Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ADR198C5.526ON54954927470.0
ZYRO0D12540g5.526ON5483983473e-34
SAKL0G04906g5.526ON6083563324e-32
Ecym_40615.526ON6634203061e-28
KLTH0G03740g5.526ON6312002811e-25
Kwal_47.186465.526ON6352002765e-25
YML006C (GIS4)5.526ON7741442331e-19
Skud_13.1485.526ON7791042295e-19
CAGL0K07271g5.526ON7761362251e-18
Smik_13.1455.526ON7741172233e-18
Kpol_1023.995.526ON5511082213e-18
TDEL0A039005.526ON6711592214e-18
Suva_13.1565.526ON7721012189e-18
NDAI0C010705.526ON757962135e-17
NCAS0H025505.526ON743952126e-17
KLLA0A01782g5.526ON5281012081e-16
TBLA0D016605.526ON866932046e-16
KAFR0C053905.526ON4551331723e-12
KNAG0B037105.526ON711701671e-11
NCAS0F010805.526ON379861392e-08
NDAI0H015905.526ON371891374e-08
TPHA0K005405.526ON6751361367e-08
KNAG0C032405.526ON32458880.035
Smik_14.631.75ON35088751.4
Suva_16.3943.356ON29855688.4
NOTE: 1 genes in the same pillar as ADR198C were not hit in these BLAST results
LIST: TBLA0G00940

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADR198C
         (549 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADR198C Chr4 complement(1046482..1048131) [1650 bp, 549 aa] {ON}...  1062   0.0  
ZYRO0D12540g Chr4 (1059795..1061441) [1647 bp, 548 aa] {ON} some...   138   3e-34
SAKL0G04906g Chr7 (403654..405480) [1827 bp, 608 aa] {ON} some s...   132   4e-32
Ecym_4061 Chr4 (133342..135333) [1992 bp, 663 aa] {ON} similar t...   122   1e-28
KLTH0G03740g Chr7 (295985..297880) [1896 bp, 631 aa] {ON} simila...   112   1e-25
Kwal_47.18646 s47 complement(909622..911529) [1908 bp, 635 aa] {...   110   5e-25
YML006C Chr13 complement(256092..258416) [2325 bp, 774 aa] {ON} ...    94   1e-19
Skud_13.148 Chr13 complement(242351..244690) [2340 bp, 779 aa] {...    93   5e-19
CAGL0K07271g Chr11 complement(712294..714624) [2331 bp, 776 aa] ...    91   1e-18
Smik_13.145 Chr13 complement(244766..247090) [2325 bp, 774 aa] {...    91   3e-18
Kpol_1023.99 s1023 complement(232194..233849) [1656 bp, 551 aa] ...    90   3e-18
TDEL0A03900 Chr1 (698940..700955) [2016 bp, 671 aa] {ON} Anc_5.5...    90   4e-18
Suva_13.156 Chr13 complement(246662..248980) [2319 bp, 772 aa] {...    89   9e-18
NDAI0C01070 Chr3 complement(209024..211297) [2274 bp, 757 aa] {O...    87   5e-17
NCAS0H02550 Chr8 (506755..508986) [2232 bp, 743 aa] {ON} Anc_5.5...    86   6e-17
KLLA0A01782g Chr1 complement(157216..158802) [1587 bp, 528 aa] {...    85   1e-16
TBLA0D01660 Chr4 complement(409692..412292) [2601 bp, 866 aa] {O...    83   6e-16
KAFR0C05390 Chr3 (1080797..1082164) [1368 bp, 455 aa] {ON} Anc_5...    71   3e-12
KNAG0B03710 Chr2 complement(710003..712138) [2136 bp, 711 aa] {O...    69   1e-11
NCAS0F01080 Chr6 (214243..215382) [1140 bp, 379 aa] {ON} Anc_5.5...    58   2e-08
NDAI0H01590 Chr8 (385963..387078) [1116 bp, 371 aa] {ON}               57   4e-08
TPHA0K00540 Chr11 complement(107389..109416) [2028 bp, 675 aa] {...    57   7e-08
KNAG0C03240 Chr3 complement(634593..635567) [975 bp, 324 aa] {ON}      39   0.035
Smik_14.63 Chr14 complement(100051..101103) [1053 bp, 350 aa] {O...    33   1.4  
Suva_16.394 Chr16 (688088..688984) [897 bp, 298 aa] {ON} YPR066W...    31   8.4  

>ADR198C Chr4 complement(1046482..1048131) [1650 bp, 549 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML006C
           (GIS4)
          Length = 549

 Score = 1062 bits (2747), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 515/549 (93%), Positives = 515/549 (93%)

Query: 1   MLQDYHGLWSWYLGNLRKGRFEQLVGDEARYSQLKAFLRDCFAHSTGQERRLQLLSFPAS 60
           MLQDYHGLWSWYLGNLRKGRFEQLVGDEARYSQLKAFLRDCFAHSTGQERRLQLLSFPAS
Sbjct: 1   MLQDYHGLWSWYLGNLRKGRFEQLVGDEARYSQLKAFLRDCFAHSTGQERRLQLLSFPAS 60

Query: 61  VPCDYKILEEFIRQQGNISVAIPRVHATGTEKHYLVDGNYMVHALEGCNLALTENEPFYT 120
           VPCDYKILEEFIRQQGNISVAIPRVHATGTEKHYLVDGNYMVHALEGCNLALTENEPFYT
Sbjct: 61  VPCDYKILEEFIRQQGNISVAIPRVHATGTEKHYLVDGNYMVHALEGCNLALTENEPFYT 120

Query: 121 DSMSIEERSEIVSGMSLVFDFKPRFEHSTSNPXXXXXXXXXXXXXXXXXDAAFSGLDDMS 180
           DSMSIEERSEIVSGMSLVFDFKPRFEHSTSNP                 DAAFSGLDDMS
Sbjct: 121 DSMSIEERSEIVSGMSLVFDFKPRFEHSTSNPVHSMRSSSSEMHSGSVRDAAFSGLDDMS 180

Query: 181 IRSNESCESFSGQELVRVLTHEGDSQEYQCDSTETRIFRESYSDISSLSQFSNHSVFPSL 240
           IRSNESCESFSGQELVRVLTHEGDSQEYQCDSTETRIFRESYSDISSLSQFSNHSVFPSL
Sbjct: 181 IRSNESCESFSGQELVRVLTHEGDSQEYQCDSTETRIFRESYSDISSLSQFSNHSVFPSL 240

Query: 241 SITNDFSKFRVVLQSILVYDCEKDRINTAVRQYNNNPNIANCSDDCLLYDNKISLITFRI 300
           SITNDFSKFRVVLQSILVYDCEKDRINTAVRQYNNNPNIANCSDDCLLYDNKISLITFRI
Sbjct: 241 SITNDFSKFRVVLQSILVYDCEKDRINTAVRQYNNNPNIANCSDDCLLYDNKISLITFRI 300

Query: 301 LSLVDLMELNRAHPKMLFYSVAEIFNSSPRCSAAGCCAQVHHSQPQLLQRNSFSASTLSR 360
           LSLVDLMELNRAHPKMLFYSVAEIFNSSPRCSAAGCCAQVHHSQPQLLQRNSFSASTLSR
Sbjct: 301 LSLVDLMELNRAHPKMLFYSVAEIFNSSPRCSAAGCCAQVHHSQPQLLQRNSFSASTLSR 360

