Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ADR195C5.528ON2881005119e-63
Ecym_40645.528ON426771945e-16
KLTH0G03784g5.528ON569961522e-10
Kwal_47.186315.528ON584741442e-09
ZYRO0D12584g5.528ON579851432e-09
TDEL0A039205.528ON466901316e-08
KLLA0A01760g5.528ON583751272e-07
SAKL0G04950g5.528ON567861272e-07
NCAS0F011005.528ON475741131e-05
TBLA0G009305.528ON608991122e-05
NCAS0H025605.528ON58740950.002
Smik_13.1445.528ON63975920.006
Kpol_1004.225.528ON47540900.008
TPHA0D023405.528ON50640900.008
YML007W (YAP1)5.528ON65040900.010
NDAI0C010605.528ON63740890.012
KNAG0B036805.528ON48267870.020
Kpol_1023.975.528ON59140850.035
Suva_13.1555.528ON64540850.040
KAFR0C054005.528ON48174840.050
KAFR0E032905.528ON26576820.060
Skud_13.1475.528ON66540820.098
CAGL0H04631g5.528ON58840770.37
TPHA0K005205.528ON56040760.45
KNAG0B060004.236ON92136693.9
NOTE: 7 genes in the same pillar as ADR195C were not hit in these BLAST results
LIST: Smik_4.698 TBLA0D01640 YDR423C KNAG0C03210 NDAI0H01610 Skud_4.697 CAGL0F03069g

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADR195C
         (288 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADR195C Chr4 complement(1041896..1042762) [867 bp, 288 aa] {ON} ...   201   9e-63
Ecym_4064 Chr4 (141770..143050) [1281 bp, 426 aa] {ON} similar t...    79   5e-16
KLTH0G03784g Chr7 complement(300734..302443) [1710 bp, 569 aa] {...    63   2e-10
Kwal_47.18631 s47 (904593..906347) [1755 bp, 584 aa] {ON} YML007...    60   2e-09
ZYRO0D12584g Chr4 complement(1064627..1066366) [1740 bp, 579 aa]...    60   2e-09
TDEL0A03920 Chr1 complement(703498..704898) [1401 bp, 466 aa] {O...    55   6e-08
KLLA0A01760g Chr1 (154859..156610) [1752 bp, 583 aa] {ON} unipro...    54   2e-07
SAKL0G04950g Chr7 complement(409365..411068) [1704 bp, 567 aa] {...    54   2e-07
NCAS0F01100 Chr6 complement(218116..219543) [1428 bp, 475 aa] {O...    48   1e-05
TBLA0G00930 Chr7 (226547..228373) [1827 bp, 608 aa] {ON} Anc_5.5...    48   2e-05
NCAS0H02560 Chr8 complement(509179..510942) [1764 bp, 587 aa] {O...    41   0.002
Smik_13.144 Chr13 (242566..244485) [1920 bp, 639 aa] {ON} YML007...    40   0.006
Kpol_1004.22 s1004 complement(45952..47379) [1428 bp, 475 aa] {O...    39   0.008
TPHA0D02340 Chr4 complement(483713..485233) [1521 bp, 506 aa] {O...    39   0.008
YML007W Chr13 (253848..255800) [1953 bp, 650 aa] {ON}  YAP1Basic...    39   0.010
NDAI0C01060 Chr3 (206067..207980) [1914 bp, 637 aa] {ON} Anc_5.5...    39   0.012
KNAG0B03680 Chr2 (707204..708652) [1449 bp, 482 aa] {ON} Anc_5.5...    38   0.020
Kpol_1023.97 s1023 (225050..226825) [1776 bp, 591 aa] {ON} (2250...    37   0.035
Suva_13.155 Chr13 (244425..246362) [1938 bp, 645 aa] {ON} YML007...    37   0.040
KAFR0C05400 Chr3 complement(1082243..1083688) [1446 bp, 481 aa] ...    37   0.050
KAFR0E03290 Chr5 (653300..654097) [798 bp, 265 aa] {ON} Anc_5.52...    36   0.060
Skud_13.147 Chr13 (240056..242053) [1998 bp, 665 aa] {ON} YML007...    36   0.098
CAGL0H04631g Chr8 complement(442448..444214) [1767 bp, 588 aa] {...    34   0.37 
TPHA0K00520 Chr11 (102027..103709) [1683 bp, 560 aa] {ON} Anc_5....    34   0.45 
KNAG0B06000 Chr2 complement(1175060..1177825) [2766 bp, 921 aa] ...    31   3.9  

