 IDEEGNYYYAGIDPFTDAFEQEADCLYHESEVESVNVNNLDHLSSDIKEENIDLDGNIEL 1933

Query: 1934 YDSDFDHTSLDQVPKATETIEKYNNNQYYKMNTLITDSSNCQGNTVALSSDYGTTSVHVE 1993
            YDSDFDHTSLDQVPKATETIEKYNNNQYYKMNTLITDSSNCQGNTVALSSDYGTTSVHVE
Sbjct: 1934 YDSDFDHTSLDQVPKATETIEKYNNNQYYKMNTLITDSSNCQGNTVALSSDYGTTSVHVE 1993

Query: 1994 NVSNENSLGFIRLQGDIPXXXXXXXXXXXXXXXXNDSSAAAQLTQVSNLASQGIHLAASV 2053
            NVSNENSLGFIRLQGDIP                NDSSAAAQLTQVSNLASQGIHLAASV
Sbjct: 1994 NVSNENSLGFIRLQGDIPENYDDYLYEGDEDDFDNDSSAAAQLTQVSNLASQGIHLAASV 2053

Query: 2054 QEPEYEXXXXXXXXXXXXXXXXXXXXXXELDEEMYRHLSMINAFDSRFGGFNNMAAQDSS 2113
            QEPEYE                      ELDEEMYRHLSMINAFDSRFGGFNNMAAQDSS
Sbjct: 2054 QEPEYEDFDFARSEDDDDVSDVMLGDFDELDEEMYRHLSMINAFDSRFGGFNNMAAQDSS 2113

Query: 2114 VYQRTFQPGNTTLSKGSSSNYNGTYPHVMMQYNTMNTSTTDSGCTFPSGALPGXXXXXXX 2173
            VYQRTFQPGNTTLSKGSSSNYNGTYPHVMMQYNTMNTSTTDSGCTFPSGALPG       
Sbjct: 2114 VYQRTFQPGNTTLSKGSSSNYNGTYPHVMMQYNTMNTSTTDSGCTFPSGALPGTTTYFTN 2173

Query: 2174 XXXXVGSSSHASGXXXXXXXXXXXXXSLFNFDEYSVTVQETATAVAERNTMLRSNSKTDL 2233
                VGSSSHASG             SLFNFDEYSVTVQETATAVAERNTMLRSNSKTDL
Sbjct: 2174 TFNTVGSSSHASGRTPAPPMRPQRPPSLFNFDEYSVTVQETATAVAERNTMLRSNSKTDL 2233

Query: 2234 SAVASASNRLSSTLWDLEKAAPEYLAPSTGGXXXXXXXXXXXXXXXXXXXXXXXXXXXXI 2293
            SAVASASNRLSSTLWDLEKAAPEYLAPSTGG                            I
Sbjct: 2234 SAVASASNRLSSTLWDLEKAAPEYLAPSTGGSASKGSSDRRLSSRSPSSHKHHRHSWKHI 2293

Query: 2294 VTGVRSSKSLSKMHQKQSSRKDKISKLRISGPIHTEHSLGWSPSQ 2338
            VTGVRSSKSLSKMHQKQSSRKDKISKLRISGPIHTEHSLGWSPSQ
Sbjct: 2294 VTGVRSSKSLSKMHQKQSSRKDKISKLRISGPIHTEHSLGWSPSQ 2338

 Score =  614 bits (1583), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/477 (71%), Positives = 339/477 (71%)

Query: 1   MAGTTKMKXXXXXXXXXXXXXXXEGANRRHGAASDXXXXXXXXXXXXXXTADGAAPLVVD 60
           MAGTTKMK               EGANRRHGAASD              TADGAAPLVVD
Sbjct: 1   MAGTTKMKAILLLSLLWALTDAAEGANRRHGAASDEREVRRRYVRAAGGTADGAAPLVVD 60

Query: 61  VRXXXXXXXXXXXXXHECCSVPALRGRTVKRQLAGPVNGSRPEPLVSGTPSSHVIQGLET 120
           VR             HECCSVPALRGRTVKRQLAGPVNGSRPEPLVSGTPSSHVIQGLET
Sbjct: 61  VRQAGPAAQALGAALHECCSVPALRGRTVKRQLAGPVNGSRPEPLVSGTPSSHVIQGLET 120

Query: 121 LSTEQTLAPEPPATFSASSDPIGLTSTGLPPSTSVADGVGQIVTSTVSSFSGTPDGSFEA 180
           LSTEQTLAPEPPATFSASSDPIGLTSTGLPPSTSVADGVGQIVTSTVSSFSGTPDGSFEA
Sbjct: 121 LSTEQTLAPEPPATFSASSDPIGLTSTGLPPSTSVADGVGQIVTSTVSSFSGTPDGSFEA 180

Query: 181 SSNLLSVAQSNTQIIPSTNLHKTGSSTHADALRSTTATATEADIRSTTSLDSVYMNGDST 240
           SSNLLSVAQSNTQIIPSTNLHKTGSSTHADALRSTTATATEADIRSTTSLDSVYMNGDST
Sbjct: 181 SSNLLSVAQSNTQIIPSTNLHKTGSSTHADALRSTTATATEADIRSTTSLDSVYMNGDST 240

Query: 241 ETGSTGRNSAFQPANIASLSHKTGPEQQDXXXXXXXXXXXXXXXHEQFGTALSSDKXXXX 300
           ETGSTGRNSAFQPANIASLSHKTGPEQQD               HEQFGTALSSDK    
Sbjct: 241 ETGSTGRNSAFQPANIASLSHKTGPEQQDTAGSAAASGFTTSISHEQFGTALSSDKTGLS 300

Query: 301 XXXXXXXXEKFTLTAKTFTDKSTSSVYSSWQPSITSELSLESFHAXXXXXXXXXXXXXXA 360
                   EKFTLTAKTFTDKSTSSVYSSWQPSITSELSLESFHA              A
Sbjct: 301 GSVSLSTSEKFTLTAKTFTDKSTSSVYSSWQPSITSELSLESFHASTTTEVTSVSTSTEA 360

Query: 361 LTKKSSSFEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIEATATGNS 420
           LTKKSSSFE                                          IEATATGNS
Sbjct: 361 LTKKSSSFEGRRSTSTPISISSPVSTRTSSGSSVDQKSHDSSDSQQPTTSTIEATATGNS 420

Query: 421 RSTLSGSTVESFKSKTSEPSSVTENTSTFRTGSSSNRSELPXXXXXXXXXXXXXEQH 477
           RSTLSGSTVESFKSKTSEPSSVTENTSTFRTGSSSNRSELP             EQH
Sbjct: 421 RSTLSGSTVESFKSKTSEPSSVTENTSTFRTGSSSNRSELPSTIDASTITSSTSEQH 477

 Score =  292 bits (747), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 186/344 (54%), Positives = 186/344 (54%)

Query: 612 NSESITKTSTSRAEQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAVEKPXXXXXXXXX 671
           NSESITKTSTSRAEQP                              AVEKP         
Sbjct: 612 NSESITKTSTSRAEQPTTTTTEGNKSTTTDGRSTTTTSETTSEATTAVEKPTSTTTDGTT 671

Query: 672 XIKSEDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHXXXXXXXXXXXXXXXX 731
            IKSEDK                                    H                
Sbjct: 672 TIKSEDKTSTTNTETRAMTTTTAEDKSKTTTTEAKPTTTSAAEHTSDTTTRMDTQRTSTT 731

Query: 732 XXXXXXXXXXXXXXXXISAENISTINTVDNKSTTTAAENKSTATTMDNNXXXXXXXXXXT 791
                           ISAENISTINTVDNKSTTTAAENKSTATTMDNN          T
Sbjct: 732 GDTSVTTTSEVKPTTTISAENISTINTVDNKSTTTAAENKSTATTMDNNSSSSGVESIST 791

Query: 792 KKTSENVPATSTAAETTSQVTPTQADSSTISNTHTGPTNSGQEAXXXXXXXXXXXXXXXX 851
           KKTSENVPATSTAAETTSQVTPTQADSSTISNTHTGPTNSGQEA                
Sbjct: 792 KKTSENVPATSTAAETTSQVTPTQADSSTISNTHTGPTNSGQEATITTRTETGSTTMSAS 851

Query: 852 XXXXXXXXXXXXQDPKDILLGVSSIFXXXXXXXXXXXXLDNIVFTTVTSSLKTAPNTIKT 911
                       QDPKDILLGVSSIF            LDNIVFTTVTSSLKTAPNTIKT
Sbjct: 852 TSASGSITSTGSQDPKDILLGVSSIFGSGKSTTTKGGSLDNIVFTTVTSSLKTAPNTIKT 911

Query: 912 ATQAPSSFTSNSAANPSTGVSNTPSTDERTGSTAASISSALTHD 955
           ATQAPSSFTSNSAANPSTGVSNTPSTDERTGSTAASISSALTHD
Sbjct: 912 ATQAPSSFTSNSAANPSTGVSNTPSTDERTGSTAASISSALTHD 955

>Ecym_4060 Chr4 (125127..131732) [6606 bp, 2201 aa] {ON} similar to
            Ashbya gossypii ADR200C
          Length = 2201

 Score =  395 bits (1016), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 238/550 (43%), Positives = 322/550 (58%), Gaps = 24/550 (4%)

Query: 1476 PTPXXXXXXXXXXXXKVFEKTDWLPATIITESVQQHLPNAASTTGGVSTTLLPAAIHPQS 1535
            P+P             + EKT WLP TI+T S+Q   P  ++T G  +T  LP AI P +
Sbjct: 1305 PSPSFIAPKSNPSSTSIDEKTGWLPTTIVTASMQTS-PKESTTVGSAATYTLPRAITPAT 1363

Query: 1536 LVEGSDGYDLISIGFLKGLNYVFVTSFALSSAQIFTFLPPVLTYPFESHTEETVKIH-DP 1594
             V   D YDLI+IGF++GLNY F+ S  ++SAQIF+FLP +L YP+  + E  +  H + 
Sbjct: 1364 PVAKPDNYDLITIGFVQGLNYAFLVSNPVASAQIFSFLPHLLNYPYIENKEALLLRHINE 1423

Query: 1595 TEKRQLERPPPVS-----FYSRAS---RDTTTLSSFTHSQVIAVQKETSDVPDLSFVKVK 1646
            +    L     VS      Y   S   + T +       Q    +++TSD    S + VK
Sbjct: 1424 SNNNILGNRGSVSGSYFNIYGNLSLEHKHTNSTEPVKRRQ--NNEEDTSDEHGYSQIVVK 1481

Query: 1647 QLAPDVSEERGYIATLAHVYFPSKLVPKLQELILDSESPLYNNPDVNLKIFASLIDPTIK 1706
            Q+ P + +   Y A++A VYFPS+ V  L++++ D  S LY NP   L   ASL+DP I 
Sbjct: 1482 QIVPFLLQGADYTASVAEVYFPSEAVTSLRKMVADKNSKLYLNPVATLNQLASLVDPRIP 1541

Query: 1707 VRIIQHDR----SNPRPAQGGGTSGSDGYSPSGYANHGDGSLDNSKSPKITFKITKRLLI 1762
            V  I        SN  P   G TSGS   +    ++H  G+LD      ++    KR+LI
Sbjct: 1542 VLTITSGSSPSFSNTDPDHSGDTSGSSNNN---SSDHKGGTLDLGAHRHMSPATRKRILI 1598

Query: 1763 FLTVLTFGXXXXXXXXXXXXXXXXXINKVKSKIVLGEKKIPPSLGLFYSHQFNNRLSDLK 1822
            F    +FG                 ++K++SKIVL EK IP +LG+ Y+HQFN+RLSDLK
Sbjct: 1599 FSLAFSFGVLLWILIFLFLLKRLYKVSKIRSKIVLREKSIPNNLGISYNHQFNDRLSDLK 1658

Query: 1823 PSALYEGDPEKQDGTATDGSSG---SVHGYATDDDIIVTGENTVYSLSQGIAYHIDEEGN 1879
              A Y+GDPE+   + +  SS    SV    TDDD+IVTGENTVYSLSQGI YHIDEEGN
Sbjct: 1659 TDAFYDGDPERNFNSQSTNSSSNHDSVPDSFTDDDMIVTGENTVYSLSQGITYHIDEEGN 1718

Query: 1880 YYYAGIDPFTDAFEQEADCLYHESEVESVNVNNLDHLSSDIKEENIDLDGNIELYDSDFD 1939
            YYYA I+PF+++FE EAD +Y ES  E++N+N   ++SS I  E+ID +GNIE+ + +F 
Sbjct: 1719 YYYARINPFSNSFEPEADIMYQESGGETININEAQYMSSGIDLEDIDQEGNIEISELEFH 1778

Query: 1940 HTS-LDQVPKATETIEKYNNNQYYKMNTLITDSSNCQGNTVALSSDYGTTSVHVENVSNE 1998
            H   L  + K    IE YN NQYY M+T++T+SSN Q NTV LSS+ G  SV+VE++SNE
Sbjct: 1779 HPELLSHLQKDDGIIEHYNKNQYYNMSTIVTESSNPQCNTVGLSSEPG-MSVNVEDLSNE 1837

Query: 1999 NSLGFIRLQG 2008
            NS+GFIRL G
Sbjct: 1838 NSVGFIRLHG 1847

 Score = 81.3 bits (199), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 86/264 (32%), Positives = 113/264 (42%), Gaps = 23/264 (8%)