Query: 361 HSLRLLPTVTSANTIERHVRTDVADKGKIPNSPAFCWQKSVDYTEYYQDQLFTRELGLAH 420
           HSLRLLPTVTSANTIERHVRTDVADKGKIPNSPAFCWQKSVDYTEYYQDQLFTRELGLAH
Sbjct: 361 HSLRLLPTVTSANTIERHVRTDVADKGKIPNSPAFCWQKSVDYTEYYQDQLFTRELGLAH 420

Query: 421 XXXXXXXXXXXXXXXXXLLPTDSKAVNPIQLSRHVTPVIFSSIQASADVDFEMRASVATK 480
                            LLPTDSKAVNPIQLSRHVTPVIFSSIQASADVDFEMRASVATK
Sbjct: 421 NPSYSSRSSNSEQPSERLLPTDSKAVNPIQLSRHVTPVIFSSIQASADVDFEMRASVATK 480

Query: 481 ASSRSGLDKISTRGSFSTARQINTDTLPTLLHSISHRKYGLSKPQIGKTLKHKWQRWSSS 540
           ASSRSGLDKISTRGSFSTARQINTDTLPTLLHSISHRKYGLSKPQIGKTLKHKWQRWSSS
Sbjct: 481 ASSRSGLDKISTRGSFSTARQINTDTLPTLLHSISHRKYGLSKPQIGKTLKHKWQRWSSS 540

Query: 541 QGHMTCLIM 549
           QGHMTCLIM
Sbjct: 541 QGHMTCLIM 549

>ZYRO0D12540g Chr4 (1059795..1061441) [1647 bp, 548 aa] {ON} some
           similarities with uniprot|Q04233 Saccharomyces
           cerevisiae YML006C GIS4 CAAX box containing protein of
           unknown function proposed to be involved in the RAS/cAMP
           signaling pathway
          Length = 548

 Score =  138 bits (347), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 119/398 (29%), Positives = 183/398 (45%), Gaps = 62/398 (15%)

Query: 3   QDYHGLWSWYLGNLRKGRFEQLVGDEARYSQLKAFLRDCFAHSTGQERR---LQLLSFPA 59
            D +GLWSWYL N+R G FE+L  ++ ++S  K FLR  +   T  ER+   + ++S P 
Sbjct: 13  NDDNGLWSWYLTNIRNGDFEELTRNQLKHSLFKRFLR-TYLEPTLNERKDTKVLIVSIPE 71

Query: 60  SVPCDYKILEEFIRQQGNI-SVAIPRVHAT---GTEKHYLV--------DGNYMVHA--- 104
            V  D  +LE F+    N+ ++ I ++  +     E HY+V        + N++  A   
Sbjct: 72  DVRRDITLLEYFLGDYLNLDNMEITKLTTSRIYNHENHYVVMDKENNFKNSNFLHFASTN 131

Query: 105 ------LEGCNLALTENEPFYTDSMSIEERSEIVSGM-------------SLVFDFKPRF 145
                   G  LA T        ++S  E ++  +G              SLVF+F  R 
Sbjct: 132 IQTGKGFTGGELAGTTVAAQAEKNISPTESAKFRAGQGLEPSDDTEGDEESLVFNFTHRD 191

Query: 146 EHSTS---------------NPXXXXXXXXXXXXXXXXXDAAFSGLDDMSIRSNES--CE 188
            H T                +P                 D   S +D  ++ SN S   E
Sbjct: 192 HHLTHPLRANGKEQEEAVGVSPSWNPQQQQRLQEHNASNDEMAS-IDSYNLGSNSSRVVE 250

Query: 189 SFSGQELVRVLTHEGD---SQEYQCDSTETRIFRESYSDISSLSQFSNHSVFPSLSITND 245
           SF G+ L   +T   D   S EY   ++         +D+SS    S  S+ PS+SI + 
Sbjct: 251 SFKGEPLTLTMTRTEDFSSSDEYDSLASSPSSSD---TDLSSFESCSLMSILPSISIADS 307

Query: 246 FSKFRVVLQSILVYDCEKDRINTAVRQYNNNPNIANCSDDCLLYDNKISLITFRILSLVD 305
           F  FR+VLQS+L  +   + I TA+RQ NN P  A+  DD LLYD++ S+   ++L+L D
Sbjct: 308 FGHFRLVLQSVLFINPTSNEIFTAIRQSNNKPTKADVDDDWLLYDSQFSMHNLQMLTLQD 367

Query: 306 LMELNRAHPKMLFYSVAEIFNSSPRCSAAGCCAQVHHS 343
           L ELN+  PK+LFYS+ E+ ++     A   CA + ++
Sbjct: 368 LSELNKGCPKVLFYSLVEVVDTPSLEDADTECATISNT 405

>SAKL0G04906g Chr7 (403654..405480) [1827 bp, 608 aa] {ON} some
           similarities with uniprot|Q04233 Saccharomyces
           cerevisiae YML006C GIS4 CAAX box containing protein of
           unknown function proposed to be involved in the RAS/cAMP
           signaling pathway
          Length = 608

 Score =  132 bits (332), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 114/356 (32%), Positives = 177/356 (49%), Gaps = 33/356 (9%)

Query: 177 DDMSIRSNESCESFSGQELVRVLTHEGDSQEYQCD--------STETRIFRESY-SDISS 227
           +D+SI S E   S+ G+ L++ +T + D+     D        S +  +   SY SDISS
Sbjct: 233 EDVSINS-EDASSYDGEALIQTITRDEDASSADEDNSNISELSSVDHSLNSLSYNSDISS 291

Query: 228 LSQFSNHSVFPSLSITNDFSKFRVVLQSILVYDCEKDRINTAVRQYNNNPNIANCSDDCL 287
              +S  S+FP++SI++ F  FR+VLQSIL+ + +   I TAVRQ NN+PN+A+ +DD L
Sbjct: 292 -DDYSMASIFPAISISDTFGTFRLVLQSILIQNPDTREIFTAVRQSNNDPNVAHINDDWL 350

Query: 288 LYDNKISLITFRILSLVDLMELNRAHPKMLFYSVAEIFNSSPRCSAAGCCAQVHHSQPQL 347
           LYD K S+   ++LSL D++E+NR  PK+LFY++  +        A        H  P  
Sbjct: 351 LYDEKFSMHNLQMLSLHDVLEINRFFPKILFYTMVMLDTEEIADEAHAYIPNDPHLPPP- 409

Query: 348 LQRNSFSASTLSRHSLRLLPTVTSANTIERHVRTDVADKGKIPNSPAFCWQKSVDY-TEY 406
             +   S STLS+++LRLLPT TS  T  RH         ++ N+ A   Q + +Y  E 
Sbjct: 410 -SQGIASTSTLSQNTLRLLPTATSNVTYTRH--------NELLNAAATSAQDAENYFPED 460

