Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ADL218C2.283ON40340320930.0
Ecym_33212.283ON40941112151e-166
SAKL0E07766g2.283ON39835411911e-162
Skud_14.2982.283ON38934311891e-162
Smik_14.2962.283ON38934311791e-160
Suva_14.3112.283ON38934311731e-160
YNL035C2.283ON38934311711e-159
KLTH0G10296g2.283ON42634211681e-158
KLLA0E08449g2.283ON42234411481e-155
Kwal_27.115502.283ON40734211331e-153
ZYRO0A01804g2.283ON37634611271e-153
TDEL0G021402.283ON39233410871e-147
Kpol_1003.342.283ON38834510771e-145
KAFR0H033402.283ON36734310701e-144
NCAS0G038702.283ON38934510721e-144
KNAG0H020402.283ON39933510681e-144
NDAI0G006302.283ON39733810661e-143
TBLA0B059202.283ON40334910521e-141
TPHA0C033702.283ON41335110151e-135
CAGL0G01628g2.283ON3763429781e-130
Kpol_1041.202.401ON5151841346e-08
Suva_13.3112.401ON5101941213e-06
TDEL0G033402.401ON5141871203e-06
NCAS0F019702.401ON5111921161e-05
CAGL0K03861g2.401ON5131991132e-05
TBLA0H036508.548ON4191891123e-05
Smik_13.3292.401ON5092021124e-05
Skud_13.2912.401ON5091841106e-05
YMR131C (RRB1)2.401ON5111941106e-05
NDAI0H027502.401ON5121901106e-05
KAFR0L003206.9ON3911741097e-05
ZYRO0A08690g2.401ON5161901098e-05
KLTH0C11550g6.9ON3981801089e-05
Kwal_47.178272.401ON5231991081e-04
KLTH0E09394g2.401ON5221991072e-04
TBLA0B092502.401ON5261901052e-04
ADR242C2.401ON5211911053e-04
NDAI0G053401.247ON7181701043e-04
TBLA0A071206.9ON4071811033e-04
Ecym_60672.401ON5221941034e-04
Kpol_1045.786.9ON3921081025e-04
Kpol_2002.995.201ON4871131026e-04
KNAG0E021802.401ON5171951018e-04
KAFR0A003802.401ON5162041000.001
KLLA0F17237g2.401ON5231971000.001
Sklu_YGOB_Anc_2.4012.401ON5201931000.001
CAGL0B03575g6.9ON419131970.002
TDEL0A068906.276ON447149960.003
SAKL0D03740g3.259ON478119950.004
TBLA0H020005.201ON473113940.004
Skud_11.2711.247ON646155940.005
Skud_5.336.9ON401185920.007
Suva_11.2681.247ON64580930.007
NCAS0B078401.247ON589135930.008
SAKL0E00814g6.9ON398117920.008
ZYRO0F00462g6.9ON393111910.009
Ecym_20243.22ON131745930.009
Kwal_55.220763.22ON128665920.010
Kpol_1028.546.325ON905223920.010
Smik_3.1576.325ON924187910.014
Skud_3.1336.325ON916187900.018
YKR036C (CAF4)1.247ON64380890.021
AAR057W6.325ON922187890.023
KLTH0D05346g2.469ON507116880.026
YCR057C (PWP2)6.325ON923187880.035
Kwal_26.77362.469ON507117870.036
ACR017W6.9ON423109860.041
KLTH0F19294g3.25ON451166860.045
KLLA0D00814g6.9ON408110860.045
Smik_15.4548.721ON461137850.055
Kpol_1060.246.276ON486144850.058
SAKL0C13332g3.22ON135344850.071
KLTH0G13068g8.288ON110135850.074
KLLA0F15598g5.201ON478113840.080
Suva_5.126.9ON401191840.084
TBLA0H030601.247ON73070840.086
KLLA0E04819g7.534ON459173830.091
ACR137W8.672ON425105830.092
Smik_11.2981.247ON66285840.092
TPHA0E030805.201ON488186830.096
Smik_6.4516.276ON523148830.099
Kwal_55.220673.25ON451184830.11
KLLA0E07085g3.25ON452124830.11
SAKL0C13266g3.25ON459117830.12
TPHA0A003803.22ON1310130830.12
NCAS0F014502.450ON90860830.12
TPHA0L016908.544ON832107830.13
Ecym_30126.9ON397184820.13
KNAG0E009806.9ON414112820.14
TDEL0A004103.22ON126298830.14
CAGL0H08932g6.239ON90257830.14
TPHA0P014903.25ON459135820.14
KAFR0G035906.162ON37448810.16
TPHA0G025002.450ON94574820.17