Query: 2083 LDEEMYRHLSMINAFDSRFGGFNNMAAQDSSVY-QRTFQPGNTTLSKGSSSNYNGTYPHV 2141
            LDEEMYRHLS+IN  +  +   +N+A+     Y  R+     T+ SK SS NYN T    
Sbjct: 1945 LDEEMYRHLSVIN--NRYYSSSSNVASFHEGYYGYRSNAAVGTSTSKSSSVNYNPTGSKF 2002

Query: 2142 MMQYNTMNTSTTDSGCTFPSGAL--PGXXXXXXXXXXXVG-SSSHASGXXXXXXXXXXXX 2198
            M Q++T NTST +SG T  SG L  P               SS H S             
Sbjct: 2003 MAQHHTYNTSTINSGYTSRSGYLQVPTTVSNNYPTPNNTEFSSGHNSALLSSLLSKTQRP 2062

Query: 2199 XSLFNFDEYSVTVQET--ATAVAERNTMLRSNSKTDLSAVASASNRLSSTL-WDLEKAAP 2255
             S F+F+     +  +   + V     ++   SKT+ S V S  NR+SST+ WD E  AP
Sbjct: 2063 ASAFDFENCPNILGSSPQVSNVGAHKGVMHRRSKTEGS-VISVPNRMSSTMHWDFENTAP 2121

Query: 2256 -----EYLAPSTGGXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVTGVRSSKSLSKMHQKQ 2310
                   L    G                             +V GVR  + L    +K 
Sbjct: 2122 GSTTSHALRTEAG----VLRKNSSAHEVDPSLHATKPHGWKHLVPGVRHRQELETRRKK- 2176

Query: 2311 SSRKDKISKLRISGPIHTEHSLGW 2334
                +KISK +ISGPIHT +SLGW
Sbjct: 2177 ---DEKISKSQISGPIHTANSLGW 2197

>SAKL0G04862g Chr7 (392107..399441) [7335 bp, 2444 aa] {ON} some
            similarities with uniprot|P41809 Saccharomyces cerevisiae
            YDR420W HKR1 Serine/threonine rich cell surface protein
            that contains an EF hand motif involved in the regulation
            of cell wall beta-1 3 glucan synthesis and bud site
            selection overexpression confers resistance to Hansenula
            mrakii killer toxin HM-1
          Length = 2444

 Score =  241 bits (616), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 186/588 (31%), Positives = 282/588 (47%), Gaps = 91/588 (15%)

Query: 1497 DWLPATIITESVQQHLPNAASTTGGVSTTLLPAAIHPQSLVEGSDGYDLISIGFLKGLNY 1556
            +WLP ++I ES      ++ +   G ++TL P AI P + V    G+ LI+IGF + LNY
Sbjct: 1473 NWLPYSLIVESKDTSTQSSTTVDLGATSTL-PQAITPPTAVPQPAGHSLITIGFKEALNY 1531

Query: 1557 VFVTSFALSSAQIFTFLPPVLTYPFES-------HTEETVKIHDPTEKRQLERPPPVSFY 1609
             F+ S  LSSAQIF+FLP VL YPF S       +  + +++    ++R       +   
Sbjct: 1532 PFLISHPLSSAQIFSFLPRVLQYPFSSTAGSVPIYRRQDIEVMTLLQRRLTSSAAEIDTC 1591

Query: 1610 S-----------------------RASRDTTTLSSFTHSQVIAVQKETSDVPDLSF--VK 1644
            S                       R  ++  +L   + +  ++V   TSD  ++ +  + 
Sbjct: 1592 SLSFQNYDKIQLVSVKLALLKSTNRTDQENNSLHRRSVNDKVSVMNSTSDSSNIDYSQIV 1651

Query: 1645 VKQLAPDVSEERGYIATLAHVYFPSKLVPKLQELILDSESPLYNNPDVNLKIFASLIDPT 1704
            VKQ+ P VS    YI ++A VYFP   +  LQ L+ +  S LY NP+ +LK  ASLIDP+
Sbjct: 1652 VKQIIPLVSSSINYIVSVAEVYFPDHSIDTLQRLVRNQNSELYKNPENSLKALASLIDPS 1711

Query: 1705 IKVRIIQHDRSN-------------PRPAQGGGTSGSDGYSPSGYANHGD----GSLDNS 1747
            + +  +     N                + G     S G   S    +GD    GSLD+ 
Sbjct: 1712 VPLTGLVDSDGNSVTNEEGGNSGSSGSNSSGDSDPSSGGSGESQGGANGDGSALGSLDDG 1771

Query: 1748 KSPKITFKITKRLLIFLTVLTFGXXXXXXXXXXXXXXXXXINKVKSKIVLGEKKIPPSLG 1807
               K++  ITKRL+I+L V +F                  I  +  ++   +K    S G
Sbjct: 1772 AYGKMSLAITKRLIIYLLVFSFVTILWIVAWLYFLKRLYGIEVIGKRLKPNDKTWSSSPG 1831

Query: 1808 LFYSHQFNNRLSDLKPSALYEGDPEKQDGTATDGSSGSVHGYATD-------DDIIVTGE 1860
             FY+H +N+  SD   +  Y  DPE+             + Y T+       DD++VTG+
Sbjct: 1832 AFYNHHYNSHYSDPN-NPFY--DPERSLREKCSFDERYDYDYDTEEQDGYLYDDLVVTGD 1888

Query: 1861 NTVYSLSQGIAYHIDEEGNYYYAGIDPFTDAFEQEADCLYHESEVESVNVNNLDHL---- 1916
            NTVYS S+G++Y IDE GNYYYAG+D   +  EQ  + + H        + +++H+    
Sbjct: 1889 NTVYSTSRGLSYFIDENGNYYYAGMDFIVNENEQANEFVDHN------QLQSMEHIYEGH 1942

Query: 1917 -------------SSDIKEENIDLDGNIELYDSDFD--HTSLDQVPKATETIEKYNNNQY 1961
                         + DI   ++D +GNIEL DSDF+   T  D     T+T+E YNNNQY
Sbjct: 1943 DSIAGGALIDEEGAFDINAVDVDEEGNIELPDSDFNVPTTVTDVEGGKTDTVESYNNNQY 2002

Query: 1962 YKMNTLITDSSNCQ--GNTVALSSDYGTTSVHVENVSNENSLGFIRLQ 2007
            YKMNTLIT  S+ Q  GN++++S       + + + SNE S G I+L+
Sbjct: 2003 YKMNTLITTESSEQQVGNSLSVSG----AGLALVSSSNEGSNGIIQLK 2046

 Score = 39.3 bits (90), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 13/56 (23%)

Query: 2293 IVTGVRSSKSLSKMHQKQSS-------------RKDKISKLRISGPIHTEHSLGWS 2335
            I   VR S  LS  H ++ S              ++++ K+RISGPI +E+SLGWS
Sbjct: 2386 ITESVRHSVVLSTSHSRRGSLSKVIPATGPRGHTREELKKIRISGPIFSENSLGWS 2441

>TDEL0A03880 Chr1 (690387..695477) [5091 bp, 1696 aa] {ON} Anc_5.524
            YDR420W
          Length = 1696

 Score =  179 bits (453), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 146/493 (29%), Positives = 230/493 (46%), Gaps = 52/493 (10%)

Query: 1498 WLPATIITESVQQHLPNAASTTGGVSTTLLPAAIHPQSLVEGSDGYDLISIGFLKGLNYV 1557
            WLP++I  +S      +  S+     T  LP  I P + V   +    I++GF K LNY 
Sbjct: 1069 WLPSSIQVQSDPTR--SGTSSFDPAVTATLPQLIAPPTAVPVPENASKITVGFKKNLNYE 1126

Query: 1558 FVTSFALSSAQIFTFLPPVLTYPFESHTEETVKIHDPTEKRQLERPPPVSFYSRASRDTT 1617
            F+ S + ++AQIF FLP VL++PFE          + T+    +R   +   S    +TT
Sbjct: 1127 FLVSSSTTAAQIFHFLPFVLSFPFE---------ENGTKDFSYKRRGTLLVSSFEFNNTT 1177

Query: 1618 TL--SSFTHSQVIAVQKET-SDVP-DLSFVKVKQLAPDVSEERGYIATLAHVYFPSKLVP 1673
            TL  + F    V  + K + S+ P + S V V Q+ P + ++R Y+ ++A +YFPS  V 
Sbjct: 1178 TLMPAQFHQETVTGISKRSDSEFPFNASAVDVIQIMPMIIKDRNYLTSIAVLYFPSAYVS 1237

Query: 1674 KLQELILDSESPLYNNPDVNLKIFASLIDPTIKVRIIQHDRSNPRPAQGGGTSGSDGYSP 1733
            +LQ ++ D  S L+NNPD  L   A+LIDP+I +  +    +    +  GG   +  +SP
Sbjct: 1238 ELQSMVSDDTSQLFNNPDPTLDALAALIDPSIPLTGLIDGSTG---SLNGGNPSTQSHSP 1294

Query: 1734 SG-----YANHGDGSLDNSKSPKITFKITKRLLIFLTVLTFGXXXXXXXXXXXXXXXXXI 1788
            S       ++   GSL  + +  ++  + KRL+I+LT L FG                  
Sbjct: 1295 SSPYKSQSSDDNSGSLGTATNSGLSSAVKKRLVIYLTCLVFG------TLLWILVFMFLY 1348

Query: 1789 NKVKSKIVLGEKKIPPSLGLFYSHQFNNRLSDLKPSALYEGDP--EKQDGT--ATDGSSG 1844
              +    V+ ++             +N   +D+      E +P  +K D      D +S 
Sbjct: 1349 KHLYGGRVIAKRAYQRDAAQEEKQHYN--FADITSVHSAETEPANDKSDDVPQEKDVASA 1406

Query: 1845 SVHGYATDDDIIVTGENTVYSLSQGIAYHIDEEGNYYYAGIDPFTDAFEQEA-------- 1896
            S   Y+  +D+++TGENTVYS+SQG+ Y + E+G++YYAG  P     E+          
Sbjct: 1407 SQSRYSLPEDLMITGENTVYSVSQGLQYFVAEDGSFYYAG--PLQSTSEENETTKGDSAD 1464

Query: 1897 -----DCLYHESEVESVNVNNLDHLSSDIKEENIDLDGNIELYDSDFDHTSLDQVPKATE 1951
                 D LY   +  S+  N  +  S DI    ID +GN  + D   +    +     + 
Sbjct: 1465 IEDINDYLYSADQERSIVTN--EQSSCDIGSLQIDEEGNFVVSDPSPNEEEHEITSSNSA 1522

Query: 1952 TIEKYNNNQYYKM 1964
            TIE YNNN  YKM
Sbjct: 1523 TIELYNNNNLYKM 1535

>Suva_2.597 Chr2
            (1058501..1059391,1059470..1059725,1059765..1059812,
            1059849..1059854,1059891..1061045,1061361..1064398) [5394
            bp, 1797 aa] {ON} YDR420W (REAL)
          Length = 1797

 Score =  177 bits (449), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 165/532 (31%), Positives = 231/532 (43%), Gaps = 117/532 (21%)

Query: 1498 WLPATIITESVQQHLPNAASTTGGVSTTL-LPAAIHPQSLVEGSDGYDLISIGFLKGLNY 1556
            WLP  II E  +    + ++T+   S T  LP  I P   V     + LI+IGF  GLNY
Sbjct: 1205 WLPTAIIVEPTKS---DTSTTSFNPSITASLPNVIAPAIAVTEPANHTLITIGFTAGLNY 1261

Query: 1557 VFVTSFALSSAQIFTFLPPVLTYPFESHTEETVKIHDPTEKRQLERPPPVSFYSRASRDT 1616
            VF+    LSSAQIF FLP VL YPF   T +     + +   ++     V  Y   S  T
Sbjct: 1262 VFLVQNPLSSAQIFNFLPLVLKYPFSDTTSQ----QEESSTYEMGSSSFVLSYQSGSS-T 1316

Query: 1617 TTLSSFTHSQVIAVQKETS-------------DVPDL--SFVKVKQLAPDVSEERGYIAT 1661
            TTLS  + S +  V+K+               D+P +  S + VKQ+ P +   R Y+  
Sbjct: 1317 TTLSPESVSSIPIVRKKKKKGGKNSVMSTANLDLPSIGNSSIVVKQIVPMIDSSRSYVIA 1376

Query: 1662 LAHVYFPSKLVPKLQELILDSESPLYNNPDVNLKIFASLIDPTIKVRIIQHDRSNPRPAQ 1721
            +A VYFP++ +  LQELILD+ S LYNNP  +L+  A LID ++ +  +    SN     
Sbjct: 1377 VAEVYFPTEAISSLQELILDTNSTLYNNPQTSLQTLAGLIDSSVPLGGLTLYGSN----- 1431

Query: 1722 GGGTSGSDGY-----------SPSGYANHGDGSLD---NSKSPKITFKITKRLLIFLTVL 1767
              G S  D             S      +  G+LD   NS +  + ++ITKR +I+LT L
Sbjct: 1432 -NGCSICDSSSSSVSEVSNTNSTKNGGTNKYGALDDFTNSLTDHMPWRITKRFIIYLTCL 1490

Query: 1768 TFGXXXXXXXXXXXXXXXXXINKVKSKIVLGEKKIPPSLGLFYSHQFNNRLSDLKPSALY 1827
            T G                        ++LG                       +PS   
Sbjct: 1491 TAGVLLWLLLALFAFR--------HRNVLLGR----------------------RPSNCI 1520