Query: 407 YQDQLFTREL-GLAHXXXXXXXXXXXXXXXXXLLPTDSKAV------NPIQLSRHVTPVI 459
             D    +E+ G+                   +L  +S          P   + H + + 
Sbjct: 461 NHDDEDDQEVNGVMPLYAPTRTNSNSTTAHRSILTVNSIGEWAFHHNEPYPQNNH-SNIS 519

Query: 460 FSSIQASADVDFEMRASVATKASSRSGLDKISTRGSFSTARQINTDTLPTLLHSIS 515
           F+    S     +    V++K SS++ L K +T GS S   +  +  LPTLL ++S
Sbjct: 520 FADQNTSTAGKMK---RVSSKGSSKNTLQKTTTVGSLSAVERSKSTPLPTLLRTLS 572

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 36/104 (34%), Positives = 57/104 (54%), Gaps = 8/104 (7%)

Query: 4   DYHGLWSWYLGNLRKGRFEQLVGDEARYSQLKAFLRDCFAHSTGQ-ERRLQLLSFPASVP 62
           DY+GLWSWYL NLR G FE+L  +  +++ LK FL +       Q  +++ L+S P ++ 
Sbjct: 14  DYNGLWSWYLSNLRDGHFEELTNNVLKFTLLKRFLNEHLMQDIVQFNKKMLLVSIPDNIH 73

Query: 63  CDYKILEEFIRQQGNIS----VAIPRVHAT---GTEKHYLVDGN 99
            D  ILE F+R   ++     + I ++  +     E HYL+  N
Sbjct: 74  QDITILENFLRSYFHLDDLQYIQIKKLTDSQIYNHENHYLISDN 117

>Ecym_4061 Chr4 (133342..135333) [1992 bp, 663 aa] {ON} similar to
           Ashbya gossypii ADR198C
          Length = 663

 Score =  122 bits (306), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 120/420 (28%), Positives = 194/420 (46%), Gaps = 66/420 (15%)

Query: 177 DDMSIRSNESCESFSGQELVRVLTHEGDSQEYQCDSTETRIFRESYSDISSLSQFSNH-- 234
           +++SIRS+ES +S+ G+ L R LT E +  +  C  TE R   E Y++  S S+ S+   
Sbjct: 263 EEVSIRSSESYQSYDGEVLARTLTRE-EHIQGSCCPTEHR-HEELYNEGDSTSELSSACN 320

Query: 235 ------SVFPSLSITNDFSKFRVVLQSILVYDCEKDRINTAVRQYNNNPNIANCSDDCLL 288
                 S+FPS+SI+ D   FR+VLQSIL+Y+   D++ TAVRQ NN+  +A+ +DD LL
Sbjct: 321 SVSSDCSIFPSISISGDEGDFRIVLQSILIYNTTLDQLLTAVRQSNNDTTVADINDDWLL 380

Query: 289 YDNKISLITFRILSLVDLMELNRAHPKMLFYSVAEIFNSSPRCSAAGCCAQVHHSQPQLL 348
           YD + S+   +++SL+D+ E+N   PK+LFYSV  I  ++     A  CA++        
Sbjct: 381 YDERFSMNNIQMVSLIDIFEMNGVFPKILFYSVVAIPCNNTASKEANSCAEIGKK----- 435

Query: 349 QRNSFSASTLSRHSLRLLPTVTSANTIERHVRTDVADKGKIPNSPAFCWQKSVDYTEYY- 407
                +AS +S      + +  S NT+ +   T  AD   +   P      S +  E+  
Sbjct: 436 -----NASNIS----NWIYSCISQNTLSQQATT--ADSAFVFGGPRHYRWHSSEREEHEP 484

Query: 408 ---QDQLFTRELGLAHXXXXXXXXXXXXXXXXXLLPTDSKAVN-----------PIQLSR 453
                    RE   A                   LP  SKA +            +  +R
Sbjct: 485 LAGDGDSVHREGNRASPLTSGAEIVTNNIPMLSTLPVHSKAFSRTGSVSEPTKTRVNSNR 544

Query: 454 HV------TPVIFSSIQASADVDFEMRAS-VATKASSRSGLDKISTRGSFSTA--RQINT 504
            +      + +  S  + S D +   R+  + +K  S++GL KIS+ GS S A   ++ +
Sbjct: 545 EIHKCESHSSITESRRKLSDDNEDMFRSKYIISKNPSKNGLTKISSLGSLSLAHRERMFS 604

Query: 505 DTLPTLLHSISHRKYG-----LSKPQIGKTLKHKWQRW----------SSSQGHMTCLIM 549
            +LP +LH++ +  Y      L+ P+  K     W+R              QG + C +M
Sbjct: 605 CSLPGMLHTVFNGTYASDEHPLAVPR-KKVRMPSWRRLHKQSCGKQSCGKRQGFVCCAVM 663

 Score = 68.2 bits (165), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 60/126 (47%), Gaps = 13/126 (10%)

Query: 1   MLQDYHGLWSWYLGNLRKGRFEQLVGDEARYSQLKAFLRDCFAHSTGQERRLQLLSFPAS 60
           +L D +GLWSWYL NLR G FE+L  D  +   +K  +++    +     R+ L+S P  
Sbjct: 8   LLDDCNGLWSWYLHNLRCGEFEELSSDIVKCRLMKRLVKEYSGGTMSASNRVLLVSVPDD 67

Query: 61  VPCDYKILEEFIR---------QQGNISVAIPRVHATGTEKHYLVDGNYMVHALEGCNLA 111
           +     ILEEF+R         + GNI+    R      E HYL+  N     + G  + 
Sbjct: 68  IRQGASILEEFLRSSLPGMREVRDGNITKLTGRKDLLNGEDHYLI--NDTKGGVAG--VG 123

Query: 112 LTENEP 117
           LT N P
Sbjct: 124 LTANRP 129

>KLTH0G03740g Chr7 (295985..297880) [1896 bp, 631 aa] {ON} similar
           to uniprot|Q04233 Saccharomyces cerevisiae YML006C GIS4
           CAAX box containing protein of unknown function proposed
           to be involved in the RAS/cAMP signaling pathway
          Length = 631

 Score =  112 bits (281), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 71/200 (35%), Positives = 118/200 (59%), Gaps = 14/200 (7%)

Query: 179 MSIRSNESCESFSGQELVRVLTHEGDSQEYQCDS---TETRIFRESYSDISSLSQFSNHS 235
           +S+RS++   S+ G+ L + +T + DS     +    +E      S   +S  S++S  S
Sbjct: 256 VSLRSDD-VSSYDGEVLTQTITRDEDSVSLMIEDDSISELSSVDHSLKSLSYDSEYSQGS 314

Query: 236 -----VFPSLSITNDFSKFRVVLQSILVYDCEKDRINTAVRQYNNNPNIANCSDDCLLYD 290
                +FPS+SI+  F +FR+VLQSILV+  +  ++ TAVRQ NN+P +A+ +DD LLYD
Sbjct: 315 SSLTSIFPSISISEKFGRFRLVLQSILVHQPDTRQLFTAVRQSNNDPTVAHVNDDWLLYD 374