>ADR195C Chr4 complement(1041896..1042762) [867 bp, 288 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML007W
           (YAP1) and YDR423C (CAD1)
          Length = 288

 Score =  201 bits (511), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 100/100 (100%), Positives = 100/100 (100%)

Query: 189 HHGRGRPNTAAAPCLAEAVRGRHQRSLAGGPRLLQHVGQRVARRELRSHAAGRHGHAGSQ 248
           HHGRGRPNTAAAPCLAEAVRGRHQRSLAGGPRLLQHVGQRVARRELRSHAAGRHGHAGSQ
Sbjct: 189 HHGRGRPNTAAAPCLAEAVRGRHQRSLAGGPRLLQHVGQRVARRELRSHAAGRHGHAGSQ 248

Query: 249 LPAGHCDTAGKRRLDVGRQPQPDRGHARAFPPVRGRPARQ 288
           LPAGHCDTAGKRRLDVGRQPQPDRGHARAFPPVRGRPARQ
Sbjct: 249 LPAGHCDTAGKRRLDVGRQPQPDRGHARAFPPVRGRPARQ 288

 Score =  172 bits (435), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 89/123 (72%)

Query: 1   MSTAGQVKRSFEEQDGPYVGETKRRGNKPGRKPLDTEXXXXXXXXXXXXXXXXXXXKERK 60
           MSTAGQVKRSFEEQDGPYVGETKRRGNKPGRKPLDTE                   KERK
Sbjct: 1   MSTAGQVKRSFEEQDGPYVGETKRRGNKPGRKPLDTEAKNRRTAQNRAAQRAFRERKERK 60

Query: 61  MRDLEDQVRRLEEERSSAECEVQSLRGHVIALVRELXXXXXXXXXXXXXXXEPTAGYDVS 120
           MRDLEDQVRRLEEERSSAECEVQSLRGHVIALVREL               EPTAGYDVS
Sbjct: 61  MRDLEDQVRRLEEERSSAECEVQSLRGHVIALVRELRRWRARQQGAGGADAEPTAGYDVS 120

Query: 121 WEH 123
           WEH
Sbjct: 121 WEH 123

>Ecym_4064 Chr4 (141770..143050) [1281 bp, 426 aa] {ON} similar to
           Ashbya gossypii ADR195C
          Length = 426

 Score = 79.3 bits (194), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 52/77 (67%)

Query: 20  GETKRRGNKPGRKPLDTEXXXXXXXXXXXXXXXXXXXKERKMRDLEDQVRRLEEERSSAE 79
           G ++R+GNKPGRKPLDTE                   KERKM+DLED+VR+LEE+R  +E
Sbjct: 36  GGSRRKGNKPGRKPLDTEAKNRRTAQNRAAQRAFRERKERKMKDLEDKVRKLEEQRLQSE 95

Query: 80  CEVQSLRGHVIALVREL 96
            EVQSLR  V++L+REL
Sbjct: 96  REVQSLRNQVVSLLREL 112

>KLTH0G03784g Chr7 complement(300734..302443) [1710 bp, 569 aa]
          {ON} weakly similar to uniprot|P19880 YML007W
          Saccharomyces cerevisiae YAP1 bZip transcription factor
          required for oxidative stress tolerance
          Length = 569

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 51/96 (53%), Gaps = 4/96 (4%)

Query: 1  MSTAGQVKRSFEEQDGPYVGETKRRGNKPGRKPLDTEXXXXXXXXXXXXXXXXXXXKERK 60
          MST   VKR  E    P     KR+G+KPGRKPLDTE                   KERK
Sbjct: 1  MST---VKRQLEASTPP-ADLPKRKGSKPGRKPLDTEAKNKRTAQNRAAQRAFRERKERK 56