Query: 1828 EGDPEKQD-----GTATDGSSGSVHGY--------------ATDDDIIVTGENTVYSLSQ 1868
            E  P  +      G +T  SS   H Y                DD  I TGENTVYS + 
Sbjct: 1521 EKTPNNERGLEGVGVSTSRSSSDNHNYNEKKPNTESESFYSMEDDQYIPTGENTVYSATH 1580

Query: 1869 GIAYHIDEEGNYYYA-----GIDPFTDAFEQEAD-----CLY--HESEVESVNVNNLDHL 1916
            G+ Y +DE+G+ +Y       ID   +  +   D     C+Y  H+   E V +N+ + +
Sbjct: 1581 GLHYTVDEDGDLFYRKSMPNDIDEINENEDSGIDSILRECVYDRHQDTTE-VYLNDEESM 1639

Query: 1917 SSDIKEENIDLDGNIELYDSDFDHTSLDQVPKA----TETIEKYNNNQYYKM 1964
            SS +   ++D +GNI LYDS     S D  P       E IE YNN+  YKM
Sbjct: 1640 SSIL---DVDENGNIRLYDS----YSEDDEPNCPHLQEEVIEDYNNSHVYKM 1684

>Smik_4.695 Chr4 (1227757..1232424) [4668 bp, 1555 aa] {ON} YDR420W
            (REAL)
          Length = 1555

 Score =  176 bits (445), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 170/552 (30%), Positives = 232/552 (42%), Gaps = 141/552 (25%)

Query: 1498 WLPATIITESVQQHLPNAASTTGGVSTTL--------LPAAIHPQSLVEGSDGYDLISIG 1549
            WLP  II +S +             STTL        LP  I P         + LI++G
Sbjct: 968  WLPTAIIVQSSET----------DTSTTLFNPTITGSLPNLIEPAVTASEPINHTLITVG 1017

Query: 1550 FLKGLNYVFVTSFALSSAQIFTFLPPVLTYPFESHTEETVKIHDPTEKRQLERPPPVSFY 1609
            F   LNYVF+    LSSAQIF FLP VL YPF S T   V      E    E    +  Y
Sbjct: 1018 FTAALNYVFLVQNPLSSAQIFNFLPLVLKYPF-SDTSSGV------ESSNGELSSFILSY 1070

Query: 1610 SRASRDTTTLSSFTHSQVIAVQKET--------SDVPDLSF-------VKVKQLAPDVSE 1654
             R+   TTTLS  + S +  V+K+         +   DL F       + VKQ+ P +  
Sbjct: 1071 -RSGTSTTTLSPQSKSSLSIVRKKKKGDKEKPPTSTMDLYFPSINASSIAVKQIVPMMDS 1129

Query: 1655 ERGYIATLAHVYFPSKLVPKLQELILDSESPLYNNPDVNLKIFASLIDPTIKVRIIQHDR 1714
             + YI  +A VYFP++ V  LQELILD  S LYNNP   L+  A LID +I         
Sbjct: 1130 SKAYIIAVAEVYFPTEAVSYLQELILDVNSTLYNNPQSPLRTLAGLIDNSI--------- 1180

Query: 1715 SNPRPAQGGGTSGSDGYS----PSGYANHGDGSLDNSKSPKITFK--------------- 1755
              P  +    +SG++G+     PSG     D S +NSK    T+K               
Sbjct: 1181 --PLGSLTLYSSGNEGHVSSLFPSGVL---DSSKENSKGIVATYKYGALDDFTNSFTDSA 1235

Query: 1756 ----ITKRLLIFLTVLTFGXXXXXXXXXXXXXXXXXINKVKSKIVLGEKKIPPSLGLFYS 1811
                   R ++FL +LT G                                   L  F+ 
Sbjct: 1236 PGWSYAARTIVFLAILTIGALLWL------------------------------LFAFFV 1265

Query: 1812 HQFNNRLSDLKPSALYE---GDPEKQDGTATDGSSG---------------SVHGYATDD 1853
              + N L    P    E   G+  K D TA   SS                SVH   TDD
Sbjct: 1266 FHYRNILLKRYPKDCIEKSLGNERKFDSTALSRSSSGNQIFNEKPSGSENESVHS-VTDD 1324

Query: 1854 DIIVTGENTVYSLSQGIAYHIDEEGNYYY--AGIDPFTDAFEQE--------ADCLYHE- 1902
              I+TGENTVYS + G+ Y I+++G+ +Y  A ++   +  E+E         DC+Y E 
Sbjct: 1325 HYIITGENTVYSTTHGLHYTINDDGDLFYKEATLNDLEETAEREDSGIDSILRDCVYDEH 1384

Query: 1903 SEVESVNVNNLDHLSSDIKEENIDLDGNIELYDSDFDHTSLDQVPKATETIEKYNNNQYY 1962
             E     +N+ + +SS +   ++D +GNI LYDS  D    +      E IE+YNNN  Y
Sbjct: 1385 QESTEAYLNDEESISSIV---DVDENGNIRLYDSYSDDEEPNSFYLPNEVIEEYNNNNVY 1441

Query: 1963 KMNTLITDSSNC 1974
            K+     ++ +C
Sbjct: 1442 KIKHNTPETGSC 1453

>KLLA0A01826g Chr1 complement(163010..167404) [4395 bp, 1464 aa] {ON}
            some similarities with uniprot|P41809 Saccharomyces
            cerevisiae YDR420W HKR1 Serine/threonine rich cell
            surface protein that contains an EF hand motif involved
            in the regulation of cell wall beta-1 3 glucan synthesis
            and bud site selection overexpression confers resistance
            to Hansenula mrakii killer toxin HM-1
          Length = 1464

 Score =  175 bits (443), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 166/565 (29%), Positives = 244/565 (43%), Gaps = 101/565 (17%)

Query: 1497 DWLPATIITESVQQHLPNAASTTGGVSTTLLPAAIHPQSLVEGSDGYDLISIGFLKGLNY 1556
            +WLP T++ E    H  +AA++    +T+ LP AI+P S V   DGY +I++GF + LNY
Sbjct: 721  NWLPTTLVIEPTAAHATSAATSADLGATSTLPQAINPASDVPLPDGYTVITVGFKEPLNY 780

Query: 1557 VFVTSFALSSAQIFTFLPPVLTYPFESHTEETVKIHDPTEKRQLERPPPVSFYSRASRDT 1616
             F+ +  L+SAQIF FLP VL  PF                 QL        Y R+    
Sbjct: 781  PFLIANPLASAQIFNFLPKVLVRPF-----------------QLTTTGAAPVYRRSWN-- 821

Query: 1617 TTLSSFTHSQVIAVQKETSDVPDLSFVKVKQLAPDVSEERGYIATLAHVYFPSKLVPKLQ 1676
                     + I     +S +P    V+VK + P V +   YI ++A VYFP++ V  LQ
Sbjct: 822  ------IFKKGINTHLLSSSLPTYDDVQVKSIVPLVIQNVSYIVSIAEVYFPTESVHTLQ 875

Query: 1677 ELILDSESPLYNNPDVNLKIFASLIDPTIKVRII-------------------------- 1710
            EL+LDS S LY+NP   L   ASLI+P I +  +                          
Sbjct: 876  ELVLDSSSILYSNPVSYLADLASLINPAIPLTGLTYSGSSGSSSGNGSGGDSDGNGNGSG 935

Query: 1711 --------QHDRSNPRPAQGGGTSGSDGYSPSGYANHGDGSLDNSKSPKITFKITKRLLI 1762
                    + D S+   A  G     D    SG+ NH                   R + 
Sbjct: 936  EGTGGNGAEKDNSSNNAALWGSL---DAGLTSGFPNH---------------DTVIRFVC 977

Query: 1763 FLTVLTFGXXXXXXXXXXXXXXXXXINKVKSKIVLGEKKIPPSLGLFYSHQFNNRLSDLK 1822
             +TVLT                         ++ L EK   P +  FYSH  N       
Sbjct: 978  MVTVLTAFILCLVGLILVFLKNLYKRTNCAQRMHLTEKNW-PEIPTFYSHHMNGSTDSPM 1036

Query: 1823 PSALYEGDPEKQDGTATDGSSGSVHGYATDDDIIVTGENTVYSLSQGIAYHIDEEGNYYY 1882
             +  Y G  +  D   T+  S S      DDD+I+TGENTVYS+SQGI Y++DE+GN+++
Sbjct: 1037 RNMFYSGS-QFSDSDTTEEDSHSAE--YIDDDLIITGENTVYSISQGITYYVDEDGNFFF 1093

Query: 1883 AGIDPFTDAFEQEA-DCLYHESEVESVNVNNL--------DHLSS-----DIKEENIDLD 1928
            AG+       E E  + + H+ + E+V V  +        D L+      D+ E  +D D
Sbjct: 1094 AGVGKDVHTSEPEKLEKIIHD-KTETVTVEPILPYYNEKDDDLTDETEPFDMGELEVDED 1152

Query: 1929 GNIELYDSDFDHTSLDQVPKATETIEKYN----NNQYYKMNTLITDSSNCQGNTVALSSD 1984
            GNI L +SD ++T L QV    E I   +    N+  Y  + +     +   N+  ++SD
Sbjct: 1153 GNIALPESDLENTIL-QVASDREEIRSRSPIGTNDGSYLQHQIPNIFPSVTSNSAHVNSD 1211

Query: 1985 YGTTSVHVENVSNENSLGFIRLQGD 2009
               T+V    +S+  S G + L G+
Sbjct: 1212 TMATAVTQTLLSSNGSGGILDLTGN 1236

>ZYRO0D12496g Chr4 (1047901..1055058) [7158 bp, 2385 aa] {ON} some
            similarities with uniprot|P41809 Saccharomyces cerevisiae
            YDR420W HKR1 Serine/threonine rich cell surface protein
            that contains an EF hand motif involved in the regulation
            of cell wall beta-1 3 glucan synthesis and bud site
            selection overexpression confers resistance to Hansenula
            mrakii killer toxin HM-1
          Length = 2385

 Score =  174 bits (442), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 159/538 (29%), Positives = 246/538 (45%), Gaps = 66/538 (12%)

Query: 1496 TDWLPATIITESVQQHLPNAASTTGGVSTTLLPAAIHPQSLVEGSDGYDLISIGFLKGLN 1555
            T+WLP +II +S      ++A +     T  LP AI PQ+ V        I+IGF + ++
Sbjct: 1646 TNWLPYSIIMQSTPSP--SSAPSFNPEVTATLPHAIAPQTPVSEPPNSSTITIGFKRQID 1703

Query: 1556 YVFVTSFALSSAQIFTFLPPVLTYPFESHTEETVKIHDPTEKRQLERPPPVSFYSRASRD 1615
            Y F+ +  LSSAQIFTFLP VL YPF          +D    + +++    +  S   R 
Sbjct: 1704 YDFLVNNPLSSAQIFTFLPDVLIYPFN---------YD----QNIDKGTHTNESSHYKRK 1750

Query: 1616 TTTLSSFTHSQVIAVQKETSDVPDLSFVKVKQLAPDVSEERGYIATLAHVYFPSKLVPKL 1675
            TTTL  +    V   +K    +   + V V Q+ P +S ++ Y+  +A +YFP++ V KL
Sbjct: 1751 TTTLQPYRDVMVRTNKKHKVQMISTANVSVIQIMPMLSRDKSYLVAVAELYFPAQYVNKL 1810

Query: 1676 QELILDSESPLYNNPDVNLKIFASLIDPTIKVRIIQHDRSNPRPAQGGGTSGSD----GY 1731
            ++ + +S S LYNN +  L   A LIDP+I +  +  D  +      G  S  +      
Sbjct: 1811 KDYMKNSNSMLYNNTNPTLFALADLIDPSIPLTGMVDDNGDVNNGGSGSGSSGEGNHASQ 1870

Query: 1732 SPSGY--ANHGDGSLDNSKS-PKITFKITKRLLIFLTVLTFGXXXXXXXXXXXXXXXXXI 1788
            SP  +   N  +G+L+ + S   IT  ITKRL IFL    FG                 +
Sbjct: 1871 SPHSFQNGNEDNGNLETANSTSHITGVITKRLAIFLNCFAFGVLLWILSFLFIFRKIRKV 1930

Query: 1789 NKVKSKIVLGE-------KKIPPSLG-----------LFYSHQFNNRLSDLKPSALYEGD 1830
               +      E        K+P   G            F+  +  N  S  + +      
Sbjct: 1931 QPPEEGESYAELDTSGDVLKLPSGSGEDNASGSSSGPQFFQEKATNNDSQNQETVDRNAT 1990

Query: 1831 PEKQDGTATDGSSGSVHGYATDDDIIVTGENTVYSLSQGIAYHIDEEGNYYYAGIDPFTD 1890
            P+ ++  + +G  G+       DD+IVTGENTVYS   G+ Y +DE+G ++YAG    +D
Sbjct: 1991 PKLEN--SNEGIGGNAQS-PISDDLIVTGENTVYSTLHGLEYFVDEDGQFHYAGNRQISD 2047

Query: 1891 AFEQEAD----------CLYHESEVESVNVNNLDHLSSDIKEENIDLDGNI-----ELYD 1935
                  D           +Y  SE  SV+V+    +  D+    +D +GN      E+YD
Sbjct: 2048 ESGTTKDEHDEIDDFDKYMYAGSEEMSVHVSEAPEV--DMSSLEVDEEGNFVLMNDEIYD 2105

Query: 1936 SDFDHTSLDQVPKATETIEKYNNNQYYKMNTLITDSSNCQGNT--VALSSDYGTTSVH 1991
            +  +++      K ++T+E YNNN  YKM    T SS+ +G T    LSSD G+  ++
Sbjct: 2106 NLQENSRSGSGNKNSDTVESYNNNHLYKM----TRSSDSEGVTKDAFLSSDEGSPEIY 2159