Query: 291 NKISLITFRILSLVDLMELNRAHPKMLFYSVAEIFNSSPRCSAAGCCAQVHHSQPQLLQR 350
           +K S+   +IL+L D++E+N+  PK+LFYS+  I         A      + S+P    +
Sbjct: 375 DKFSMNNLQILALHDVLEMNKFFPKILFYSLVMI-----SEEVAADAQDYYPSKPSKSPQ 429

Query: 351 NSFSASTLSRHSLRLLPTVT 370
            + S ST+S ++L++ PT+T
Sbjct: 430 PTASNSTISENTLKVQPTLT 449

 Score = 60.8 bits (146), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 56/101 (55%), Gaps = 8/101 (7%)

Query: 4   DYHGLWSWYLGNLRKGRFEQLVGDEARYSQLKAFLRD-CFAHSTGQERRLQLLSFPASVP 62
           D +GLWSWYL NLR G FE+L  ++ +++ L+ FL +   + S    ++L L+S P ++ 
Sbjct: 15  DENGLWSWYLCNLRHGNFEELNNNQLKFALLRRFLNEQLLSDSVLFNKKLLLVSIPDAIH 74

Query: 63  CDYKILEEFIRQQGNIS----VAIPRV---HATGTEKHYLV 96
            +  +LE F+R   N+     + I ++        E HYL+
Sbjct: 75  ENTNLLENFLRDYFNLDDLQFIQIQKLTQDRCYNHENHYLI 115

 Score = 31.6 bits (70), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 26/40 (65%)

Query: 477 VATKASSRSGLDKISTRGSFSTARQINTDTLPTLLHSISH 516
           V +K+S +SGL K  T GS ST  +  +  LP++L S+S+
Sbjct: 559 VRSKSSVKSGLTKTLTLGSLSTVERSKSVPLPSVLKSLSN 598

>Kwal_47.18646 s47 complement(909622..911529) [1908 bp, 635 aa] {ON}
           YML006C (GIS4) - CAAX box containing protein [contig
           191] FULL
          Length = 635

 Score =  110 bits (276), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 71/200 (35%), Positives = 110/200 (55%), Gaps = 14/200 (7%)

Query: 179 MSIRSNESCESFSGQELVRVLTHEGDSQEYQCD--------STETRIFRESYSDISSLSQ 230
           MS+RS E   S+ G+EL  + + + DS     D        S +  +   SY    +   
Sbjct: 256 MSLRS-EDVSSYDGEELAHIASRDEDSASLSADEDNISELSSVDHSLNSLSYDSECTPGS 314

Query: 231 FSNHSVFPSLSITNDFSKFRVVLQSILVYDCEKDRINTAVRQYNNNPNIANCSDDCLLYD 290
            S  S+FPS+SI+  F +FR+VLQSIL+   +  ++ TAVRQ NN+P +A+ +DD LLYD
Sbjct: 315 SSMTSIFPSISISEKFGRFRLVLQSILIQQTDTRQLYTAVRQSNNDPTVAHVNDDWLLYD 374

Query: 291 NKISLITFRILSLVDLMELNRAHPKMLFYSVAEIFNSSPRCSAAGCCAQVHHSQPQLLQR 350
           +K S+   +IL+L D++E+N+  PK+LFYS+  +        A        H  P+    
Sbjct: 375 DKFSMNNLQILALHDVLEINKFFPKVLFYSLI-VVTDEVAIDAQEYYPSASHQSPE---- 429

Query: 351 NSFSASTLSRHSLRLLPTVT 370
            + S S LS ++L+L  T+T
Sbjct: 430 RTVSTSLLSENTLKLQTTLT 449

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 4  DYHGLWSWYLGNLRKGRFEQLVGDEARYSQLKAFLRD-CFAHSTGQERRLQLLSFPASVP 62
          D +GLWSWYL NLR G FE+L  ++ + + L+ FL +   + +    ++L L+S P ++ 
Sbjct: 15 DENGLWSWYLCNLRHGNFEELNNNQLKSALLRRFLNEQLMSETVPFNKKLLLVSIPDAIH 74

Query: 63 CDYKILEEFIR 73
           +  +LE F+R
Sbjct: 75 ENTNLLENFLR 85

>YML006C Chr13 complement(256092..258416) [2325 bp, 774 aa] {ON}
           GIS4CAAX box containing protein of unknown function,
           proposed to be involved in the RAS/cAMP signaling
           pathway
          Length = 774

 Score = 94.4 bits (233), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 85/144 (59%), Gaps = 4/144 (2%)

Query: 189 SFSGQELVRVLTHEGDSQEYQCDSTETRIFRESYSDIS-SLSQFSNHSVFPSLSITNDFS 247
           S + +E   ++ H  D+Q Y     +     E Y D   S S +S  S+ PS+SI +   
Sbjct: 391 STTPEEEDNLIHHNYDAQGYGSGEDDGE---EVYDDEDLSSSDYSVLSILPSISICDSLG 447

Query: 248 KFRVVLQSILVYDCEKDRINTAVRQYNNNPNIANCSDDCLLYDNKISLITFRILSLVDLM 307
            FR+VLQSIL+ D +   I TA+RQ NN P +A+ +DD LLYD+  S+   +IL+L DL+
Sbjct: 448 YFRLVLQSILIQDPDTKEIFTAIRQSNNKPTMASVTDDWLLYDSNFSMNNLQILTLQDLL 507

Query: 308 ELNRAHPKMLFYSVAEIFNSSPRC 331
           ++ R+ PK+LFY++  + NS  + 
Sbjct: 508 DIKRSFPKILFYTMVIVTNSGKQV 531

 Score = 68.2 bits (165), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 59/107 (55%), Gaps = 11/107 (10%)

Query: 4   DYHGLWSWYLGNLRKGRFEQLVGDEARYSQLKAFLRDCFAH----STGQERRLQLLSFPA 59
           D +GLWSWYL NLR G FE+L+G++ +Y+ LK FL   F      S    +++ L+S P 
Sbjct: 14  DDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNNISARPNKKILLVSIPE 73

Query: 60  SVPCDYKILEEFIRQQGNIS----VAIPRV---HATGTEKHYLVDGN 99
           +V  D  ILE F++   ++     + I ++   H    E HYL+  N
Sbjct: 74  NVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDN 120

>Skud_13.148 Chr13 complement(242351..244690) [2340 bp, 779 aa] {ON}
           YML006C (REAL)
          Length = 779

 Score = 92.8 bits (229), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 72/104 (69%), Gaps = 1/104 (0%)

Query: 224 DISSLSQFSNHSVFPSLSITNDFSKFRVVLQSILVYDCEKDRINTAVRQYNNNPNIANCS 283
           DISS S +S  S+ PS+SI +    FR+VLQSIL+ D +   I TA+RQ NN P +A+ +
Sbjct: 432 DISS-SDYSVLSILPSISICDSLGYFRLVLQSILIQDPDTKEIFTAIRQSNNKPTMASVT 490

Query: 284 DDCLLYDNKISLITFRILSLVDLMELNRAHPKMLFYSVAEIFNS 327
           DD LLYD+  S+   +IL+L DL+++ R+ PK+LFY++  + +S
Sbjct: 491 DDWLLYDSNFSMNNLQILTLQDLLDIKRSFPKILFYTMVIVTDS 534

 Score = 67.8 bits (164), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 59/108 (54%), Gaps = 11/108 (10%)