Query: 61 MRDLEDQVRRLEEERSSAECEVQSLRGHVIALVREL 96
          MR+LE+QV RLE+ R  +E E + LR  +  L+ E+
Sbjct: 57 MRELEEQVERLEKVREQSEMESEFLRSQLQMLIAEI 92

>Kwal_47.18631 s47 (904593..906347) [1755 bp, 584 aa] {ON} YML007W
          (YAP1) - jun-like transcription factor [contig 192]
          FULL
          Length = 584

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/74 (44%), Positives = 42/74 (56%)

Query: 23 KRRGNKPGRKPLDTEXXXXXXXXXXXXXXXXXXXKERKMRDLEDQVRRLEEERSSAECEV 82
          KR+G+KPGRKPLDTE                   KERKMR+LE+QV RLE  R  +E E 
Sbjct: 19 KRKGSKPGRKPLDTEAKNKRTAQNRAAQRAFRERKERKMRELEEQVERLERVREQSELES 78

Query: 83 QSLRGHVIALVREL 96
          + LR  +  L+ E+
Sbjct: 79 EFLRSQLQKLLAEI 92

>ZYRO0D12584g Chr4 complement(1064627..1066366) [1740 bp, 579 aa]
           {ON} weakly similar to uniprot|P19880 YML007W
           Saccharomyces cerevisiae YAP1 bZip transcription factor
           required for oxidative stress tolerance
          Length = 579

 Score = 59.7 bits (143), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/85 (37%), Positives = 44/85 (51%)

Query: 12  EEQDGPYVGETKRRGNKPGRKPLDTEXXXXXXXXXXXXXXXXXXXKERKMRDLEDQVRRL 71
           E  D P   E +++G KPGRKPLD+E                   KE+KM++LED+V  L
Sbjct: 22  EADDSPTSDEPRKKGGKPGRKPLDSEAKSKRTAQNRAAQRAFRERKEKKMKELEDKVHAL 81

Query: 72  EEERSSAECEVQSLRGHVIALVREL 96
           EE    +  E + LR  ++ LV EL
Sbjct: 82  EELNQQSLVETEFLRSQLVTLVTEL 106

>TDEL0A03920 Chr1 complement(703498..704898) [1401 bp, 466 aa] {ON}
           Anc_5.528 YDR423C
          Length = 466

 Score = 55.1 bits (131), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 33/90 (36%), Positives = 44/90 (48%), Gaps = 2/90 (2%)

Query: 7   VKRSFEEQDGPYVGETKRRGNKPGRKPLDTEXXXXXXXXXXXXXXXXXXXKERKMRDLED 66
           VKR  E+   P     K  G+KPGRKPLD E                   KE+KM++LED
Sbjct: 29  VKRPLEQSSSPMAPAAK--GSKPGRKPLDEETKNKRTAQNRAAQRAFRERKEKKMKELED 86

Query: 67  QVRRLEEERSSAECEVQSLRGHVIALVREL 96
           +V+ LE+       E + LR  ++ LV EL
Sbjct: 87  KVQSLEQANRDTVVESEFLRSQLLTLVNEL 116

>KLLA0A01760g Chr1 (154859..156610) [1752 bp, 583 aa] {ON}
           uniprot|P56095 Kluyveromyces lactis KLLA0A01760g YAP1
           AP- 1-like transcription factor
          Length = 583

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 40/75 (53%)

Query: 22  TKRRGNKPGRKPLDTEXXXXXXXXXXXXXXXXXXXKERKMRDLEDQVRRLEEERSSAECE 81
           +KRR  KPGRKPL+TE                   +ERKM++LED+V +LE     +E E
Sbjct: 37  SKRRERKPGRKPLETEAKDKRTAQNRAAQRAFRERRERKMKELEDKVSQLESLNKQSELE 96