>YDR420W Chr4 (1306267..1311675) [5409 bp, 1802 aa] {ON}  HKR1Mucin
            family member that functions as an osmosensor in the
            Sho1p-mediated HOG pathway with Msb2p; proposed to be a
            negative regulator of filamentous growth; mutant displays
            defects in beta-1,3 glucan synthesis and bud site
            selection
          Length = 1802

 Score =  152 bits (383), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 158/519 (30%), Positives = 223/519 (42%), Gaps = 103/519 (19%)

Query: 1498 WLPATIITESVQQHLPNAASTTGGVSTTLLPAAIHPQSLVEGSDGYDLISIGFLKGLNYV 1557
            WLP  II ES +   P  AS    + T  LP AI P   V     + LI+IGF   LNYV
Sbjct: 1210 WLPTAIIVESSETG-PTTASFNPSI-TGSLPNAIEPAVAVSEPINHTLITIGFTAALNYV 1267

Query: 1558 FVTSFALSSAQIFTFLPPVLTYPFESHTEETVKIHDPTEKRQLERPPPVSFYSRASRDTT 1617
            F+    LSSAQIF FLP VL YPF + + E            L          R+   TT
Sbjct: 1268 FLVQNPLSSAQIFNFLPLVLKYPFSNTSSELDNSIGELSTFILSY--------RSGSSTT 1319

Query: 1618 TLSSFTHSQV-----------IAVQKETSDV----PDLSFVKVKQLAPDVSEERGYIATL 1662
            TLS  + S +               K T D+     D S + VK++ P V   + YI ++
Sbjct: 1320 TLSPKSISSLSVVKKKKNQQKKNATKSTEDLHPPQVDTSSIAVKKIVPMVDSSKAYIVSV 1379

Query: 1663 AHVYFPSKLVPKLQELILDSESPLYNNPDVNLKIFASLIDPTIKVRIIQHDRSNPRPAQG 1722
            A VYFP++ V  LQ+LILD  S LY+NP   L+  A LID  I +              G
Sbjct: 1380 AEVYFPTEAVTYLQQLILDENSTLYSNPQTPLRSLAGLIDSGIPL--------------G 1425

Query: 1723 GGT---SGSDGYSPSGYANHG-DGSLDNSKSPKITF-------------------KITKR 1759
            G T   SG  GY PS  ++   D S  NS++   T+                   K   +
Sbjct: 1426 GLTLYGSGDGGYVPSLTSSSVLDSSKGNSQNIDGTYKYGALDDFINSFTDSASAGKYAVK 1485

Query: 1760 LLIFLTVLTFGXXXXXXXXXXXXXXXXXINKVKSKIVLG-----EKKIPPSLGLFYSHQF 1814
            ++IFL VLT G                 + K   +  +G     E+++  S  L  S   
Sbjct: 1486 IIIFLIVLTIGVLLWLFVAFFAFRHRNILLKRHPRNCIGKSLNNEREL-ESTELSRSSS- 1543

Query: 1815 NNRLSDLKPSALYEGDPEKQDGTATDGSSGSVHGYATDDDIIVTGENTVYSLSQGIAYHI 1874
             N++ + KP       PE ++         SV+  A DD  IVTGENTVY+    + Y I
Sbjct: 1544 GNQVYNEKP-------PESEN--------ESVYS-AVDDHYIVTGENTVYNTIHRLHYTI 1587

Query: 1875 DEEGNYYYAGIDPFTDAFEQE------------ADCLYHESE-VESVNVNNLDHLSSDIK 1921
            +++G+  Y    P    F+Q              DC+Y +++      +N+ + +S  + 
Sbjct: 1588 NDDGDLLYRDAIPLD--FDQTNGDDGSGIDSIVRDCVYDKNQDATEAFLNDEESISGIL- 1644

Query: 1922 EENIDLDGNIELYDSDFDHTSLDQVPKATETIEKYNNNQ 1960
              ++D +G+I LYDS  D+   +      E IE YN N 
Sbjct: 1645 --DVDENGDIRLYDSYSDNEESNSFHLPDEVIENYNKNH 1681

>KNAG0C03260 Chr3 complement(639021..643613) [4593 bp, 1530 aa] {ON}
            Anc_5.524 YDR420W
          Length = 1530

 Score =  145 bits (367), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 133/457 (29%), Positives = 202/457 (44%), Gaps = 70/457 (15%)

Query: 1496 TDWLPATIITESVQQHLPNAAST--TGGVSTTLLPAAIHPQSLVEGSDGYDLISIGFLKG 1553
            T WLP  II  S      NA ST      ST  LPAAI P   ++    ++LI+IGFL G
Sbjct: 886  TVWLPTNIIIAS------NADSTHTARAESTASLPAAIAPAEELQSPPDFELITIGFLSG 939

Query: 1554 LNYVFVTSFALSSAQIFTFLPPVLTYPFESHTEETVKIHDPTEKRQLERPPPVSFYSRAS 1613
            LNY F+    LSSAQ+F FLP VL +P E   E++  I   +         P+    +  
Sbjct: 940  LNYAFLVGNPLSSAQVFDFLPHVLFFPIEDAAEKSKAIQPQSSDITTTLVAPLRKNRKTV 999

Query: 1614 RDTTTLSSFTHSQV------IAVQKETSDVPDLSF----VKVKQLAPDVSEERGYIATLA 1663
             D T  +    ++       +AV  E +   D+      ++VKQ+ P V E   YI ++A
Sbjct: 1000 TDMTRANVVNQNEATSSSLNLAVSSEATGSNDVELIFKNIRVKQIIPLVIEGNDYITSVA 1059

Query: 1664 HVYFPSKLVPKLQELILDSESPLYNNPDVNLKIFASLIDPTIKVRIIQHD-------RSN 1716
             VYFP+  +  L  LI D  S LY+NP  N    ASLID  I +  ++ +         +
Sbjct: 1060 EVYFPTIYIDSLSALISDPNSTLYSNPKKNFATLASLIDKAIPLTSLRKNDGQSNTSTDS 1119

Query: 1717 PRPAQGGGTSGSDGYSPSGYANHGDGSLD--NSKSPKITFKITKRLLIFLTVLTFGXXXX 1774
                    ++G D +  +       G++D  N K  K+   I  R+++FL  LT G    
Sbjct: 1120 SSDVNSNESTGDDAFQNAEEYLRVSGAMDLSNIKVSKVNHTIRNRIIVFLFTLTTG---- 1175

Query: 1775 XXXXXXXXXXXXXINKVKSKIVLGEKKIPPSLGLFYSHQFNNRLSD--LKPSA--LYEGD 1830
                                + L    I   L +F     + +L D  LK  +  LY+ +
Sbjct: 1176 --------------------VFLW---ISTFLIIFRITNKSRKLKDSNLKKGSLPLYQQN 1212

Query: 1831 PEKQDGTATDGSSGS---VHGYATDD--DIIVT----GENTVYSLSQGIAYHIDEEGNYY 1881
            P +++   +  SS S   +H Y T+   D   +    GEN +   +QGI Y +D EGNYY
Sbjct: 1213 PYRENKQFSAESSESYIDIH-YTTEKYSDYSASSPPIGENIIVDSAQGIQYKVDNEGNYY 1271

Query: 1882 YAGIDPFTDAFEQEADCLYHESEVESVNV--NNLDHL 1916
            Y G        E++ +   ++ E +S  +  +++DH 
Sbjct: 1272 YNGNHLAEGMPEEDEESARYKQENQSTELQSDSIDHF 1308

>Skud_4.694 Chr4 (1228095..1232609) [4515 bp, 1504 aa] {ON} YDR420W
            (REAL)
          Length = 1504

 Score =  118 bits (296), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 79/220 (35%), Positives = 107/220 (48%), Gaps = 15/220 (6%)

Query: 1498 WLPATIITESVQ---QHLPNAASTTGGVSTTLLPAAIHPQSLVEGSDGYDLISIGFLKGL 1554
            WLP TII E  Q      P   S TG      LP+ I P   V     + LI++GF  GL
Sbjct: 918  WLPTTIIVEPSQTGSSTAPFNPSITGS-----LPSLIEPAVAVSEPANHTLITVGFTAGL 972

Query: 1555 NYVFVTSFALSSAQIFTFLPPVLTYPFESHTEETVKIHDPTEKRQLERPPPVSFYSRASR 1614
            NY F+    LSSAQIF FLP VL YPF +   E            L      S  + + +
Sbjct: 973  NYEFLVQNPLSSAQIFNFLPLVLGYPFSNTRLEVQSSTQGLSSFVLSYQSGTSTTTLSPK 1032

Query: 1615 DTTTLSSFTHSQVIAVQKETSDVPDL-------SFVKVKQLAPDVSEERGYIATLAHVYF 1667
              ++LS     +    +  T+   DL       S + VKQ+ P V+  + Y+  +A VYF
Sbjct: 1033 SVSSLSIVKKKKKGEKRNATASTADLYLPSIETSSIVVKQIVPMVNSSKAYVIAVAEVYF 1092

Query: 1668 PSKLVPKLQELILDSESPLYNNPDVNLKIFASLIDPTIKV 1707
            P++ +  LQ+LILD+ SP+YNNP   L+  A LID  I +
Sbjct: 1093 PTEAISYLQKLILDASSPIYNNPQTPLRTLAGLIDSRIPL 1132

 Score = 59.3 bits (142), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 65/125 (52%), Gaps = 18/125 (14%)

Query: 1853 DDIIVTGENTVYSLSQGIAYHIDEEGNYYY------------AGIDPFTDAFEQEADCLY 1900
            D  IVTGENT+YS + G+ Y ++++G+ +Y             G D   D   +E  C+Y
Sbjct: 1273 DHYIVTGENTIYSTTHGLHYTMNDDGDLFYREAVPNDLNQLNGGEDLEIDVIVRE--CVY 1330

Query: 1901 -HESEVESVNVNNLDHLSSDIKEENIDLDGNIELYDSDFDHTSLDQVPKATETIEKYNNN 1959
              + +     +N+ + +SS +   ++D +GNI L+DS  D    ++     E I+ YNN+
Sbjct: 1331 DKDQDTTEAYLNDGESVSSIL---DVDENGNIRLHDSYSDDGESNRYHLQDEVIDDYNNS 1387

Query: 1960 QYYKM 1964
              YK+
Sbjct: 1388 HLYKI 1392

>Kwal_47.18650 s47 complement(913245..919724) [6480 bp, 2159 aa] {ON}
            YDR420W (HKR1) - Type 1 membrane protein with EF hand
            motif [contig 191] FULL
          Length = 2159

 Score =  114 bits (286), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 77/222 (34%), Positives = 110/222 (49%), Gaps = 12/222 (5%)

Query: 1497 DWLPATIITESVQQHLPNAASTTGGVSTTLLPAAIHPQSLVEGSDGYDLISIGFLKGLNY 1556
            DWLP  ++T S  + + N  S+    +T  LP  I P + V     Y  I+IGF K LNY
Sbjct: 1303 DWLPTLLVTASATESV-NTQSSFDTAATATLPQFIVPSTPVSIPANYSQITIGFQKALNY 1361

Query: 1557 VFVTSFALSSAQIFTFLPPVLTYPFESHTEETVKIHDPTEKRQLERPPP--------VSF 1608
             F+    L+SAQIF FLP VL YPF S  + T  + +    R  +  P         +S 
Sbjct: 1362 PFLIKNPLASAQIFGFLPDVLRYPFVSRFDRTTNVSESQPWRYFKEFPRDGHLENTNLSE 1421

Query: 1609 YSRASRDTTTLSSFTHSQVIAVQ---KETSDVPDLSFVKVKQLAPDVSEERGYIATLAHV 1665
              R  ++  T   F   Q +  +   +  +   + S V V  + P +     YIA++A V
Sbjct: 1422 DERKLKNGLTNHIFEDGQALQYRMHNRTGAFSANFSEVVVSSIIPLIISGNDYIASVAIV 1481

Query: 1666 YFPSKLVPKLQELILDSESPLYNNPDVNLKIFASLIDPTIKV 1707
            YFP+  V  LQ++IL+S S LY+NPD   +  A LIDP I +
Sbjct: 1482 YFPTSAVNVLQKMILNSASMLYSNPDSTQESLALLIDPKIPI 1523

 Score = 79.7 bits (195), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 74/136 (54%), Gaps = 19/136 (13%)

Query: 1849 YATDDDIIVTGENTVYSLSQGIAYHIDEEGNYYYAG----IDP-------FTDAFEQEAD 1897
            + +++D++  G    +S S G+ Y +  +GN+YYAG    + P        T+  +Q+ +
Sbjct: 1668 FRSEEDLLAVGNGLFFSRSTGLTYQVGPDGNFYYAGRTDDVYPKNQGAFQATNTGDQDKN 1727

Query: 1898 C-----LYHESEVESVNVNNLDHLSSDIKEENIDLDGNIELYDSDFDHTSLDQVPKATET 1952
                  L+ E EV +  ++ L  +  D+ E  +D DGN+EL  +D +  S ++    T+T
Sbjct: 1728 LNAVTTLFKEGEVNNEALH-LSQVGQDLDEIIVDEDGNVELPLADLEQLSFEE--NNTDT 1784