Query: 3   QDYHGLWSWYLGNLRKGRFEQLVGDEARYSQLKAFLRDCF----AHSTGQERRLQLLSFP 58
            D +GLWSWYL NLR G FE+L+G++ +Y+ LK FL   F      S    +++ L+S P
Sbjct: 13  NDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDYNTSARPNKKILLVSIP 72

Query: 59  ASVPCDYKILEEFIRQQGNIS----VAIPRV---HATGTEKHYLVDGN 99
            +V  D  ILE F++   ++     + I ++   H    E HYL+  N
Sbjct: 73  ENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDN 120

>CAGL0K07271g Chr11 complement(712294..714624) [2331 bp, 776 aa]
           {ON} similar to uniprot|Q04233 Saccharomyces cerevisiae
           YML006c
          Length = 776

 Score = 91.3 bits (225), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 53/136 (38%), Positives = 82/136 (60%), Gaps = 11/136 (8%)

Query: 189 SFSGQELVRVLTHEGDSQEYQCDSTETRIFRESYSDISSLSQFSNHSVFPSLSITNDFSK 248
           SFS  E   + + + +S++ + D      +  S SDI+ LS      + PS+SI +    
Sbjct: 418 SFSDNESESMYSSDLESEDGEMDH-----YNASGSDITLLS------ILPSISIFDTLGY 466

Query: 249 FRVVLQSILVYDCEKDRINTAVRQYNNNPNIANCSDDCLLYDNKISLITFRILSLVDLME 308
           FR+VLQSIL+ D +   + TAVRQ NN P IA+ +DD LLYD + S+   +IL+L D+M 
Sbjct: 467 FRLVLQSILIQDPQTKEVFTAVRQSNNKPTIADITDDWLLYDAEFSMHNLQILTLQDIMT 526

Query: 309 LNRAHPKMLFYSVAEI 324
           + + +PK+LFY++  I
Sbjct: 527 IKKDYPKILFYTMVVI 542

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 43/77 (55%), Gaps = 7/77 (9%)

Query: 4  DYHGLWSWYLGNLRKGRFEQLVGDEARYSQLKAFLRDCFAHSTGQE-------RRLQLLS 56
          D +G+WSWYL NLR G FE+++ ++ +Y+ LK FL      +   E       ++L  +S
Sbjct: 14 DENGVWSWYLSNLRSGDFEEIIENKLKYTLLKRFLNSNLLGNFSPESPTRFINKKLIFVS 73

Query: 57 FPASVPCDYKILEEFIR 73
           P  V  D  ILE F+R
Sbjct: 74 IPEDVHQDISILELFLR 90

>Smik_13.145 Chr13 complement(244766..247090) [2325 bp, 774 aa] {ON}
           YML006C (REAL)
          Length = 774

 Score = 90.5 bits (223), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 70/117 (59%), Gaps = 6/117 (5%)

Query: 235 SVFPSLSITNDFSKFRVVLQSILVYDCEKDRINTAVRQYNNNPNIANCSDDCLLYDNKIS 294
           S+ PS+SI +    FR+VLQSIL+ D +   I TA+RQ NN P IA+ +DD LLYD+  S
Sbjct: 438 SILPSISICDSLGYFRLVLQSILIQDPDTKEIFTAIRQSNNRPTIASVTDDWLLYDSNFS 497

Query: 295 LITFRILSLVDLMELNRAHPKMLFYSVAEIFNSS------PRCSAAGCCAQVHHSQP 345
           +   +IL+L DL+++ R+ PK+LFY++  +  S       P+    G    +   QP
Sbjct: 498 MNNLQILTLQDLLDIKRSFPKILFYTMVIVTESGQQIEEEPKNPNYGTREDMLKEQP 554

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 60/107 (56%), Gaps = 11/107 (10%)

Query: 4   DYHGLWSWYLGNLRKGRFEQLVGDEARYSQLKAFLRDCF----AHSTGQERRLQLLSFPA 59
           D +GLWSWYL NLR G FE+L+G++ +Y+ LK FL   F    + S    +++ L+S P 
Sbjct: 14  DDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNSISVRSNKKILLVSIPE 73

Query: 60  SVPCDYKILEEFIRQQGNIS----VAIPRV---HATGTEKHYLVDGN 99
           +V  D  ILE F++   ++     + I ++   H    E HYL+  N
Sbjct: 74  NVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDN 120

>Kpol_1023.99 s1023 complement(232194..233849) [1656 bp, 551 aa]
           {ON} complement(232194..233849) [1656 nt, 552 aa]
          Length = 551

 Score = 89.7 bits (221), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 42/108 (38%), Positives = 72/108 (66%)

Query: 234 HSVFPSLSITNDFSKFRVVLQSILVYDCEKDRINTAVRQYNNNPNIANCSDDCLLYDNKI 293
           ++V P++++ + ++ F++VLQSIL+Y+ + D + TA+RQ NN  + A+  DD LLYD+K 
Sbjct: 245 NTVLPTVNLPDPYANFQLVLQSILIYNSDSDELITAIRQSNNEQDSADIDDDWLLYDSKF 304

Query: 294 SLITFRILSLVDLMELNRAHPKMLFYSVAEIFNSSPRCSAAGCCAQVH 341
           S+   +ILSL +L+ +N+ +PK+LFYS+  I N +   S     +  H
Sbjct: 305 SMTNLQILSLNELLHINKDYPKILFYSLVSIPNVTVNISNYENSSNPH 352

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 29/50 (58%)

Query: 8  LWSWYLGNLRKGRFEQLVGDEARYSQLKAFLRDCFAHSTGQERRLQLLSF 57
          +W+WYL ++R G FE+++G+E  Y  LK  L D   +     +  +L+S 
Sbjct: 15 VWTWYLCHVRNGSFEEILGNEDYYKLLKNNLVDDVFNIDKGNKIFKLISI 64

>TDEL0A03900 Chr1 (698940..700955) [2016 bp, 671 aa] {ON} Anc_5.526
           YML006C
          Length = 671

 Score = 89.7 bits (221), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 90/159 (56%), Gaps = 29/159 (18%)

Query: 188 ESFSGQELVRVLTHEGDSQEYQCDSTETRIFRESYSDISSLSQ----------------F 231
           +S+SGQ L    TH  D  +   D ++     E+ S++SS+S+                +
Sbjct: 317 DSYSGQPLALTTTHYKDDTQGSSDDSQ----EENISELSSVSRSMKSLGSQTSLGDNNDY 372

Query: 232 SNHS---------VFPSLSITNDFSKFRVVLQSILVYDCEKDRINTAVRQYNNNPNIANC 282
            N+S         + PS+SI++    +R+V+QS L+ D E   I TA+RQ NN P +A+ 
Sbjct: 373 ENNSDSSDYSVVSILPSISISDARGHYRLVMQSSLLQDPETKEIYTAIRQSNNQPTVADV 432

Query: 283 SDDCLLYDNKISLITFRILSLVDLMELNRAHPKMLFYSV 321
            DD LLYD++ S+   ++L+L +L+++NR+ PK++FYS+
Sbjct: 433 DDDWLLYDSQFSMNNLQMLTLQELLDMNRSFPKIIFYSM 471