Query: 82  VQSLRGHVIALVREL 96
            + LR  V  L+ EL
Sbjct: 97  TKFLRNQVTNLLSEL 111

>SAKL0G04950g Chr7 complement(409365..411068) [1704 bp, 567 aa] {ON}
           weakly similar to uniprot|P19880 YML007W Saccharomyces
           cerevisiae YAP1 bZip transcription factor required for
           oxidative stress tolerance
          Length = 567

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 42/86 (48%), Gaps = 4/86 (4%)

Query: 15  DGPYVGETKRRG----NKPGRKPLDTEXXXXXXXXXXXXXXXXXXXKERKMRDLEDQVRR 70
           D     + KR+G    +KPGRKPL TE                   KERKM++LED+V  
Sbjct: 31  DNEPTAQAKRKGTKPASKPGRKPLGTEAKNKRTAQNRAAQRAFRERKERKMKELEDKVTH 90

Query: 71  LEEERSSAECEVQSLRGHVIALVREL 96
           LE  R   E E + LR  ++ L+ EL
Sbjct: 91  LETVREQNEVETEFLRSQLMTLISEL 116

>NCAS0F01100 Chr6 complement(218116..219543) [1428 bp, 475 aa]
          {ON} Anc_5.528 YDR423C
          Length = 475

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 39/74 (52%)

Query: 23 KRRGNKPGRKPLDTEXXXXXXXXXXXXXXXXXXXKERKMRDLEDQVRRLEEERSSAECEV 82
          KRR  +PGRKPLDT                    KERKM++LED++  LE  + + E E 
Sbjct: 18 KRRVGRPGRKPLDTAAKNRRTAQNRAAQRAFRERKERKMKELEDKISDLERIKDNNEVES 77

Query: 83 QSLRGHVIALVREL 96
            LR +++ L+ ++
Sbjct: 78 TFLRDYMMDLICDM 91

>TBLA0G00930 Chr7 (226547..228373) [1827 bp, 608 aa] {ON} Anc_5.528
           YDR423C
          Length = 608

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 46/99 (46%), Gaps = 4/99 (4%)

Query: 2   STAGQVKRSFEEQDGPYVG----ETKRRGNKPGRKPLDTEXXXXXXXXXXXXXXXXXXXK 57
           + +  +KR  +  D         ETK++ NK GRK  D E                   +
Sbjct: 9   TNSSTIKRHLDASDANETASATKETKKKSNKVGRKLSDQEAKSKRTAQNRAAQRAFRERR 68

Query: 58  ERKMRDLEDQVRRLEEERSSAECEVQSLRGHVIALVREL 96
           ERKM++LED+V+ LEE    +E E Q LR  +  L+ EL
Sbjct: 69  ERKMQELEDKVKSLEEVHKKSEIESQFLRDQLKVLLGEL 107

>NCAS0H02560 Chr8 complement(509179..510942) [1764 bp, 587 aa] {ON}
           Anc_5.528 YDR423C
          Length = 587

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/40 (47%), Positives = 27/40 (67%)

Query: 57  KERKMRDLEDQVRRLEEERSSAECEVQSLRGHVIALVREL 96
           KERKM++LE++V  L + +   E E + LRG +I LV EL
Sbjct: 86  KERKMKELEEKVNNLTKIQKQNEIESEFLRGQLITLVNEL 125

>Smik_13.144 Chr13 (242566..244485) [1920 bp, 639 aa] {ON} YML007W
           (REAL)
          Length = 639

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 35/75 (46%), Gaps = 1/75 (1%)

Query: 23  KRRGNKPGRK-PLDTEXXXXXXXXXXXXXXXXXXXKERKMRDLEDQVRRLEEERSSAECE 81
           KR+G K  +K  LD E                   KERKM++LE +V+ LE  +   E E
Sbjct: 50  KRKGTKTSKKQDLDPETKQKRTAQNRAAQRAFRERKERKMKELEKKVQSLESIQQQNEVE 109

Query: 82  VQSLRGHVIALVREL 96
              LR  ++ LV EL
Sbjct: 110 ATFLRDQLVTLVNEL 124

>Kpol_1004.22 s1004 complement(45952..47379) [1428 bp, 475 aa] {ON}
           complement(45952..47379) [1428 nt, 476 aa]
          Length = 475