Query: 1953 IEKYNNNQYYKMNTLI 1968
            IE YNN QYYKMN L+
Sbjct: 1785 IESYNNQQYYKMNQLL 1800

>SAKL0H23188g Chr8 (2009677..2013465) [3789 bp, 1262 aa] {ON} some
            similarities with uniprot|P08640 Saccharomyces cerevisiae
            YIR019C MUC1 GPI-anchored cell surface glycoprotein
            required for diploid pseudohyphal formation and haploid
            invasive growth transcriptionally regulated by the MAPK
            pathway (via Ste12p and Tec1p) and the cAMP pathway (via
            Flo8p)
          Length = 1262

 Score =  107 bits (268), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 75/216 (34%), Positives = 98/216 (45%), Gaps = 64/216 (29%)

Query: 1497 DWLPATIITESVQQHLPNAASTTGG-------VSTTLLPAAIHPQSLVEGSDGYDLISIG 1549
            +WLP  ++ ES      N  +  GG       ++T  LP AI   + V   DGY LI+IG
Sbjct: 901  NWLPTAMLVESTATD--NGQANAGGSGTGISTLATQTLPQAIAAATQVSQPDGYTLITIG 958

Query: 1550 FLKGLNYVFVTSFALSSAQIFTFLPPVLTYPFESHTEETVKIHDPTEKRQLERPPPVSFY 1609
            F K LNY FV S  +SSAQ+F++LP VL YPF                            
Sbjct: 959  FKKSLNYPFVVSHPVSSAQLFSYLPNVLNYPF---------------------------- 990

Query: 1610 SRASRDTTTLSSFTHSQVIAVQKETSDVPDLSFVKVKQLAPDVSEERGYIATLAHVYFPS 1669
                       ++T S V                +V QL P  S  R Y+ T+A VYFPS
Sbjct: 991  -----------NYTFSDV----------------QVYQLVPLKSSSRDYLITVAKVYFPS 1023

Query: 1670 KLVPKLQELILDSESPLYNNPDVNLKIFASLIDPTI 1705
            + V  LQ+LI ++ + LY N +   K  ASLIDPTI
Sbjct: 1024 EQVEVLQKLISNTAANLYFNSNPTEKSLASLIDPTI 1059

>KLTH0G03696g Chr7 (286341..292598) [6258 bp, 2085 aa] {ON} some
            similarities with uniprot|P41809 Saccharomyces cerevisiae
            YDR420W HKR1 Serine/threonine rich cell surface protein
            that contains an EF hand motif involved in the regulation
            of cell wall beta-1 3 glucan synthesis and bud site
            selection overexpression confers resistance to Hansenula
            mrakii killer toxin HM-1
          Length = 2085

 Score =  105 bits (262), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 109/404 (26%), Positives = 163/404 (40%), Gaps = 99/404 (24%)

Query: 1639 DLSFVKVKQLAPDVSEERGYIATLAHVYFPSKLVPKLQELILDSESPLYNNPDVNLKIFA 1698
            + S V V  + P +     YI ++A VYFP++ V  LQ++I++  S +Y NPD +L+  A
Sbjct: 1375 NFSGVAVSSIVPLIVSGNDYITSVAVVYFPTEAVEVLQKMIINGASRIYKNPDQSLRDMA 1434

Query: 1699 SLIDPTIKVRII----------QHDRSNPRPAQGGGTSGSDGYSPSGY---ANHGDGSLD 1745
             LID  I +  I               +   +   GT  S   S S Y    N   G+LD
Sbjct: 1435 LLIDSKIPITGIISSDGSGQGSGSSGGSGSSSGSDGTGSSGSSSESDYEDVKNDNSGTLD 1494

Query: 1746 NSKSPKITFKITKRLLIFLTVLTFGXXXXXXXXXXXXXXXXXINKVKSKIVLGEKKIPPS 1805
              K+ ++ F  TKRL+IFL V                     I  V   I LG       
Sbjct: 1495 GYKNFQVKFFTTKRLVIFLPVF--------------------IVAVTMWISLGL------ 1528

Query: 1806 LGLFYSHQFNNRL-------------SDLKPSALYEGDPE----KQDGTATDGSSGSVHG 1848
              LF+   F                 +D K    Y G  E    +Q        +GS H 
Sbjct: 1529 --LFFGSLFRKGSLQGMAGNLEKKWNTDQKTLDNYFGITEFIGKRQSADLEKNLAGSFHN 1586

Query: 1849 YATDDD------IIVTGENTVYSLSQGIAYHIDEEGNYYYAG-----IDPFTDA--FEQE 1895
              +  D      ++  G    +S S G+ YH+D EGN++YAG     + P       + E
Sbjct: 1587 DESSSDAFDDDDLLAVGNGMFFSKSTGLTYHVDREGNFFYAGTANKAVLPLKSKSTSKLE 1646

Query: 1896 ADCLYHESEVESVNVNNLDHLS--------------------------SDIKEENIDLDG 1929
            A  +    E +  N  N  + +                          ++++E ++D DG
Sbjct: 1647 ASNMVPNGESDPKNEANEANEAKEEGEENEERKENEEKPCSNGEFRDDAEVEEFDVDEDG 1706

Query: 1930 NIELYDSDFDHTSLDQVPKATETIEKYNNNQYYKMNTLITDSSN 1973
            N+EL  SD +  SLD+    ++TIE YNN QYYKM  L+ + +N
Sbjct: 1707 NVELSVSDLERLSLDE--HNSDTIESYNNQQYYKMKQLLQNLNN 1748

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 37/85 (43%), Positives = 48/85 (56%), Gaps = 1/85 (1%)

Query: 1497 DWLPATIITESVQQHLPNAASTTGGVSTTLLPAAIHPQSLVEGSDGYDLISIGFLKGLNY 1556
            DWLP+ I+T S      +  S+    +T  LP AI P + V     Y  I+IGF + LNY
Sbjct: 1227 DWLPSNIVTASYTGSA-HTQSSFDADATATLPQAIMPPTPVTMPPNYSQITIGFKESLNY 1285

Query: 1557 VFVTSFALSSAQIFTFLPPVLTYPF 1581
             F+    L+SAQIF FLP +L YPF
Sbjct: 1286 PFLIENPLASAQIFGFLPEILRYPF 1310

>Kpol_363.14 s363 (25673..27781,27783..27959) [2286 bp, 761 aa] {ON}
            (25673..27781,27783..27959) [2286 nt, 762 aa]
          Length = 761

 Score = 96.7 bits (239), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 77/228 (33%), Positives = 109/228 (47%), Gaps = 25/228 (10%)

Query: 1498 WLPATIITESVQQHLPNAASTTGGVSTTLLPAAIHPQSLVEGSDGYDLISIGFLKGLNYV 1557
            WLP  I+ +S    + N+  T    +T+ LP  I P ++ + +D   LISIGF   LNY 
Sbjct: 520  WLPTNIVVQSSNTDMTNSPET--NTNTSGLPVRIAPTAVTQPADSI-LISIGFKIELNYP 576

Query: 1558 FVTSFALSSAQIFTFLPPVLTYPFES-----HTEETVKIHDPTEKRQLERPPPVSFYSRA 1612
            F+   + +SAQIF FLP +LTYPFE        + ++ +   T     E     S +S  
Sbjct: 577  FLIKESYASAQIFNFLPLILTYPFEQDSSNYQLDPSISLQSDTSVISTEYQDYSSIFSYE 636

Query: 1613 SRDTTTLSSFTHSQVIAVQKETSDVP-------------DLSFVKVKQLAPDVSEERGYI 1659
                TTLS+   +       ETS +              D S + VKQ+ P +     YI
Sbjct: 637  ----TTLSNLGLTLYDLSDGETSVLEASPTVASMNKYQRDTSSISVKQIIPILIPGNLYI 692

Query: 1660 ATLAHVYFPSKLVPKLQELILDSESPLYNNPDVNLKIFASLIDPTIKV 1707
             +LA   FP + V +LQ  I +  S +Y NPD  LK  A+LID TI +
Sbjct: 693  TSLAEGLFPGEKVDELQNYINNLTSIIYQNPDPRLKDMAALIDSTIPI 740

>AGR019C Chr7 complement(747644..750961) [3318 bp, 1105 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YGR014W
            (MSB2)
          Length = 1105

 Score = 94.7 bits (234), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 67/219 (30%), Positives = 96/219 (43%), Gaps = 63/219 (28%)

Query: 1497 DWLPATIITESVQ--------QHLPNAASTTGGVSTTLLPAAIHPQSLVEGSDGYDLISI 1548
            +WLP  IIT + Q        Q+  +    T   +   LP  I     V     Y LI+I
Sbjct: 756  NWLPTVIITATEQEVVSTESPQNTQSKPKPTATPNIQTLPQVIAAPDRVTPKKDYTLITI 815

Query: 1549 GFLKGLNYVFVTSFALSSAQIFTFLPPVLTYPFESHTEETVKIHDPTEKRQLERPPPVSF 1608
            GF K LNY F+     ++AQIF +LP +L Y                         P +F
Sbjct: 816  GFKKQLNYPFIAMNPFANAQIFDYLPGILNY-------------------------PFNF 850

Query: 1609 YSRASRDTTTLSSFTHSQVIAVQKETSDVPDLSFVKVKQLAPDVSEERGYIATLAHVYFP 1668
                                    E +D+       V QL P  +  + YIAT+A VYFP
Sbjct: 851  ------------------------EYADI------SVIQLVPLKANSKDYIATIAQVYFP 880

Query: 1669 SKLVPKLQELILDSESPLYNNPDVNLKIFASLIDPTIKV 1707
            S+ V +L +L++D+ S LY++ D N+K+FASLIDP + +
Sbjct: 881  SEKVDELAKLVVDTNSELYSSYDANMKVFASLIDPQLPL 919

>CAGL0F03003g Chr6 (289923..293480) [3558 bp, 1185 aa] {ON} some
            similarities with uniprot|P32334 Saccharomyces cerevisiae
            YGR014w MSB2 or uniprot|P41809 Saccharomyces cerevisiae
            YDR420w HKR1
          Length = 1185

 Score = 93.6 bits (231), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 66/211 (31%), Positives = 96/211 (45%), Gaps = 32/211 (15%)

Query: 1497 DWLPATIITESVQQHLPNAASTTGGVSTTLLPAAIHPQSLVEGSDGYDLISIGFLKGLNY 1556
            +WLP+ II +S        +S+    +T  LP  I P  +   S    L++IG  +GLNY
Sbjct: 716  NWLPSGIIFQS--DFATTVSSSFNPTATKSLPQFIAPPKMTVKSPNTTLVTIGLKQGLNY 773

Query: 1557 VFVTSFALSSAQIFTFLPPVLTYPFESHTEETVKIHDPTEKRQLERPPPVSFYSRASRDT 1616
             F+    LSSAQIF FLP VLTYPF S+      I+   +   L                
Sbjct: 774  QFLIDNPLSSAQIFNFLPSVLTYPFSSYAPNDFPINSLIDDNAL---------------- 817

Query: 1617 TTLSSFTHSQVIAVQKETSDVPDLSFVKVKQLAPDVSEERGYIATLAHVYFPSKLVPKLQ 1676
                +F  S +           + S + V  + P +     +  ++  VYFP+ L+  L 
Sbjct: 818  ----AFLDSNLF----------NASTISVHGIVPLLIPGHEFFVSVVEVYFPNDLLDSLS 863

Query: 1677 ELILDSESPLYNNPDVNLKIFASLIDPTIKV 1707
             LI D  S LY+NP+ +L   A LIDP+I +
Sbjct: 864  ALIKDRNSSLYSNPNDSLSALARLIDPSIPL 894

>ZYRO0G11242g Chr7 (900370..904833) [4464 bp, 1487 aa] {ON} weakly
            similar to uniprot|P32334 Saccharomyces cerevisiae
            YGR014W MSB2 Mucin family member at the head of the
            Cdc42p- and MAP kinase-dependent filamentous growth
            signaling pathway also functions as an osmosensor in
            parallel to the Sho1p-mediated pathway potential Cdc28p
            substrate
          Length = 1487

 Score = 93.6 bits (231), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 70/211 (33%), Positives = 90/211 (42%), Gaps = 60/211 (28%)

Query: 1498 WLPATIITESVQQHLPNA-ASTTGGVSTTLLPAAIHPQSLVEGSDGYDLISIGFLKGLNY 1556
            W+P  IIT    Q  PN  AS+T   +T  LP AI   +      GY L++IGF   LNY
Sbjct: 1159 WVPTKIIT----QPAPNTTASSTSSQATATLPQAIAAATQQVRPKGYSLLTIGFKSALNY 1214

Query: 1557 VFVTSFALSSAQIFTFLPPVLTYPFESHTEETVKIHDPTEKRQLERPPPVSFYSRASRDT 1616
             F+ S  LSSAQIF FLP +L  PF++                      VS Y       
Sbjct: 1215 NFLISSPLSSAQIFAFLPSILNDPFQNQFNN------------------VSIY------- 1249

Query: 1617 TTLSSFTHSQVIAVQKETSDVPDLSFVKVKQLAPDVSEERGYIATLAHVYFPSKLVPKLQ 1676
                                          Q+ P  SE   Y+AT+A VYFP+K +  L 
Sbjct: 1250 ------------------------------QIVPLKSESLDYLATVAEVYFPTKHISDLN 1279

Query: 1677 ELILDSESPLYNNPDVNLKIFASLIDPTIKV 1707
             LI ++ S LY +   + K  A LIDPTI +
Sbjct: 1280 SLITNNASSLYTDAHGSAKYLAELIDPTIPL 1310

>TDEL0D03010 Chr4 complement(564735..568106) [3372 bp, 1123 aa] {ON}
            Anc_4.150 YGR014W
          Length = 1123