YJL112W (MDV1)1.247ON71484820.17
TPHA0K007807.405ON361112810.19
KNAG0A036708.548ON426181810.19
KLTH0E12694g8.548ON418115800.21
TDEL0A057708.631ON43380800.21
YOR272W (YTM1)8.721ON460137800.21
Kwal_56.232073.115ON933117810.24
SAKL0G01628gna 1ON959121800.25
YEL056W (HAT2)6.9ON401111800.25
KNAG0D034604.119ON41274800.26
KLTH0G15620g3.115ON935167800.28
Kpol_1013.377.534ON468192790.30
Kwal_56.236858.288ON110233800.31
KLTH0F19338g3.22ON129044800.32
NDAI0E044407.356ON581262790.33
ZYRO0A09636g8.435ON808126790.34
NDAI0B051901.247ON668142790.34
ABL024W2.450ON73448790.36
TDEL0E042805.201ON481151790.36
Ecym_24018.672ON426115780.37
TPHA0B042501.107ON507134790.37
Suva_6.1871.247ON71484790.38
SAKL0H15708g8.316ON368128780.41
NDAI0E015008.631ON428138780.42
ZYRO0B10450g5.201ON482208780.43
KLTH0B03410g5.201ON477175780.44
SAKL0H22396g4.122ON555196780.45
NCAS0A018504.77ON701108780.51
KNAG0E024702.469ON509113770.55
ABL044C2.469ON518109770.56
Ecym_71055.201ON48448770.56
Ecym_20936.325ON923187770.57
Skud_16.326.276ON522152770.57
TBLA0F005206.363ON663149770.57
Kpol_1048.598.544ON850116770.57
ZYRO0F09372g8.721ON448118770.57
SAKL0G16962g4.309ON61746770.61
Kpol_1024.428.544ON843119770.61
ZYRO0G03146g2.469ON510111760.66
NCAS0F033405.429ON44841760.73
NCAS0I024903.95ON62634760.73
Kwal_33.151365.201ON473163760.74
Skud_10.1021.247ON70884760.75
Ecym_42808.288ON113236770.76
AGR067W8.288ON112536760.76
ADL186C3.22ON1361141770.77
KNAG0A012503.25ON452131760.78
Suva_16.606.276ON52657760.80
KLTH0G12276g8.324ON937134760.81
KAFR0A064804.122ON568137760.81
Suva_8.3218.721ON460137760.81
CAGL0G04345g1.247ON71192760.84
NCAS0F001906.9ON411107750.85
Ecym_42498.316ON374163750.85
CAGL0A00561g4.119ON41245750.88
KNAG0A012303.22ON132183760.88
Smik_5.316.9ON427191750.89
SAKL0H05456g8.721ON446119750.90
KAFR0H017508.435ON783131760.94
ZYRO0G10406g4.119ON39170750.98
TDEL0C009408.67ON640126751.0
KLTH0H03608g6.239ON87557751.0
NCAS0C044303.22ON131143751.0
SAKL0G12892g5.201ON476180751.0
CAGL0D05588g5.201ON47753751.1
TDEL0A057208.626ON87058751.1
KAFR0H022608.324ON938118751.1
TBLA0G014904.122ON732156751.1
ADL184W3.25ON449156741.1
CAGL0K03377g2.450ON97841751.1
KNAG0H012903.259ON464141751.1
NCAS0B022008.544ON822120751.1
SAKL0F15972g7.534ON470141741.2
Smik_2.3158.585ON315141741.2
TBLA0B035708.721ON458137741.2
TPHA0G026502.401ON516202741.2
Ecym_42558.324ON937121751.3
Ecym_70388.544ON800123741.3
AGL190W8.316ON37032731.4
Ecym_62118.150ON54731741.4
Kpol_1036.658.316ON37151731.5
AFR195W8.150ON45431731.5
NDAI0J003307.534ON472113731.5
KAFR0F010606.276ON553142731.6
Ecym_62288.721ON445137731.7
KAFR0A006902.469ON508113731.8
ACR194C7.333ON51339731.8
KLTH0A00880g7.534ON471152731.9
KLTH0D15840g4.309ON69743731.9
NCAS0G011206.276ON494140731.9
KLTH0E15576g1.247ON723155731.9
YGR145W (ENP2)4.77ON70788731.9
CAGL0M05291g8.548ON41955722.0
TPHA0F005204.77ON713118732.0
Suva_4.4498.548ON424138722.0
Kwal_47.174654.106ON800115732.1
Kwal_27.120708.548ON41887722.1
KAFR0E031808.544ON814120732.2
TPHA0G029402.450ON91874722.2
ZYRO0D08558g6.325ON91291722.4
Kwal_56.24399na 2ON36962712.4
TPHA0G018408.631ON43132722.4
Suva_4.4278.585ON315108712.5