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 25/40 (62%)

Query: 57  KERKMRDLEDQVRRLEEERSSAECEVQSLRGHVIALVREL 96
           KE+KM++LE++V  LE      E E + LR  V+ LV EL
Sbjct: 62  KEKKMKELENKVNSLENIHQKNEVETEFLRSQVLTLVNEL 101

>TPHA0D02340 Chr4 complement(483713..485233) [1521 bp, 506 aa]
          {ON} Anc_5.528 YDR423C
          Length = 506

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 27/40 (67%)

Query: 57 KERKMRDLEDQVRRLEEERSSAECEVQSLRGHVIALVREL 96
          KE+KM++L+++VR+LE      E E   LR  +++LV EL
Sbjct: 37 KEKKMKELQEKVRKLENINEKNEIETVFLRTQLLSLVNEL 76

>YML007W Chr13 (253848..255800) [1953 bp, 650 aa] {ON}  YAP1Basic
           leucine zipper (bZIP) transcription factor required for
           oxidative stress tolerance; activated by H2O2 through
           the multistep formation of disulfide bonds and transit
           from the cytoplasm to the nucleus; mediates resistance
           to cadmium
          Length = 650

 Score = 39.3 bits (90), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 19/40 (47%), Positives = 25/40 (62%)

Query: 57  KERKMRDLEDQVRRLEEERSSAECEVQSLRGHVIALVREL 96
           KERKM++LE +V+ LE  +   E E   LR  +I LV EL
Sbjct: 85  KERKMKELEKKVQSLESIQQQNEVEATFLRDQLITLVNEL 124

>NDAI0C01060 Chr3 (206067..207980) [1914 bp, 637 aa] {ON} Anc_5.528
           YDR423C
          Length = 637

 Score = 38.9 bits (89), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 26/40 (65%)

Query: 57  KERKMRDLEDQVRRLEEERSSAECEVQSLRGHVIALVREL 96
           KERKM++LE++V  L + +   E E + LR  +I LV EL
Sbjct: 95  KERKMKELEEKVANLTKIQKQNEIESEFLRSQLITLVNEL 134

>KNAG0B03680 Chr2 (707204..708652) [1449 bp, 482 aa] {ON} Anc_5.528
           YDR423C
          Length = 482

 Score = 38.1 bits (87), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 31/67 (46%)

Query: 30  GRKPLDTEXXXXXXXXXXXXXXXXXXXKERKMRDLEDQVRRLEEERSSAECEVQSLRGHV 89
             KPLD E                   KERKM++LE +V +L   +   E E + LRG +
Sbjct: 41  ASKPLDKEARMKRTEQNRAAQRAFRERKERKMKELEAKVDKLTRIQKQNEVESEFLRGQL 100

Query: 90  IALVREL 96
           + LV EL
Sbjct: 101 VTLVHEL 107

>Kpol_1023.97 s1023 (225050..226825) [1776 bp, 591 aa] {ON}
           (225050..226825) [1776 nt, 592 aa]
          Length = 591

 Score = 37.4 bits (85), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 26/40 (65%)

Query: 57  KERKMRDLEDQVRRLEEERSSAECEVQSLRGHVIALVREL 96
           KERKM++LED+V  LE+ +   + E + LR  +  ++ EL
Sbjct: 75  KERKMKELEDKVHELEKVKQQNDVESEFLRNQLTLMIDEL 114

>Suva_13.155 Chr13 (244425..246362) [1938 bp, 645 aa] {ON} YML007W
           (REAL)
          Length = 645

 Score = 37.4 bits (85), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 24/40 (60%)

Query: 57  KERKMRDLEDQVRRLEEERSSAECEVQSLRGHVIALVREL 96
           KERKM++LE +V  LE  +   E E   LR  ++ LV EL
Sbjct: 85  KERKMKELEKKVHSLESIQQENEVEATFLRDQLVTLVSEL 124

>KAFR0C05400 Chr3 complement(1082243..1083688) [1446 bp, 481 aa]
           {ON} Anc_5.528 YDR423C
          Length = 481