 Score = 92.4 bits (228), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 68/210 (32%), Positives = 93/210 (44%), Gaps = 59/210 (28%)

Query: 1498 WLPATIITESVQQHLPNAASTTGGVSTTLLPAAIHPQSLVEGSDGYDLISIGFLKGLNYV 1557
            W+P  I+T++ Q      +S T G +T  LP AI   + V   DGY LI++GF + LNY 
Sbjct: 796  WVPTQIVTQTSQ----TTSSGTVGQATATLPQAIAAATQVARPDGYTLITLGFKRALNYN 851

Query: 1558 FVTSFALSSAQIFTFLPPVLTYPFESHTEETVKIHDPTEKRQLERPPPVSFYSRASRDTT 1617
            FV S  +SSAQIF FLP +L  PFE+  E                               
Sbjct: 852  FVVSNPISSAQIFAFLPEMLRTPFENSYEN------------------------------ 881

Query: 1618 TLSSFTHSQVIAVQKETSDVPDLSFVKVKQLAPDVSEERGYIATLAHVYFPSKLVPKLQE 1677
                      I VQ               QL P  S+   Y+AT+A VYFP+  +  L +
Sbjct: 882  ----------ITVQ---------------QLVPLQSKAVSYLATVAEVYFPTSEISALSK 916

Query: 1678 LILDSESPLYNNPDVNLKIFASLIDPTIKV 1707
            LI ++ S LY + +   K  A LID +I +
Sbjct: 917  LISNTSSNLYTDVEGPAKYLAYLIDASIPL 946

>KAFR0E03320 Chr5 complement(659303..662875) [3573 bp, 1190 aa] {ON}
            Anc_5.524 YDR420W
          Length = 1190

 Score = 91.7 bits (226), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 94/310 (30%), Positives = 138/310 (44%), Gaps = 39/310 (12%)

Query: 1497 DWLPATIITESVQQHLPNAASTTGGVSTTLLPAAIHPQSLVEGSDGYDLISIGFLKGLNY 1556
            DWLP ++I  S Q    +  S+     T  LPA I   +         L++IGF K LNY
Sbjct: 591  DWLPNSMIFASDQSD--STFSSLNPEITATLPAEIAAPTEAVQPPNTTLVTIGFKKELNY 648

Query: 1557 VFVTSFALSSAQIFTFLPPVLTYPF-----ESHTEETVKIHDPTEKRQLERPPPVSFYSR 1611
            +F+    L+SAQIF FLP  L+YPF      + +EE   +   +   + +    ++ +  
Sbjct: 649  IFLIDNPLASAQIFEFLPLTLSYPFLLTQYNASSEEITSLCSSSLYYEDDGRTILTTHES 708

Query: 1612 ASRDTTTLSSFTH---SQVIAVQ---------------KETSDVPDL--SFVKVKQLAPD 1651
             + D+T          S ++  Q               +E+S  P    S V VK + P 
Sbjct: 709  TTVDSTQFVKKIMGPASNLLTAQLASSPSSSPTQRPHPRESSPPPFFNSSNVVVKHILPM 768

Query: 1652 VSEERGYIATLAHVYFPSKLVPKLQELILDSESPLYNNPDVNLKIFASLIDPTIKV--RI 1709
            +S +R YI ++A VYFP+  +  LQ+ I    SPLY+NP         LIDP I +    
Sbjct: 769  ISNQRDYIVSVAEVYFPTDTLGILQKFINKPNSPLYSNPSTPYSTLVHLIDPWISLTDLF 828

Query: 1710 IQHDRSNPRPAQGGGTSGSDG-----YSPSGYAN---HGDGSLD--NSKSPKITFKITKR 1759
             Q+  +N    Q G  S +D       +PS   +      GSLD  +  + K + KI  R
Sbjct: 829  QQNGMNNQGNNQDGSLSSNDSSFNTKTNPSNLTSTETERSGSLDLNSGYTSKFSSKIKDR 888

Query: 1760 LLIFLTVLTF 1769
            L IF TV  F
Sbjct: 889  LAIFTTVFLF 898

 Score = 33.9 bits (76), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 25/55 (45%)

Query: 1852 DDDIIVTGENTVYSLSQGIAYHIDEEGNYYYAGIDPFTDAFEQEADCLYHESEVE 1906
            D   + + E  VY  S G+ Y +D +GN+YY G     D         Y  +++E
Sbjct: 972  DGTTVNSKEGVVYDQSNGMQYTVDYDGNFYYFGNKELLDGTNTTTFTEYMYNDIE 1026

>YGR014W Chr7 (516943..520863) [3921 bp, 1306 aa] {ON}  MSB2Mucin
            family member involved in the Cdc42p- and MAP
            kinase-dependent filamentous growth signaling pathway;
            also functions as an osmosensor in parallel to the
            Sho1p-mediated pathway; potential Cdc28p substrate
          Length = 1306

 Score = 86.3 bits (212), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 61/216 (28%), Positives = 94/216 (43%), Gaps = 56/216 (25%)

Query: 1498 WLPATIITESVQQHLPNAASTTGGVSTTLLPAAIHPQSLVEGSDGYDLISIGFLKGLNYV 1557
            W+P  +IT++  +    A+ST GG  T  LP AI   + V   +GY LI+IGF K LNY 
Sbjct: 961  WIPTELITQA-PEAASTASSTVGGTQTMTLPHAIAAATQVPEPEGYTLITIGFKKALNYE 1019

Query: 1558 FVTSFALSSAQIFTFLPPVLTYPFESHTEETVKIHDPTEKRQLERPPPVSFYSRASRDTT 1617
            FV S   SSAQIF +LP  L  PF++                                  
Sbjct: 1020 FVVSEPKSSAQIFGYLPEALNTPFKN---------------------------------- 1045

Query: 1618 TLSSFTHSQVIAVQKETSDVPDLSFVKVKQLAPDVSEERGYIATLAHVYFPSKLVPKLQE 1677
              ++ T  Q++ +Q ++                       Y+ ++A VYFP+  + +L  
Sbjct: 1046 VFTNITVLQIVPLQDDS---------------------LNYLVSVAEVYFPTAEIEELSN 1084

Query: 1678 LILDSESPLYNNPDVNLKIFASLIDPTIKVRIIQHD 1713
            LI +S S  Y +     K  A+++D +I +  + HD
Sbjct: 1085 LITNSSSAFYTDGMGTAKSMAAMVDSSIPLTGLLHD 1120

>KLLA0C17985g Chr3 complement(1596320..1599046) [2727 bp, 908 aa] {ON}
            some similarities with uniprot|P32334 Saccharomyces
            cerevisiae YGR014W MSB2 Mucin family member at the head
            of the Cdc42p- and MAP kinase-dependent filamentous
            growth signaling pathway also functions as an osmosensor
            in parallel to the Sho1p-mediated pathway potential
            Cdc28p substrate
          Length = 908

 Score = 83.6 bits (205), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 65/210 (30%), Positives = 93/210 (44%), Gaps = 53/210 (25%)

Query: 1498 WLPATIITESVQQHLPNAASTTGGVSTTLLPAAIHPQSLVEGSDGYDLISIGFLKGLNYV 1557
            WLP T++ E       + ++T+  ++T  LP AI   + +    GY LI++GF K LNY 
Sbjct: 535  WLPTTMVAEFETSGTQSTSTTSSKIATETLPQAITAATEIVQPAGYTLITVGFKKELNYP 594

Query: 1558 FVTSFALSSAQIFTFLPPVLTYPFESHTEETVKIHDPTEKRQLERPPPVSFYSRASRDTT 1617
            F  +  +S+AQIF FLP VL YPF    +                               
Sbjct: 595  FTVNNPVSNAQIFEFLPKVLNYPFNGAQK------------------------------- 623

Query: 1618 TLSSFTHSQVIAVQKETSDVPDLSFVKVKQLAPDVSEERGYIATLAHVYFPSKLVPKLQE 1677
                F ++ V+ +      VP    +KV  L         Y+ T+A VYFP   V  LQ 
Sbjct: 624  ----FDNTSVLEL------VP----LKVTSL--------DYLVTVAKVYFPEDSVSTLQA 661

Query: 1678 LILDSESPLYNNPDVNLKIFASLIDPTIKV 1707
             IL+S S +YNN    LK  +S ID +I +
Sbjct: 662  QILNSSSVIYNNDVTALKQLSSYIDASIPL 691

 Score = 35.8 bits (81), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (63%)

Query: 2302 SLSKMHQKQSSRKDKISKLRISGPIHTEHSLGW 2334
            S++   +KQ     K S L+IS PI TE+SLGW
Sbjct: 873  SVANNGEKQPQLSTKTSSLKISKPIATENSLGW 905

>Skud_7.299 Chr7 (520447..523956) [3510 bp, 1169 aa] {ON} YGR014W
            (REAL)
          Length = 1169

 Score = 82.8 bits (203), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 59/214 (27%), Positives = 93/214 (43%), Gaps = 64/214 (29%)

Query: 1498 WLPATIITESVQQHLPNAASTT----GGVSTTLLPAAIHPQSLVEGSDGYDLISIGFLKG 1553
            W+P  +IT++     P  AST     GG  T  LP A+   + +  S+GY LI++GF K 
Sbjct: 823  WIPTELITQA-----PETASTISSAIGGTQTMTLPQAVAAATQIPESEGYSLITVGFKKP 877

Query: 1554 LNYVFVTSFALSSAQIFTFLPPVLTYPFESHTEETVKIHDPTEKRQLERPPPVSFYSRAS 1613
            LNY FV S   SSAQIF +LP  L  PF++                              
Sbjct: 878  LNYEFVVSEPKSSAQIFGYLPAALNTPFKN------------------------------ 907

Query: 1614 RDTTTLSSFTHSQVIAVQKETSDVPDLSFVKVKQLAPDVSEERGYIATLAHVYFPSKLVP 1673
                  ++ T  Q++ +Q ++                       Y+ ++A VYFP+  V 
Sbjct: 908  ----VFTNITVLQIVPLQDDS---------------------LNYLISVAEVYFPTAEVE 942

Query: 1674 KLQELILDSESPLYNNPDVNLKIFASLIDPTIKV 1707
            +L  LI+++ S  Y +     K  A+++DP+I +
Sbjct: 943  ELSNLIMNTSSTFYTDGTGTAKSMAAMVDPSIPL 976

>Kwal_47.17703 s47 (521283..525989) [4707 bp, 1568 aa] {ON} YNR044W
            (AGA1) - anchorage subunit of a-agglutinin [contig 206]
            FULL
          Length = 1568

 Score = 80.1 bits (196), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 77/262 (29%), Positives = 108/262 (41%), Gaps = 76/262 (29%)

Query: 1497 DWLPATIITESVQQHLPNAASTT-------GGVSTTLLPAAIHPQSLVEGSDGYDLISIG 1549
            +WLP  +IT +       +AS T          +T  LP AI   + V   +GY LI++G
Sbjct: 1223 NWLPTAMITANANTE---SASPTDSSDPKDAQQATKTLPQAIGAPTEVVQPEGYTLITVG 1279

Query: 1550 FLKGLNYVFVTSFALSSAQIFTFLPPVLTYPFESHTEETVKIHDPTEKRQLERPPPVSFY 1609
            F K LNY FV    ++SAQIF FLP  L  PF+                           
Sbjct: 1280 FKKALNYPFVVGNPVTSAQIFAFLPDTLNSPFD--------------------------- 1312

Query: 1610 SRASRDTTTLSSFTHSQVIAVQKETSDVPDLSFVKVKQLAPDVSEERGYIATLAHVYFPS 1669
                      ++FT+   I V +               L P     R Y+ T+A VYFPS
Sbjct: 1313 ----------NAFTN---ITVAR---------------LGPLKVSSRDYLLTVAEVYFPS 1344

Query: 1670 KLVPKLQELILDSESPLYNNPDVNLKIFASLIDPTIKVR-IIQHDRSNPRPAQGGGTS-- 1726
              V  LQ+LI +  S  Y     +  + ASL+D TI +  ++Q D        G  TS  
Sbjct: 1345 AQVENLQKLIQNDASKFYFVNGTSRNVVASLVDATIPLTGLLQDD--------GSTTSET 1396

Query: 1727 GSDGYSPSGYANHGDGSLDNSK 1748
            GS+  SPS   +  +   D+S+
Sbjct: 1397 GSESGSPSNTGSSSNEGTDSSE 1418

>NCAS0A05230 Chr1 (1034523..1036880) [2358 bp, 785 aa] {ON} Anc_4.150
          Length = 785

 Score = 79.3 bits (194), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 62/210 (29%), Positives = 89/210 (42%), Gaps = 58/210 (27%)

Query: 1498 WLPATIITESVQQHLPNAASTTGGVSTTLLPAAIHPQSLVEGSDGYDLISIGFLKGLNYV 1557
            W+P  +IT S Q      ++     +T  LP  I   + V   +GY +I+IGF + LNY 
Sbjct: 452  WIPTQLITASTQV---TGSAMVSSAATKTLPQVIGAATSVPTPEGYTVITIGFKEALNYE 508

Query: 1558 FVTSFALSSAQIFTFLPPVLTYPFESHTEETVKIHDPTEKRQLERPPPVSFYSRASRDTT 1617
            F+ S   SSAQIF+FLP VL  PF+        I+D                        
Sbjct: 509  FIVSSPKSSAQIFSFLPYVLNTPFD-------DIYD------------------------ 537

Query: 1618 TLSSFTHSQVIAVQKETSDVPDLSFVKVKQLAPDVSEERGYIATLAHVYFPSKLVPKLQE 1677
               + T S+++ +QK                     ++ GY  T+A V FP   +  L  
Sbjct: 538  ---NITVSRLVPLQK---------------------KDIGYFITVAEVLFPESAIANLSV 573