YBR175W (SWD3)8.585ON315108712.5
KAFR0A007002.470ON607149722.5
Smik_12.2798.435ON81799722.5
Ecym_74032.469ON517105722.6
KAFR0F036304.77ON69388722.7
NDAI0G025808.324ON958113722.7
YBR198C (TAF5)8.544ON798120722.7
CAGL0M05335g8.544ON806117722.7
Kpol_1038.203.22ON131343722.8
Kpol_513.125.49ON153253722.9
KLLA0A09471g5.49ON150635723.0
NCAS0A105003.259ON47850713.0
KLTH0H12122g1.399ON303151703.1
Suva_15.3895.49ON155565713.1
Kwal_23.50358.67ON744126713.2
KNAG0F006201.107ON46251713.3
CAGL0C03608g6.363ON643124713.3
Smik_10.1261.247ON712154713.3
TBLA0C018408.672ON423153713.3
NCAS0B021708.548ON41479703.3
Smik_6.2484.77ON707108713.4
KNAG0I009208.316ON381154703.5
NDAI0I021805.201ON479186703.5
Skud_2.3248.544ON802120713.6
SAKL0H01628g5.49ON155438713.6
Kwal_27.120538.544ON755120713.6
NCAS0A078602.469ON510104703.6
ZYRO0D07744g5.49ON152538713.7
KAFR0H024508.672ON417181703.7
NDAI0K029006.9ON438188703.8
Skud_13.2612.450ON83431703.9
AER114W4.309ON63356703.9
NDAI0C035405.49ON155835713.9
Ecym_80901.247ON71665703.9
Suva_14.3421.399ON303149694.0
Suva_4.4528.544ON800120704.0
TBLA0C039904.123ON43746704.0
Kwal_26.89758.721ON445119704.1
Skud_14.3211.399ON303149694.1
NDAI0K014102.450ON97725704.1
Smik_12.525.201ON48948704.2
Smik_13.2892.450ON83731704.2
YLR222C (UTP13)8.435ON81799704.2
TPHA0O007101.399ON304149694.3
KNAG0D007406.276ON504143704.3
Suva_13.2802.450ON84339704.3
NCAS0B019108.585ON32555694.4
AEL246C8.544ON815123704.4
KNAG0H016901.399ON303149694.5
Suva_15.223.22ON133643704.5
Smik_14.3221.399ON303149694.5
YNL006W (LST8)1.399ON303149694.5
NCAS0A055206.363ON671150704.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADL218C
         (403 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADL218C Chr4 complement(319674..320885) [1212 bp, 403 aa] {ON} S...   810   0.0  
Ecym_3321 Chr3 complement(615730..616959) [1230 bp, 409 aa] {ON}...   472   e-166
SAKL0E07766g Chr5 (628373..629569) [1197 bp, 398 aa] {ON} simila...   463   e-162
Skud_14.298 Chr14 complement(546083..547252) [1170 bp, 389 aa] {...   462   e-162
Smik_14.296 Chr14 complement(535060..536229) [1170 bp, 389 aa] {...   458   e-160
Suva_14.311 Chr14 complement(553987..555156) [1170 bp, 389 aa] {...   456   e-160
YNL035C Chr14 complement(568522..569691) [1170 bp, 389 aa] {ON} ...   455   e-159
KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {...   454   e-158
KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} simila...   446   e-155
Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035...   441   e-153
ZYRO0A01804g Chr1 complement(150103..151233) [1131 bp, 376 aa] {...   438   e-153
TDEL0G02140 Chr7 complement(420388..421566) [1179 bp, 392 aa] {O...   423   e-147
Kpol_1003.34 s1003 complement(85833..86999) [1167 bp, 388 aa] {O...   419   e-145
KAFR0H03340 Chr8 (637913..639016) [1104 bp, 367 aa] {ON} Anc_2.2...   416   e-144
NCAS0G03870 Chr7 (717809..718978) [1170 bp, 389 aa] {ON} Anc_2.283    417   e-144
KNAG0H02040 Chr8 (366384..367583) [1200 bp, 399 aa] {ON} Anc_2.2...   416   e-144
NDAI0G00630 Chr7 complement(137826..139019) [1194 bp, 397 aa] {O...   415   e-143