 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 41/73 (56%), Gaps = 3/73 (4%)

Query: 4  DYHGLWSWYLGNLRKGRFEQLVGDEARYSQLKAFLRDCFAHST---GQERRLQLLSFPAS 60
          D +GLWSWYL ++R G FE+   ++ + + L+ FL   F  +    GQ  ++  +S P  
Sbjct: 14 DDNGLWSWYLSHIRSGDFEEFSRNKLKVTLLRRFLNSHFDSNRSHYGQNTKILFVSIPDK 73

Query: 61 VPCDYKILEEFIR 73
          V  D  +LE F+R
Sbjct: 74 VHRDLSLLENFLR 86

>Suva_13.156 Chr13 complement(246662..248980) [2319 bp, 772 aa] {ON}
           YML006C (REAL)
          Length = 772

 Score = 88.6 bits (218), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 44/101 (43%), Positives = 68/101 (67%)

Query: 227 SLSQFSNHSVFPSLSITNDFSKFRVVLQSILVYDCEKDRINTAVRQYNNNPNIANCSDDC 286
           S S +S  S+ PS+SI +    FR+VLQSIL+ + +   I TA+RQ NN P +A+ +DD 
Sbjct: 426 SSSDYSILSILPSISICDSLGYFRLVLQSILIQNPDTKEIFTAIRQSNNEPTVASVTDDW 485

Query: 287 LLYDNKISLITFRILSLVDLMELNRAHPKMLFYSVAEIFNS 327
           LLYD+  S+   +IL+L DL+++ R+ PK+L Y++  + NS
Sbjct: 486 LLYDSNFSMNNLQILTLQDLLDIKRSFPKILLYTMVIVTNS 526

 Score = 67.4 bits (163), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 58/105 (55%), Gaps = 11/105 (10%)

Query: 3   QDYHGLWSWYLGNLRKGRFEQLVGDEARYSQLKAFLRDCF----AHSTGQERRLQLLSFP 58
            D +GLWSWYL NLR G FE+L+G++ +Y+ LK FL   F      S    +++ L+S P
Sbjct: 13  NDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNNTSIRPNKKILLVSIP 72

Query: 59  ASVPCDYKILEEFIRQQGNIS----VAIPRV---HATGTEKHYLV 96
            +V  D  ILE F++   ++     + I ++   H    E HYL+
Sbjct: 73  ENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLL 117

>NDAI0C01070 Chr3 complement(209024..211297) [2274 bp, 757 aa] {ON}
           Anc_5.526 YML006C
          Length = 757

 Score = 86.7 bits (213), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 66/96 (68%), Gaps = 1/96 (1%)

Query: 235 SVFPSLSITN-DFSKFRVVLQSILVYDCEKDRINTAVRQYNNNPNIANCSDDCLLYDNKI 293
           S+ PS+SI++ +   FR+VLQS L+ +     I TA+RQ NN P IA+ +DD LLYD+K 
Sbjct: 460 SILPSISISDRNEGHFRLVLQSTLIQNPITKEIFTAIRQSNNEPTIAHITDDWLLYDSKF 519

Query: 294 SLITFRILSLVDLMELNRAHPKMLFYSVAEIFNSSP 329
           ++   +IL+L DL++ NR  PK+LFYS+  +  SSP
Sbjct: 520 AMDNLQILTLQDLLDSNRTFPKILFYSMVIVNESSP 555

 Score = 57.4 bits (137), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 48/90 (53%), Gaps = 20/90 (22%)

Query: 4   DYHGLWSWYLGNLRKGRFEQLVGDEARYSQLKAFLRDCF-AHSTGQE------------- 49
           D +GLWSWYL N+R G FE+L G++ +Y+ LK FL   F +++T  +             
Sbjct: 14  DDNGLWSWYLRNIRLGDFEELTGNQLKYTLLKRFLNSHFYSNATTTDTAIDDNNNTNSVN 73

Query: 50  ------RRLQLLSFPASVPCDYKILEEFIR 73
                 +++ L+S P  V  D  +LE F+R
Sbjct: 74  DIKPTVKKILLVSIPDKVHSDISLLELFLR 103

>NCAS0H02550 Chr8 (506755..508986) [2232 bp, 743 aa] {ON} Anc_5.526
           YML006C
          Length = 743

 Score = 86.3 bits (212), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 64/95 (67%), Gaps = 1/95 (1%)

Query: 229 SQFSNHSVFPSLSITNDF-SKFRVVLQSILVYDCEKDRINTAVRQYNNNPNIANCSDDCL 287
           S +S  S+ PS+SI++     FR+VLQSIL+       I TA+RQ NN P IA+  DD L
Sbjct: 415 SDYSVLSILPSISISDAIEGHFRLVLQSILIQHPVTKEIYTAIRQSNNEPTIADIMDDWL 474

Query: 288 LYDNKISLITFRILSLVDLMELNRAHPKMLFYSVA 322
           LYD++ S+   +IL+L DL++ NR+ PK+LFYS+ 
Sbjct: 475 LYDSQFSMDNLQILTLQDLLDTNRSFPKILFYSMV 509

 Score = 57.4 bits (137), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 59/126 (46%), Gaps = 33/126 (26%)

Query: 4   DYHGLWSWYLGNLRKGRFEQLVGDEARYSQLKAFLR-------DCFAHSTGQE------- 49
           D +GLWSWYL N+R G FE++ G++ +Y+ LK FL        D  A  + Q+       
Sbjct: 14  DDNGLWSWYLTNIRLGDFEEVTGNQLKYTLLKRFLNSHFYSNSDVTATESPQQHNNNNNT 73

Query: 50  ------------RRLQLLSFPASVPCDYKILEEFIRQQGNI----SVAIPRVHAT---GT 90
                       R++ L+S P  V  D  ILE F+R   ++     + I R+  +     
Sbjct: 74  NNNNTQQLKPNFRKILLVSIPDKVHRDLSILETFLRDYFHLEHLEGIQIQRLTQSKCYNH 133

Query: 91  EKHYLV 96
           E HYL+
Sbjct: 134 ENHYLL 139

>KLLA0A01782g Chr1 complement(157216..158802) [1587 bp, 528 aa] {ON}
           some similarities with uniprot|Q04233 Saccharomyces
           cerevisiae YML006C GIS4 CAAX box containing protein of
           unknown function proposed to be involved in the RAS/cAMP
           signaling pathway
          Length = 528

 Score = 84.7 bits (208), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 42/101 (41%), Positives = 58/101 (57%), Gaps = 8/101 (7%)

Query: 4   DYHGLWSWYLGNLRKGRFEQLVGDEARYSQLKAFLRDCFAHSTGQERRLQLLSFPASVPC 63
           DY+GLWSWYL NLR G FE+L G+E ++  LK FLRD F  +    ++L L+S P  +  
Sbjct: 14  DYNGLWSWYLSNLRNGEFEELTGNELKHGLLKRFLRDQFQATGPLNKKLLLVSIPDEIHQ 73

Query: 64  DYKILEEFIRQ-------QGNISV-AIPRVHATGTEKHYLV 96
           D K+LEEF+ +         NI +  + R      E HYL+
Sbjct: 74  DIKVLEEFLSEYFHLKDDHTNIVIDKLTRGTVYKHENHYLI 114