 Score = 37.0 bits (84), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 32/74 (43%)

Query: 23  KRRGNKPGRKPLDTEXXXXXXXXXXXXXXXXXXXKERKMRDLEDQVRRLEEERSSAECEV 82
           K   +K  R  LD E                   KERKM++LE +V  L   +   E E 
Sbjct: 31  KNNASKSSRTELDQEAKLKRTAQNRAAQRAFRERKERKMKELEAKVDHLSNIQKQNEIES 90

Query: 83  QSLRGHVIALVREL 96
           + LR  +I LV+EL
Sbjct: 91  EFLRSQLITLVKEL 104

>KAFR0E03290 Chr5 (653300..654097) [798 bp, 265 aa] {ON} Anc_5.528
          YDR423C
          Length = 265

 Score = 36.2 bits (82), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 38/76 (50%)

Query: 21 ETKRRGNKPGRKPLDTEXXXXXXXXXXXXXXXXXXXKERKMRDLEDQVRRLEEERSSAEC 80
          E KRR  +PGRK LD +                   KE K++ LE++V +L+ E  S   
Sbjct: 4  EVKRRVGRPGRKKLDADAKNKRTQQNRMAQRAFRERKEAKLKLLENEVDKLQLENLSKAE 63

Query: 81 EVQSLRGHVIALVREL 96
           ++ L+ +V+ L+ E+
Sbjct: 64 IIEFLKQNVMTLLGEI 79

>Skud_13.147 Chr13 (240056..242053) [1998 bp, 665 aa] {ON} YML007W
           (REAL)
          Length = 665

 Score = 36.2 bits (82), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 24/40 (60%)

Query: 57  KERKMRDLEDQVRRLEEERSSAECEVQSLRGHVIALVREL 96
           KERKM +LE +V+ LE  +   E E   LR  ++ LV EL
Sbjct: 85  KERKMMELEKKVQGLENIQQQNEVEATFLRDQLVTLVNEL 124

>CAGL0H04631g Chr8 complement(442448..444214) [1767 bp, 588 aa]
          {ON} similar to uniprot|P19880 Saccharomyces cerevisiae
          YML007w YAP1
          Length = 588

 Score = 34.3 bits (77), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 23/40 (57%)

Query: 57 KERKMRDLEDQVRRLEEERSSAECEVQSLRGHVIALVREL 96
          KERKM++LE +V  LE      E E   LR  +  LV+EL
Sbjct: 46 KERKMKELERKVVDLENLTKLNEVETNFLRDQLSILVKEL 85

>TPHA0K00520 Chr11 (102027..103709) [1683 bp, 560 aa] {ON}
          Anc_5.528 YDR423C
          Length = 560

 Score = 33.9 bits (76), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 25/40 (62%)

Query: 57 KERKMRDLEDQVRRLEEERSSAECEVQSLRGHVIALVREL 96
          KERK+++LED+V  LE+   + E E   LR  + ++  EL
Sbjct: 59 KERKLKELEDKVLALEQVNEAKELETNFLRSRLKSMADEL 98

>KNAG0B06000 Chr2 complement(1175060..1177825) [2766 bp, 921 aa]
           {ON} Anc_4.236 YLR382C
          Length = 921

 Score = 31.2 bits (69), Expect = 3.9,   Method: Composition-based stats.
 Identities = 13/36 (36%), Positives = 19/36 (52%)

Query: 223 QHVGQRVARRELRSHAAGRHGHAGSQLPAGHCDTAG 258
           Q +G+RV +  LR     R  + G+ +P  HCD  G
Sbjct: 434 QKIGKRVTKYRLRDWLISRQRYWGTPIPIIHCDHCG 469

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 17,930,394
Number of extensions: 496025
Number of successful extensions: 1557
Number of sequences better than 10.0: 31
Number of HSP's gapped: 1559
Number of HSP's successfully gapped: 32
Length of query: 288
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 180
Effective length of database: 41,097,471
Effective search space: 7397544780
Effective search space used: 7397544780
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)