TBLA0B05920 Chr2 complement(1390257..1391468) [1212 bp, 403 aa] ...   409   e-141
TPHA0C03370 Chr3 complement(738736..739977) [1242 bp, 413 aa] {O...   395   e-135
CAGL0G01628g Chr7 complement(151262..152392) [1131 bp, 376 aa] {...   381   e-130
Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {O...    56   6e-08
Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {...    51   3e-06
TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.4...    51   3e-06
NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {O...    49   1e-05
CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa] ...    48   2e-05
TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.5...    48   3e-05
Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {...    48   4e-05
Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {...    47   6e-05
YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON} ...    47   6e-05
NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.4...    47   6e-05
KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9 ...    47   7e-05
ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly...    47   8e-05
KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} simila...    46   9e-05
Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {...    46   1e-04
KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {...    46   2e-04
TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON} Anc_2...    45   2e-04
ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}...    45   3e-04
NDAI0G05340 Chr7 (1301733..1303889) [2157 bp, 718 aa] {ON} Anc_1...    45   3e-04
TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa] ...    44   3e-04
Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar t...    44   4e-04
Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON} (1830...    44   5e-04
Kpol_2002.99 s2002 (237070..238533) [1464 bp, 487 aa] {ON} (2370...    44   6e-04
KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.4...    44   8e-04
KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401...    43   0.001
KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} high...    43   0.001
Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 52...    43   0.001
CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {...    42   0.002
TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON} Anc_6...    42   0.003
SAKL0D03740g Chr4 (303240..304676) [1437 bp, 478 aa] {ON} simila...    41   0.004
TBLA0H02000 Chr8 complement(474850..476271) [1422 bp, 473 aa] {O...    41   0.004
Skud_11.271 Chr11 complement(490869..492809) [1941 bp, 646 aa] {...    41   0.005
Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)    40   0.007
Suva_11.268 Chr11 complement(492639..494576) [1938 bp, 645 aa] {...    40   0.007
NCAS0B07840 Chr2 complement(1486900..1488669) [1770 bp, 589 aa] ...    40   0.008
SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON...    40   0.008
ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON...    40   0.009
Ecym_2024 Chr2 complement(35886..39839) [3954 bp, 1317 aa] {ON} ...    40   0.009
Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON} YOL...    40   0.010