Query: 1678 LILDSESPLYNNPDVNLKIFASLIDPTIKV 1707
             I D+ S LY   D  L+  A LIDP+I +
Sbjct: 574  YIKDTNSSLYTKNDDALRSLALLIDPSIPL 603

>TPHA0K01390 Chr11 complement(287666..290146) [2481 bp, 826 aa] {ON}
            Anc_4.150 YGR014W
          Length = 826

 Score = 77.8 bits (190), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 64/191 (33%), Positives = 85/191 (44%), Gaps = 57/191 (29%)

Query: 1498 WLPATIITESVQQHLPNAASTTGGVSTTLL-PAAIHPQSLVEGSDGYDLISIGFLKGLNY 1556
            W+P  IITES +    N+ S+T  VSTT + P AI   + +    GY LI+IGF + LNY
Sbjct: 488  WVPTRIITESDKTQ--NSVSSTQTVSTTRIKPKAIAAPTTIPVPSGYTLITIGFKEALNY 545

Query: 1557 VFVTSFALSSAQIFTFLPPVLTYPFESHTEETVKIHDPTEKRQLERPPPVSFYSRASRDT 1616
             FV    +SSAQIF FLP  L  PF+   + +V I        L+  P    YS ++ + 
Sbjct: 546  DFVLDNPVSSAQIFAFLPEALDLPFQFANDSSVSI--------LKLVP----YSLSNYNY 593

Query: 1617 TTLSSFTHSQVIAVQKETSDVPDLSFVKVKQLAPDVSEERGYIATLAHVYFPSKLVPKLQ 1676
            T L                                          +A VYFPS  + +L 
Sbjct: 594  TVL------------------------------------------VAEVYFPSDSIDELS 611

Query: 1677 ELILDSESPLY 1687
             LI DS+SPLY
Sbjct: 612  SLIKDSDSPLY 622

>TPHA0L00360 Chr12 complement(50396..53881) [3486 bp, 1161 aa] {ON} 
          Length = 1161

 Score = 77.0 bits (188), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 85/337 (25%), Positives = 137/337 (40%), Gaps = 76/337 (22%)

Query: 1497 DWLPATIITES---VQQHLPNAASTTGGVSTTLLPAAIHPQSLVEGSDGYDLISIGFLKG 1553
            DWLP+ I  +S    +   P+    T G     LP  I   + +       LI++ F + 
Sbjct: 515  DWLPSEIAIQSDSTAESMEPSFLIDTSG-----LPNIITAPTAITIPSNTTLITVAFKRE 569

Query: 1554 LNYVFVTSFALSSAQIFTFLPPVLTYP--------------------------------- 1580
            LNY F+ +   SSAQIF FLP ++ +P                                 
Sbjct: 570  LNYAFLVNNFYSSAQIFNFLPIIIKHPFTALVSESCNDDSVCSPLFTEYILNSYASSAAS 629

Query: 1581 -----------FESHTEETVKIHDPTEKRQLERP-PPVSFYSRASRDTTTLSSFTHSQVI 1628
                       F+S  + +V I+       ++    P  F +  +    +L+    S+  
Sbjct: 630  SMSTSSVNNVDFQSGGKHSVNINLSLHSTIVQTAISPTGFQTNMTSQIPSLAKKDLSKNA 689

Query: 1629 AVQKETSDVPDLSF-VKVKQLAPDVSEERGYIATLAHVYFPSKLVPKLQELILDSESPLY 1687
            ++QK+     ++S  + V ++ P + +   YI ++A VY P+++V  LQELIL+  S  Y
Sbjct: 690  SLQKQ-----EISMDITVARIIPYIVQNNKYIISIAEVYVPNEIVETLQELILNPASSFY 744

Query: 1688 NNPDVNLKIFASLIDPTIKVRIIQHDRSNPRPAQGGGTSGSDGYSPSGYANHGDGS---- 1743
            N+   +LK  A LIDP I +  +     N      GG S S+G   +    H  GS    
Sbjct: 745  NSESSSLKTLAFLIDPNIPLTGMLDSNGN---LISGGLSSSNGNIQNSSTKHSHGSGISD 801

Query: 1744 ----------LDNSKSPKITFKITKRLLIFLTVLTFG 1770
                      LD+S    ++  + KRL IF+   T G
Sbjct: 802  ISSQTLKLGTLDSSAYKGLSTNLKKRLSIFIVCFTVG 838

 Score = 42.7 bits (99), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 57/118 (48%), Gaps = 21/118 (17%)

Query: 1863 VYSLSQGIAYHIDEEGNYYYAGID------------PFTDAFEQEADCLYHESEVESVNV 1910
            VY+ SQ + Y +DE+GN+YY  +D            P    + +  D  Y++   +S N 
Sbjct: 920  VYNRSQDMTYLVDEQGNFYYTNLDNVQGRTVHIMRTPEGSIYSK--DVSYNKYVYDSNNS 977

Query: 1911 NNLDHLSSDIKEENIDLDGNIELYDSDFDHTSLDQVPKA----TETIEKYNNNQYYKM 1964
             +  +L     E  ++   ++E+   DF    L++V ++     E ++++NNN  YKM
Sbjct: 978  TSNTYLDDQYHENTVNKGDDLEITYPDF---LLNEVKESHTNIIENVKRFNNNGLYKM 1032

>KAFR0F03470 Chr6 (689705..692554) [2850 bp, 949 aa] {ON} Anc_4.150
            YGR014W
          Length = 949

 Score = 76.3 bits (186), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 55/179 (30%), Positives = 73/179 (40%), Gaps = 55/179 (30%)

Query: 1527 LPAAIHPQSLVEGSDGYDLISIGFLKGLNYVFVTSFALSSAQIFTFLPPVLTYPFESHTE 1586
            LP AI   + V   D Y LI+IGF K LNY FV +   SSAQ+F++LP  L  PF     
Sbjct: 618  LPQAIAAPTEVTAPDDYSLITIGFKKALNYEFVVNTPESSAQLFSYLPIALNTPFN---- 673

Query: 1587 ETVKIHDPTEKRQLERPPPVSFYSRASRDTTTLSSFTHSQVIAVQKETSDVPDLSFVKVK 1646
                                             +SFT+                  + V 
Sbjct: 674  ---------------------------------NSFTN------------------ISVY 682

Query: 1647 QLAPDVSEERGYIATLAHVYFPSKLVPKLQELILDSESPLYNNPDVNLKIFASLIDPTI 1705
            Q+ P V     Y  T+A VYFP + +  LQ++I D+ S L+       K   SLIDP+I
Sbjct: 683  QIVPLVESSLNYYITVAEVYFPEQEIASLQQMIKDNSSALFTENVGAPKTLVSLIDPSI 741

>Smik_7.302 Chr7 (508666..512235) [3570 bp, 1189 aa] {ON} YGR014W
            (REAL)
          Length = 1189

 Score = 75.9 bits (185), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 58/216 (26%), Positives = 92/216 (42%), Gaps = 56/216 (25%)

Query: 1498 WLPATIITESVQQHLPNAASTTGGVSTTLLPAAIHPQSLVEGSDGYDLISIGFLKGLNYV 1557
            W+P  +IT++ +     A+ST  G  T  LP AI   + +  S+GY LI++GF + LNY 
Sbjct: 842  WIPTELITQAPEAAS-TASSTASGTQTMTLPHAIAAATQIPASEGYSLITVGFKRALNYE 900

Query: 1558 FVTSFALSSAQIFTFLPPVLTYPFESHTEETVKIHDPTEKRQLERPPPVSFYSRASRDTT 1617
            FV S   SSAQIF +LP  L  PF++                                  
Sbjct: 901  FVVSEPKSSAQIFGYLPEALNTPFKNV--------------------------------- 927

Query: 1618 TLSSFTHSQVIAVQKETSDVPDLSFVKVKQLAPDVSEERGYIATLAHVYFPSKLVPKLQE 1677
                FT+  V+ +                   P   +   Y+ ++A VYFP+  + +L  
Sbjct: 928  ----FTNISVLQI------------------VPLQDDSLSYLVSVAEVYFPTAELEELSN 965

Query: 1678 LILDSESPLYNNPDVNLKIFASLIDPTIKVRIIQHD 1713
            LI ++ S  Y +     K  A+++DP+I +  +  D
Sbjct: 966  LITNTSSTFYTSGTGTAKSMAAMVDPSIPLTGLLRD 1001

>Suva_7.296 Chr7 (508904..512311) [3408 bp, 1135 aa] {ON} YGR014W
            (REAL)
          Length = 1135

 Score = 73.6 bits (179), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 62/215 (28%), Positives = 92/215 (42%), Gaps = 56/215 (26%)

Query: 1498 WLPATIITESVQQHLPNAASTTGGVSTTLLPAAIHPQSLVEGSDGYDLISIGFLKGLNYV 1557
            W+P  +IT+  +    +A++TTGG  T  LP AI   + +   DGY LI+IGF K LNY 
Sbjct: 790  WIPTQLITQETEAA-SSASTTTGGTQTMTLPHAIAAATQIAEPDGYSLITIGFKKALNYE 848

Query: 1558 FVTSFALSSAQIFTFLPPVLTYPFESHTEETVKIHDPTEKRQLERPPPVSFYSRASRDTT 1617
            FV S   SSAQIF +LP  L  PF                                +D  
Sbjct: 849  FVVSEPKSSAQIFAYLPEALNTPF--------------------------------KDV- 875

Query: 1618 TLSSFTHSQVIAVQKETSDVPDLSFVKVKQLAPDVSEERGYIATLAHVYFPSKLVPKLQE 1677
                FT+  V+                  Q+ P   +   Y+ ++A VYFP+  +  L  
Sbjct: 876  ----FTNISVL------------------QIVPLQDDLFSYLVSVAEVYFPTAEIETLSS 913

Query: 1678 LILDSESPLYNNPDVNLKIFASLIDPTIKVRIIQH 1712
            LI ++ S  Y +     K  A+++D +I +  + H
Sbjct: 914  LITNTSSSFYTDGMGTAKSMAAMVDASIPLTGLLH 948

>Kpol_1062.37 s1062 complement(78801..81722) [2922 bp, 973 aa] {ON}
            complement(78801..81722) [2922 nt, 974 aa]
          Length = 973

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 63/211 (29%), Positives = 89/211 (42%), Gaps = 59/211 (27%)

Query: 1498 WLPATIITESVQQHLPNAASTTGGVSTTL-LPAAIHPQSLVEGSDGYDLISIGFLKGLNY 1556
            W+P ++ITES    + ++A TT  +S T  +P AI   +     +G  L++IGF + LNY
Sbjct: 643  WVPTSLITES---DVTDSAVTTRTLSATKSVPLAIAASTQTATPEGCSLVTIGFKEALNY 699

Query: 1557 VFVTSFALSSAQIFTFLPPVLTYPFESHTEETVKIHDPTEKRQLERPPPVSFYSRASRDT 1616
             FV S +++ AQIF FLP  L  PFE                QL     V+ Y       
Sbjct: 700  QFVLSSSVTVAQIFAFLPGGLIAPFE---------------EQLAN---VTVY------- 734

Query: 1617 TTLSSFTHSQVIAVQKETSDVPDLSFVKVKQLAPDVSEERGYIATLAHVYFPSKLVPKLQ 1676
                                          +L+P       Y  T+A VYFP+  + +L 
Sbjct: 735  ------------------------------RLSPLNYGNFNYTLTVAEVYFPTSKIDELA 764

Query: 1677 ELILDSESPLYNNPDVNLKIFASLIDPTIKV 1707
              + DSES LY N     +   SLIDP I +
Sbjct: 765  AFVADSESALYVNASGTEEELVSLIDPRIPI 795

>KLTH0E08844g Chr5 (804120..808682) [4563 bp, 1520 aa] {ON} some
            similarities with uniprot|P32334 Saccharomyces cerevisiae
            YGR014W MSB2 Mucin family member at the head of the
            Cdc42p- and MAP kinase-dependent filamentous growth
            signaling pathway also functions as an osmosensor in
            parallel to the Sho1p-mediated pathway potential Cdc28p
            substrate
          Length = 1520

 Score = 70.5 bits (171), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 53/89 (59%), Gaps = 3/89 (3%)

Query: 1497 DWLPATIITESVQQHLPNAASTTGG---VSTTLLPAAIHPQSLVEGSDGYDLISIGFLKG 1553
            +WLP  ++T S   +   + ST      ++T  LP AI   + V   +GY LI+IGF + 
Sbjct: 1178 NWLPTALVTASSDTNDTQSGSTDSNGSQLATQTLPQAIGAPTEVSQPEGYTLITIGFKQA 1237

Query: 1554 LNYVFVTSFALSSAQIFTFLPPVLTYPFE 1582
            LNY FV + A++SAQIF +LP  L +PF+
Sbjct: 1238 LNYPFVVTNAVTSAQIFAYLPETLNFPFD 1266

>NDAI0K02580 Chr11 complement(574995..577952) [2958 bp, 985 aa] {ON}
            Anc_4.150
          Length = 985

 Score = 70.1 bits (170), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 55/188 (29%), Positives = 80/188 (42%), Gaps = 56/188 (29%)

Query: 1498 WLPATIITESVQQHLPNAASTTGGVSTTLLPAAIHPQSLVEGSDGYDLISIGFLKGLNYV 1557
            W+P  +IT+S  Q   +A+  T   +T  LP  I   + +   +GY LI+IGF K LNY 
Sbjct: 606  WIPTVLITQS-NQPSESASVPTSNTATKTLPQVIAVGTTIPEPEGYSLITIGFKKPLNYE 664