 Score = 72.8 bits (177), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 87/143 (60%), Gaps = 4/143 (2%)

Query: 185 ESCESFSGQELVRVLTHEGDSQEYQCDSTETRIFRESYSDISSLSQFSNHSVFPSLSITN 244
           +  ES+ G+ LV+ +T   D  E   D  +     ES  D+ S     + S+ PS+SI++
Sbjct: 229 DDLESYRGEALVQTVTRAIDEDEEDEDDDDHHHDVESADDMKS----KDISIPPSISISD 284

Query: 245 DFSKFRVVLQSILVYDCEKDRINTAVRQYNNNPNIANCSDDCLLYDNKISLITFRILSLV 304
           +F  FR+VLQSIL+ + E ++I T +RQ  N+ + A+ +DD LLYD   +L   ++LSL 
Sbjct: 285 NFGTFRLVLQSILITNKETEQIFTGIRQSENDRSNADINDDWLLYDTDFNLGNLQMLSLY 344

Query: 305 DLMELNRAHPKMLFYSVAEIFNS 327
           D+++ ++  PK+LFYS+  + +S
Sbjct: 345 DILDFSKFLPKILFYSMIHVKDS 367

>TBLA0D01660 Chr4 complement(409692..412292) [2601 bp, 866 aa] {ON}
           Anc_5.526 YML006C
          Length = 866

 Score = 83.2 bits (204), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 39/93 (41%), Positives = 64/93 (68%)

Query: 236 VFPSLSITNDFSKFRVVLQSILVYDCEKDRINTAVRQYNNNPNIANCSDDCLLYDNKISL 295
           + PS+SI++    FR+VLQ IL+Y    ++  TA+RQ ++N ++A+  DD LLYD K S+
Sbjct: 499 ILPSISISDSLGHFRLVLQCILIYHPHAEKTYTAIRQSDSNRDVADIQDDWLLYDLKFSM 558

Query: 296 ITFRILSLVDLMELNRAHPKMLFYSVAEIFNSS 328
               IL+L +L++ NR +PK+LFY++  I ++S
Sbjct: 559 DNLEILTLQELLDFNRDYPKILFYTLVAINDNS 591

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 43/77 (55%), Gaps = 7/77 (9%)

Query: 4  DYHGLWSWYLGNLRKGRFEQLVGDEARYSQLKAFLRDCFA---HSTGQER----RLQLLS 56
          D +GLWSWYL N+R G FE+L  +  + + LK FL++ F    +ST Q      ++   S
Sbjct: 18 DNNGLWSWYLSNIRNGMFEELTENILKITLLKRFLKENFQQDINSTSQHSTNCTKILFTS 77

Query: 57 FPASVPCDYKILEEFIR 73
           P ++  D  ILE  ++
Sbjct: 78 IPDNIHQDLPILENLLK 94

>KAFR0C05390 Chr3 (1080797..1082164) [1368 bp, 455 aa] {ON}
           Anc_5.526 YML006C
          Length = 455

 Score = 70.9 bits (172), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 73/133 (54%), Gaps = 14/133 (10%)

Query: 201 HEGDSQEYQCDSTETRIFRESYSDISSLSQF-----SNHSVFPSLSITND-FSKFRVVLQ 254
           HE D+ +Y+        + E Y D  S  Q      SN S+ P +SI N+    +R+VLQ
Sbjct: 219 HENDNADYET-------YSEDYFDDDSEFQNYSISESNCSILPCVSINNEAIGHYRLVLQ 271

Query: 255 SILVYDCEKDRINTAVRQYNNNPNIANCSDDCLLYDNKISLITFRILSLVDLMEL-NRAH 313
           S+L+ + E   + T VRQ NN  N AN +DD +LYD K S+    ILSL DL  + N   
Sbjct: 272 SMLICNKENLDLQTGVRQSNNLINYANINDDWMLYDEKFSMRNLNILSLKDLSIIGNVDS 331

Query: 314 PKMLFYSVAEIFN 326
            K+LFYS+ ++ N
Sbjct: 332 IKILFYSMIDVNN 344

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 55/101 (54%), Gaps = 8/101 (7%)

Query: 3   QDYHGLWSWYLGNLRKGRFEQLVGDEARYSQLKAFLRDCFAHSTGQERRLQLLSFPASVP 62
            D +GLWSWYL NLR G FE+L+ ++ + S LK FLR+       Q +++ L+S P  + 
Sbjct: 13  NDENGLWSWYLTNLRSGNFEELINNKLKDSLLKRFLRNQ-VDINDQIKKILLISIPDHIF 71

Query: 63  CDYKILEEFIRQQGNIS-------VAIPRVHATGTEKHYLV 96
            D  +LE F+    +++       + + + +    E HYL+
Sbjct: 72  SDINVLEIFLSDYFHLNDLSNIKIIKLTKFNVYNHENHYLL 112

>KNAG0B03710 Chr2 complement(710003..712138) [2136 bp, 711 aa]
          {ON} Anc_5.526 YML006C
          Length = 711

 Score = 68.9 bits (167), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 43/70 (61%)

Query: 4  DYHGLWSWYLGNLRKGRFEQLVGDEARYSQLKAFLRDCFAHSTGQERRLQLLSFPASVPC 63
          D +GLWSWYL N+R G FE+L  +E +Y+ LK FL++ F    G   ++  +S P  V  
Sbjct: 14 DDNGLWSWYLQNIRSGDFEELTHNELKYTLLKRFLKNHFTSLEGINSKILFISIPDKVHS 73

Query: 64 DYKILEEFIR 73
          D  +LE F++
Sbjct: 74 DISVLETFLK 83

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 48/153 (31%), Positives = 77/153 (50%), Gaps = 6/153 (3%)

Query: 234 HSVFPSLSITNDFSKFRVVLQSILVYDCEKDRINTAVRQYNNNPNIANCSDDCLLYDNKI 293
           +S+ PS++I +    FR+VLQS+L+   +K  I TA+RQ NN  + A   DD +LYD+  
Sbjct: 459 YSILPSITIKDTEGHFRLVLQSVLLQREDK-AIFTAIRQSNNKVDRATVQDDWILYDSDF 517

Query: 294 SLITFRILSLVDLMELNRAHPKMLFYSVAEIFNSSPR----CSAAGCCAQVHHSQPQLLQ 349
           S+    +++L  L   +    K+LFYS+  + ++          A     V  +QPQL+ 
Sbjct: 518 SMNNLMMMTLRGLFNFSENMSKILFYSMIIVDDAETADDMLDEEATHSGDVSDTQPQLMF 577

Query: 350 RNSFSASTLSRHSLRL-LPTVTSANTIERHVRT 381
               S S +    + L   T + A T  R +RT
Sbjct: 578 DEEDSDSGVQEPQMYLPQKTASHATTAHRSIRT 610

>NCAS0F01080 Chr6 (214243..215382) [1140 bp, 379 aa] {ON} Anc_5.526
           YML006C
          Length = 379

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 50/86 (58%)