Kpol_1028.54 s1028 (125940..128657) [2718 bp, 905 aa] {ON} (1259...    40   0.010
Smik_3.157 Chr3 complement(218522..221296) [2775 bp, 924 aa] {ON...    40   0.014
Skud_3.133 Chr3 complement(204741..207488) [2748 bp, 916 aa] {ON...    39   0.018
YKR036C Chr11 complement(508702..510633) [1932 bp, 643 aa] {ON} ...    39   0.021
AAR057W Chr1 (442821..445589) [2769 bp, 922 aa] {ON} Syntenic ho...    39   0.023
KLTH0D05346g Chr4 complement(475917..477440) [1524 bp, 507 aa] {...    39   0.026
YCR057C Chr3 complement(220457..223228) [2772 bp, 923 aa] {ON}  ...    39   0.035
Kwal_26.7736 s26 complement(491687..493210) [1524 bp, 507 aa] {O...    38   0.036
ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic ho...    38   0.041
KLTH0F19294g Chr6 complement(1560167..1561522) [1356 bp, 451 aa]...    38   0.045
KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON...    38   0.045
Smik_15.454 Chr15 (782403..783788) [1386 bp, 461 aa] {ON} YOR272...    37   0.055
Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {O...    37   0.058
SAKL0C13332g Chr3 (1177358..1181419) [4062 bp, 1353 aa] {ON} sim...    37   0.071
KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa...    37   0.074
KLLA0F15598g Chr6 (1439610..1441046) [1437 bp, 478 aa] {ON} high...    37   0.080
Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)    37   0.084
TBLA0H03060 Chr8 complement(748221..750413) [2193 bp, 730 aa] {O...    37   0.086
KLLA0E04819g Chr5 (428278..429657) [1380 bp, 459 aa] {ON} simila...    37   0.091
ACR137W Chr3 (590077..591354) [1278 bp, 425 aa] {ON} Syntenic ho...    37   0.092
Smik_11.298 Chr11 complement(497968..499956) [1989 bp, 662 aa] {...    37   0.092
TPHA0E03080 Chr5 complement(646691..648157) [1467 bp, 488 aa] {O...    37   0.096
Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C ...    37   0.099
Kwal_55.22067 s55 complement(1094600..1095955) [1356 bp, 451 aa]...    37   0.11 
KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} simila...    37   0.11 
SAKL0C13266g Chr3 complement(1171961..1173340) [1380 bp, 459 aa]...    37   0.12 
TPHA0A00380 Chr1 complement(55881..59813) [3933 bp, 1310 aa] {ON...    37   0.12 
NCAS0F01450 Chr6 complement(287070..289796) [2727 bp, 908 aa] {O...    37   0.12 
TPHA0L01690 Chr12 (355859..358357) [2499 bp, 832 aa] {ON} Anc_8....    37   0.13 
Ecym_3012 Chr3 complement(24573..25766) [1194 bp, 397 aa] {ON} s...    36   0.13 
KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {O...    36   0.14 
TDEL0A00410 Chr1 complement(70940..74728) [3789 bp, 1262 aa] {ON...    37   0.14 
CAGL0H08932g Chr8 (871668..871685,872089..874779) [2709 bp, 902 ...    37   0.14 
TPHA0P01490 Chr16 complement(302996..304375) [1380 bp, 459 aa] {...    36   0.14 
KAFR0G03590 Chr7 (740652..741776) [1125 bp, 374 aa] {ON} Anc_6.1...    36   0.16 
TPHA0G02500 Chr7 (515975..518812) [2838 bp, 945 aa] {ON} Anc_2.4...    36   0.17 
YJL112W Chr10 (205305..207449) [2145 bp, 714 aa] {ON}  MDV1Perip...    36   0.17 
TPHA0K00780 Chr11 (163003..164088) [1086 bp, 361 aa] {ON} Anc_7....    36   0.19 
KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {O...    36   0.19 
KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} simi...    35   0.21 
TDEL0A05770 Chr1 (1018340..1019641) [1302 bp, 433 aa] {ON} Anc_8...    35   0.21 
YOR272W Chr15 (832813..834195) [1383 bp, 460 aa] {ON}  YTM1Const...    35   0.21 
Kwal_56.23207 s56 (446947..449748) [2802 bp, 933 aa] {ON} YOL087...    36   0.24 
SAKL0G01628g Chr7 complement(133626..136505) [2880 bp, 959 aa] {...    35   0.25 
YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit ...    35   0.25 
KNAG0D03460 Chr4 (622817..624055) [1239 bp, 412 aa] {ON} Anc_4.1...    35   0.26 
KLTH0G15620g Chr7 complement(1363249..1366056) [2808 bp, 935 aa]...    35   0.28 
Kpol_1013.37 s1013 complement(88637..88936,88986..88994,89037..9...    35   0.30 
Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa] ...    35   0.31 
KLTH0F19338g Chr6 (1564555..1568427) [3873 bp, 1290 aa] {ON} sim...    35   0.32 
NDAI0E04440 Chr5 (1002113..1003858) [1746 bp, 581 aa] {ON} Anc_7...    35   0.33 
ZYRO0A09636g Chr1 (779501..781927) [2427 bp, 808 aa] {ON} highly...    35   0.34 
NDAI0B05190 Chr2 complement(1269217..1271223) [2007 bp, 668 aa] ...    35   0.34 
ABL024W Chr2 (353682..355886) [2205 bp, 734 aa] {ON} Syntenic ho...    35   0.36 
TDEL0E04280 Chr5 complement(799966..801411) [1446 bp, 481 aa] {O...    35   0.36 
Ecym_2401 Chr2 complement(781043..782323) [1281 bp, 426 aa] {ON}...    35   0.37 
TPHA0B04250 Chr2 complement(995664..997187) [1524 bp, 507 aa] {O...    35   0.37 
Suva_6.187 Chr6 complement(344709..346853) [2145 bp, 714 aa] {ON...    35   0.38 
SAKL0H15708g Chr8 (1370148..1371254) [1107 bp, 368 aa] {ON} high...    35   0.41 
NDAI0E01500 Chr5 complement(295871..297157) [1287 bp, 428 aa] {O...    35   0.42 
ZYRO0B10450g Chr2 complement(825240..826688) [1449 bp, 482 aa] {...    35   0.43 
KLTH0B03410g Chr2 complement(276115..277548) [1434 bp, 477 aa] {...    35   0.44 
SAKL0H22396g Chr8 complement(1949474..1951141) [1668 bp, 555 aa]...    35   0.45 
NCAS0A01850 Chr1 complement(356138..358243) [2106 bp, 701 aa] {O...    35   0.51 
KNAG0E02470 Chr5 (490378..491907) [1530 bp, 509 aa] {ON} Anc_2.4...    34   0.55 
ABL044C Chr2 complement(312376..313932) [1557 bp, 518 aa] {ON} S...    34   0.56 
Ecym_7105 Chr7 complement(205465..206919) [1455 bp, 484 aa] {ON}...    34   0.56 
Ecym_2093 Chr2 (165578..168349) [2772 bp, 923 aa] {ON} similar t...    34   0.57 
Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}...    34   0.57 
TBLA0F00520 Chr6 complement(134791..136782) [1992 bp, 663 aa] {O...    34   0.57 
Kpol_1048.59 s1048 complement(166721..169273) [2553 bp, 850 aa] ...    34   0.57 
ZYRO0F09372g Chr6 (761606..762952) [1347 bp, 448 aa] {ON} highly...    34   0.57 
SAKL0G16962g Chr7 (1463359..1463363,1463442..1465290) [1854 bp, ...    34   0.61 
Kpol_1024.42 s1024 complement(112044..114575) [2532 bp, 843 aa] ...    34   0.61 
ZYRO0G03146g Chr7 complement(238354..239886) [1533 bp, 510 aa] {...    34   0.66 
NCAS0F03340 Chr6 complement(675569..676915) [1347 bp, 448 aa] {O...    34   0.73 