Query: 1558 FVTSFALSSAQIFTFLPPVLTYPFESHTEETVKIHDPTEKRQLERPPPVSFYSRASRDTT 1617
            F+ +   SSAQIF+FLP VL  PF +                                  
Sbjct: 665  FIVANPKSSAQIFSFLPDVLNAPFNN---------------------------------- 690

Query: 1618 TLSSFTHSQVIAVQKETSDVPDLSFVKVKQLAPDVSEERGYIATLAHVYFPSKLVPKLQE 1677
            T ++ T  Q++ +Q      P L                 Y+ T+A VYFP+ ++  L  
Sbjct: 691  TFNNITVLQLVPLQN-----PSL----------------NYLVTVAKVYFPTDMIDTLSS 729

Query: 1678 LILDSESP 1685
            LI D  +P
Sbjct: 730  LIEDYTTP 737

>TBLA0G00950 Chr7 complement(232502..239263) [6762 bp, 2253 aa] {ON}
            Anc_5.524 YDR420W
          Length = 2253

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 89/355 (25%), Positives = 142/355 (40%), Gaps = 73/355 (20%)

Query: 1643 VKVKQLAPDVSEERGYIATLAHVYFPSKLVPKLQELILDSESPLYNNPDVNLKIFASLID 1702
            ++VKQ+ P + E+R Y      VY P+ +V +LQ  I D +S LY+NP    +  ++ ID
Sbjct: 1777 IEVKQIIPLLIEDRDYWVAGVQVYVPNNVVDQLQAYIYDLDSILYHNPVYIARELSNFID 1836

Query: 1703 PTIKV----RIIQHDRSNPRP-------AQGGGTSGSDGYSPSGYANHGD--------GS 1743
             +I +    +       NP         +    T+GSD    S  A+           G+
Sbjct: 1837 SSIPIVGSGKYWTAYDGNPNEENELNTSSNSEDTNGSDVEPNSDDASQNTNSLVYQDMGT 1896

Query: 1744 LDNSK--SPKITFKITKRLLIFLTVLTFGXXXXXXXXXXXXXXXXXINKVK--SKIVLGE 1799
            LD     S K T + T +  I++  + FG                   + +  +KI+   
Sbjct: 1897 LDTGTILSKKTTLE-TSKAWIYIVAMIFGFISLLFSILFSMTFMKFSYQFEFITKIIRPT 1955

Query: 1800 KKIPPS--LGLFYSHQFNNRLSDLKPSALYEGDPEKQDGTATDGSSGSVHGYATDDDIIV 1857
            +KI P+    +  SH   N+  ++ P  ++    EK          G +    + +D  +
Sbjct: 1956 EKIWPTKDASIGASHALKNK--NILP-IVHTPIMEK----------GEIFPSPSINDCEI 2002

Query: 1858 TGENTVYSLSQGIAYHIDEEGNYYYAGIDPFTDAFEQEADCLYHESEVESVNVNNLDHLS 1917
                 VY  + G+AY +D+EGNYYY                L    +  + N +  D+  
Sbjct: 2003 -----VYDNNNGLAYTVDKEGNYYYHH-------------NLTTGKDFITFNTSLQDYRK 2044

Query: 1918 SDIKEENIDLDGNIELYDSDFDHTSLDQVP-----------KATETIEKYNNNQY 1961
                +  ID DGNIE+ DS   H   D +P           K  + I KY NNQY
Sbjct: 2045 EGHDDIFIDQDGNIEIEDS---HGIYD-IPTSSSISHGSSIKNLDNIRKY-NNQY 2094

 Score = 42.0 bits (97), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 46/86 (53%), Gaps = 6/86 (6%)

Query: 1497 DWLPATIITESVQQHLPNAASTTGGVSTTL-LPAAIHPQSLVEGSDGYD--LISIGFLKG 1553
            +WLP+T++   V+ +   +A+     S T   P AI P++  E     D  LI +   + 
Sbjct: 1555 NWLPSTLV---VENNPSGSANMQFNPSETFKWPRAITPENQNEKPAPVDSQLILVALDRP 1611

Query: 1554 LNYVFVTSFALSSAQIFTFLPPVLTY 1579
            LNY F+    +SSAQ+  ++P +L+Y
Sbjct: 1612 LNYPFLIENLVSSAQVMNYIPFILSY 1637

>KNAG0D03590 Chr4 (657513..660497) [2985 bp, 994 aa] {ON} Anc_4.150
            YGR014W
          Length = 994

 Score = 59.3 bits (142), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 51/92 (55%), Gaps = 4/92 (4%)

Query: 1494 EKTD---WLPATIITESVQ-QHLPNAASTTGGVSTTLLPAAIHPQSLVEGSDGYDLISIG 1549
            E TD   W+P  ++TE+   +   N  ST    +T  +P  I     V  ++GY LI+IG
Sbjct: 639  ETTDSDWWIPTRLLTETAAVETASNTVSTLSPSATKYMPQVIMAPGDVTVAEGYTLITIG 698

Query: 1550 FLKGLNYVFVTSFALSSAQIFTFLPPVLTYPF 1581
            F K L+Y FV +   SSAQI +FLP +L  P+
Sbjct: 699  FKKPLHYEFVVTQPKSSAQIISFLPNLLNQPY 730

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 36/68 (52%)

Query: 1640 LSFVKVKQLAPDVSEERGYIATLAHVYFPSKLVPKLQELILDSESPLYNNPDVNLKIFAS 1699
             S + V QL P       Y  T+A VYFP+  +  L +L+ D+ S LY     +LK  A 
Sbjct: 734  FSNISVLQLVPLQDSSISYYVTVAEVYFPTAEITNLSQLVKDTSSILYTEVSESLKTLAD 793

Query: 1700 LIDPTIKV 1707
            +IDP+I +
Sbjct: 794  MIDPSIPI 801

>Ecym_7349 Chr7 complement(722484..725873) [3390 bp, 1129 aa] {ON}
            similar to Ashbya gossypii AGR019C
          Length = 1129

 Score = 58.5 bits (140), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/93 (40%), Positives = 49/93 (52%), Gaps = 9/93 (9%)

Query: 1498 WLPATIITESVQQHLPNAASTTGGVSTTLLPAAIHPQSL---VEGSDG------YDLISI 1548
            WLP  I+TES     P    T      T   A+   Q+L   +  ++G      Y LI++
Sbjct: 776  WLPTAILTESDADSEPTVTVTDTETKPTTSMASTAIQTLPKFISSANGKIPEGNYTLITV 835

Query: 1549 GFLKGLNYVFVTSFALSSAQIFTFLPPVLTYPF 1581
            GF + LNY FV S  +SSAQIF FLP VL YP+
Sbjct: 836  GFKRRLNYPFVVSNPVSSAQIFDFLPNVLNYPY 868

 Score = 57.8 bits (138), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 64/128 (50%), Gaps = 13/128 (10%)

Query: 1643 VKVKQLAPDVSEERGYIATLAHVYFPSKLVPKLQELILDSESPLYNNPDVNLKIFASLID 1702
            V V +L P  S  R Y+ T+A V+FP++ + +L  L+ D+ S LY++ D   K  ASLID
Sbjct: 875  VSVWRLLPLKSGSRDYLVTVAAVFFPTEHLDELARLVADNTSSLYSSYDETGKTMASLID 934

Query: 1703 PTIKVR-IIQHDRSNPRPAQG---GGTSGSDGYSPSGYAN---HGDGSLDNS------KS 1749
            P I +  II    S+P   +    G  +   G  P G+A    +G G L N+       S
Sbjct: 935  PMIPLTGIINSISSDPASGESSATGTNTPKSGSVPVGFAGTLANGGGRLGNAGSKSLDSS 994

Query: 1750 PKITFKIT 1757
            P    KIT
Sbjct: 995  PMSKLKIT 1002

>CAGL0F08833g Chr6 (873849..876659) [2811 bp, 936 aa] {ON} weakly
            similar to uniprot|P32334 Saccharomyces cerevisiae
            YGR014w MSB2 multicopy suppressor of a CDC24 bud
            emergence defect
          Length = 936

 Score = 55.1 bits (131), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/90 (38%), Positives = 51/90 (56%), Gaps = 6/90 (6%)

Query: 1498 WLPATII---TESVQQHLPNAASTTGGVSTTLLPAAIHPQSLVEG-SDGYDLISIGFLKG 1553
            W+P ++I   TE+  +  P  ++   G   + LP  I+  +  E   +GY +I+IGF K 
Sbjct: 591  WIPTSLIIAPTETESESTPTESN--DGTQLSSLPKVIYGSAYSESVPEGYSVITIGFKKP 648

Query: 1554 LNYVFVTSFALSSAQIFTFLPPVLTYPFES 1583
            LNY FV S + SSAQI  +LP +L   FES
Sbjct: 649  LNYPFVVSESKSSAQIMYYLPKLLNANFES 678

 Score = 37.4 bits (85), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 40/69 (57%), Gaps = 1/69 (1%)

Query: 1640 LSFVKVKQLAPDVSEERGYIATLAHVYFPSKLVPKLQELILDSESPLYNNP-DVNLKIFA 1698
             S +K  QL P   ++ GY++T+A ++FP+  +  L  ++ ++ S LY+   +   +  +
Sbjct: 680  FSDIKTVQLMPLEIQDSGYLSTVALLFFPTSEIQSLSNMVKNTSSSLYSTQYETITQSLS 739

Query: 1699 SLIDPTIKV 1707
            +LIDP I V
Sbjct: 740  ALIDPRIPV 748

>TBLA0G01210 Chr7 (321555..327032) [5478 bp, 1825 aa] {ON} Anc_4.150
            YGR014W
          Length = 1825

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 43/89 (48%), Gaps = 15/89 (16%)

Query: 1498 WLPATIITESVQQHLPNAASTTGGVSTTLLPAAIHPQSL--VE---GSDGYDLISIGFLK 1552
            W+P ++            AST     T+ LP    PQ++  VE     + + LI+IGF K
Sbjct: 1498 WIPTSLA----------VASTMNSTDTSTLPTQAIPQAIGSVEQPPAPENHSLITIGFKK 1547

Query: 1553 GLNYVFVTSFALSSAQIFTFLPPVLTYPF 1581
             LNY FV S  +S AQI  +LP  L   F
Sbjct: 1548 ELNYEFVVSHPMSGAQIINYLPNTLVNAF 1576

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 51/110 (46%), Gaps = 6/110 (5%)

Query: 1643 VKVKQLAPDVSEERGYIATLAHVYFPSKLVPKLQELILDSESPLYNNPDVNLKIFASLID 1702
            + V  L P    +  Y+ T+A VYFP+  +  L+ELI D  S  Y       +  A+L+D
Sbjct: 1583 ISVNNLVPYNDTKSDYLITIATVYFPTDEIKHLRELIHDKSSSFYTASQDVARQLANLVD 1642

Query: 1703 PTIKVRIIQHDRSNPRPAQGGGTSGSDGYSPSGYANHGDGSLDNSKSPKI 1752
            P+I +  +              T+ ++ YSP    + G G+LD S   K+
Sbjct: 1643 PSIPLTGLN------LFGNSDDTNNNNPYSPDNSNSEGIGTLDVSPINKV 1686

>NDAI0F01450 Chr6 (358291..360354) [2064 bp, 687 aa] {ON} Anc_6.242
            YPL222W
          Length = 687

 Score = 33.9 bits (76), Expect = 6.7,   Method: Composition-based stats.
 Identities = 23/70 (32%), Positives = 36/70 (51%), Gaps = 1/70 (1%)

Query: 1566 SAQIFTFLPPVLTYPFESHTEETVKIHDPTEKRQLERPPPVSFYSRASRDT-TTLSSFTH 1624
            S+++   L P  T P  S   E ++ HDPT+K ++E+     + S  S  + TT    +H
Sbjct: 16   SSKVIQKLTPDQTIPTISKAIELIENHDPTDKERVEKFHTPRYVSSGSHFSFTTPMKRSH 75

Query: 1625 SQVIAVQKET 1634
             + I V KET
Sbjct: 76   YKPILVSKET 85

>AGR092W Chr7 (908750..910540) [1791 bp, 596 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR109C and
           Non-syntenic homolog of Saccharomyces cerevisiae YNL249C
           (MPA43)
          Length = 596

 Score = 33.1 bits (74), Expect = 9.5,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 37/78 (47%), Gaps = 12/78 (15%)

Query: 130 EPPATFSASSDPIGL------TSTGLPPSTSVADGVGQIVTSTVSSFSGTPDGSFEA--- 180
           EP + F ++ +P+GL       S GL P   V  GV       V +   +PDG+ E+   
Sbjct: 236 EPGSEFRSAGEPVGLLSEAAAASLGLTPRCVVGSGVIDAYAGWVGTVGASPDGARESGGV 295

Query: 181 ---SSNLLSVAQSNTQII 195
              +  L +VA ++T +I
Sbjct: 296 EELAGRLAAVAGTSTCLI 313

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.307    0.122    0.334 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 148,415,226
Number of extensions: 5591024
Number of successful extensions: 34714
Number of sequences better than 10.0: 462
Number of HSP's gapped: 34328
Number of HSP's successfully gapped: 1220
Length of query: 2338
Length of database: 53,481,399
Length adjustment: 126
Effective length of query: 2212
Effective length of database: 39,033,483
Effective search space: 86342064396
Effective search space used: 86342064396
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 74 (33.1 bits)