Query: 234 HSVFPSLSITNDFSKFRVVLQSILVYDCEKDRINTAVRQYNNNPNIANCSDDCLLYDNKI 293
           HS  P+ + +    + R VL S+L+ + +     TA+RQ +++PN AN  D+ LLYD+K 
Sbjct: 287 HSNIPTQTFSYKSGQLRFVLHSLLIQNAQSKETFTAIRQRSSDPNTANILDEWLLYDSKF 346

Query: 294 SLITFRILSLVDLMELNRAHPKMLFY 319
           SL    + +L D++  N+ +  +L Y
Sbjct: 347 SLDNLEMGTLQDILLSNKGNSMLLLY 372

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 61/146 (41%), Gaps = 24/146 (16%)

Query: 4   DYHGLWSWYLGNLRKGRFEQLVGDEARYSQLKAFLRDCFAHSTGQERRLQLLSFPASVPC 63
           D   +WSWYL NL+ G FE LV    R   L+A+ +  F       +++ LLS P+ +  
Sbjct: 12  DIDDMWSWYLSNLQSGNFEALVNGSVRQQHLEAYFKSQFTSGNEGSKKI-LLSVPSMLCQ 70

Query: 64  DYKILEEFI-------RQQGNISVAIPRVHATGTEKHYLVDGNYMVHALEGCNLALTENE 116
           +  I   F+       R Q    +   +      +KHYL     +  AL G       NE
Sbjct: 71  EVSIKRLFLGSIFNEERLQYINVMEFSKSPKQTEKKHYL-----LTDALSGF------NE 119

Query: 117 PFYTDSMSI-----EERSEIVSGMSL 137
             + +SM        E+S  + GM +
Sbjct: 120 AAFIESMEFNQTEENEQSVYIEGMEI 145

>NDAI0H01590 Chr8 (385963..387078) [1116 bp, 371 aa] {ON} 
          Length = 371

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 53/89 (59%)

Query: 236 VFPSLSITNDFSKFRVVLQSILVYDCEKDRINTAVRQYNNNPNIANCSDDCLLYDNKISL 295
           V PS+S  + + + R VLQSI+        + TA+RQ + +  +A  SD+ LLYD+  SL
Sbjct: 282 VVPSISCHHPYGQIRFVLQSIVFKSVRTAELLTAIRQSSADRIVATSSDEWLLYDSDFSL 341

Query: 296 ITFRILSLVDLMELNRAHPKMLFYSVAEI 324
               I +L D++  N  +P++LFY+++ +
Sbjct: 342 NNLEISTLQDILYPNYENPRILFYTMSVV 370

 Score = 38.9 bits (89), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 23/36 (63%)

Query: 3  QDYHGLWSWYLGNLRKGRFEQLVGDEARYSQLKAFL 38
          +D + + SWYL NLR+GRFE ++ D A+   L   L
Sbjct: 8  KDDNEVLSWYLRNLREGRFENIIEDRAKNYHLNTIL 43

>TPHA0K00540 Chr11 complement(107389..109416) [2028 bp, 675 aa] {ON}
           Anc_5.526 YML006C
          Length = 675

 Score = 57.0 bits (136), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 73/136 (53%), Gaps = 3/136 (2%)

Query: 221 SYSDISSLSQFSNHSVFPSLSITNDFSKFRVVLQSILVYDCEKDRINTAVRQYNNNPNIA 280
           S S++S  SQ    S+ PS+ + N + +F++VLQS+++ + E     TAVRQ N+  + A
Sbjct: 311 SMSNLSINSQDRLLSLLPSIEMQNSYGEFKLVLQSMILINFESGESFTAVRQSNSLIHEA 370

Query: 281 NCSDDCLLYDNKISLITFRILSLVDLMELNRAHPKMLFYSVAEIFNSSPRCSAAGCCAQV 340
              D+ LLYD+K S+    I++L  LM++     K+ FYS+  I    P+   A   A  
Sbjct: 371 TEDDEWLLYDSKFSMDNLEIVTLNYLMDIYADFVKIFFYSMVIINLEYPQ---AITFATD 427

Query: 341 HHSQPQLLQRNSFSAS 356
            H    L+  +  SA+
Sbjct: 428 KHINNNLINSDGSSAN 443

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 39/79 (49%), Gaps = 11/79 (13%)

Query: 5  YHGLWSWYLGNLRKGRFEQLVGDEARYSQLKAFLRDCF-AHSTGQERR----------LQ 53
          Y  LW+WYL  +R G FE+L+ +E +Y  +   +R+    H+   E            + 
Sbjct: 12 YSSLWTWYLNCIRNGEFEELLKEEDKYRSILNKIRETLQTHARNIEMEEEDANISDGNIL 71

Query: 54 LLSFPASVPCDYKILEEFI 72
           LS   ++  D +I+++F+
Sbjct: 72 FLSLHYTLDKDKEIIDDFL 90

>KNAG0C03240 Chr3 complement(634593..635567) [975 bp, 324 aa] {ON}
          
          Length = 324

 Score = 38.5 bits (88), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 32/58 (55%), Gaps = 2/58 (3%)

Query: 6  HGLWSWYLGNLRKGRFEQLVGDEARYSQLKAFLRDCFA--HSTGQERRLQLLSFPASV 61
          +  W WY+ NL  G FE+L  +  + +QL +FL   F    +T  +RRL L++ P  +
Sbjct: 18 NNFWFWYIDNLVAGNFEELNDNLIKRNQLCSFLAHYFGGKQTTKLQRRLLLVTSPYGL 75

>Smik_14.63 Chr14 complement(100051..101103) [1053 bp, 350 aa] {ON}
           YNL274C (REAL)
          Length = 350

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 43/88 (48%), Gaps = 12/88 (13%)

Query: 63  CDYKILEEFIRQQGNISVAIPRVHATGTEKHYLVDGNYMVHALEGCNLALTE-----NEP 117
           C+Y   EEF+++   +SV IP  H T    H+L++   +    +G  +  T      +E 
Sbjct: 206 CEYVGFEEFLKRSDIVSVNIPLNHNT----HHLINAETIQKMKDGVVIVNTARGGVIDER 261

Query: 118 FYTDSMSIEERSEIVSGMSLVFDFKPRF 145
             TD++   +  +I S    VF+F+PR 
Sbjct: 262 AMTDAL---QSGKIRSAGLDVFEFEPRI 286

>Suva_16.394 Chr16 (688088..688984) [897 bp, 298 aa] {ON} YPR066W
           (REAL)
          Length = 298

 Score = 30.8 bits (68), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 6/55 (10%)

Query: 235 SVFPSLSITNDFSKFRVVLQSILVYDCEKDRINTAVRQYNNNPNIANCSDDCLLY 289
           S+ PS+S TN         Q + +Y   KD I+    + +NN  + NCS+ C +Y
Sbjct: 232 SIIPSVSTTNAMVAATCCTQMVKIY---KDLIDL---ENDNNFTLINCSEGCFMY 280

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.131    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 52,140,220
Number of extensions: 2032620
Number of successful extensions: 5218
Number of sequences better than 10.0: 36
Number of HSP's gapped: 5347
Number of HSP's successfully gapped: 59
Length of query: 549
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 434
Effective length of database: 40,294,809
Effective search space: 17487947106
Effective search space used: 17487947106
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)