NCAS0I02490 Chr9 complement(465916..467796) [1881 bp, 626 aa] {O...    34   0.73 
Kwal_33.15136 s33 (974095..975516) [1422 bp, 473 aa] {ON} YLL011...    34   0.74 
Skud_10.102 Chr10 (173179..175305) [2127 bp, 708 aa] {ON} YJL112...    34   0.75 
Ecym_4280 Chr4 complement(600066..603464) [3399 bp, 1132 aa] {ON...    34   0.76 
AGR067W Chr7 (842176..845553) [3378 bp, 1125 aa] {ON} Syntenic h...    34   0.76 
ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON} ...    34   0.77 
KNAG0A01250 Chr1 (23559..24917) [1359 bp, 452 aa] {ON} Anc_3.25 ...    34   0.78 
Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}...    34   0.80 
KLTH0G12276g Chr7 complement(1042617..1045430) [2814 bp, 937 aa]...    34   0.81 
KAFR0A06480 Chr1 complement(1312834..1314540) [1707 bp, 568 aa] ...    34   0.81 
Suva_8.321 Chr8 (572329..573711) [1383 bp, 460 aa] {ON} YOR272W ...    34   0.81 
CAGL0G04345g Chr7 (408842..410977) [2136 bp, 711 aa] {ON} simila...    34   0.84 
NCAS0F00190 Chr6 complement(29012..30247) [1236 bp, 411 aa] {ON}...    33   0.85 
Ecym_4249 Chr4 complement(516064..517188) [1125 bp, 374 aa] {ON}...    33   0.85 
CAGL0A00561g Chr1 complement(63710..64948) [1239 bp, 412 aa] {ON...    33   0.88 
KNAG0A01230 Chr1 complement(17341..21306) [3966 bp, 1321 aa] {ON...    34   0.88 
Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)    33   0.89 
SAKL0H05456g Chr8 complement(490546..491886) [1341 bp, 446 aa] {...    33   0.90 
KAFR0H01750 Chr8 complement(322707..325058) [2352 bp, 783 aa] {O...    34   0.94 
ZYRO0G10406g Chr7 complement(839502..840677) [1176 bp, 391 aa] {...    33   0.98 
TDEL0C00940 Chr3 (150797..152719) [1923 bp, 640 aa] {ON} Anc_8.6...    33   1.0  
KLTH0H03608g Chr8 (327747..327764,327941..330550) [2628 bp, 875 ...    33   1.0  
NCAS0C04430 Chr3 complement(905927..909862) [3936 bp, 1311 aa] {...    33   1.0  
SAKL0G12892g Chr7 complement(1102157..1103587) [1431 bp, 476 aa]...    33   1.0  
CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly...    33   1.1  
TDEL0A05720 Chr1 complement(1008646..1011258) [2613 bp, 870 aa] ...    33   1.1  
KAFR0H02260 Chr8 complement(430272..433088) [2817 bp, 938 aa] {O...    33   1.1  
TBLA0G01490 Chr7 (389958..392156) [2199 bp, 732 aa] {ON} Anc_4.1...    33   1.1  
ADL184W Chr4 (375530..376879) [1350 bp, 449 aa] {ON} Syntenic ho...    33   1.1  
CAGL0K03377g Chr11 complement(307358..310294) [2937 bp, 978 aa] ...    33   1.1  
KNAG0H01290 Chr8 (227947..229341) [1395 bp, 464 aa] {ON} Anc_3.2...    33   1.1  
NCAS0B02200 Chr2 complement(359080..361548) [2469 bp, 822 aa] {O...    33   1.1  
SAKL0F15972g Chr6 (1291625..1293037) [1413 bp, 470 aa] {ON} simi...    33   1.2  
Smik_2.315 Chr2 (568572..569519) [948 bp, 315 aa] {ON} YBR175W (...    33   1.2  
TBLA0B03570 Chr2 complement(828308..829684) [1377 bp, 458 aa] {O...    33   1.2  
TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.4...    33   1.2  
Ecym_4255 Chr4 (529455..532268) [2814 bp, 937 aa] {ON} similar t...    33   1.3  
Ecym_7038 Chr7 (80529..82931) [2403 bp, 800 aa] {ON} similar to ...    33   1.3  
AGL190W Chr7 (341382..342494) [1113 bp, 370 aa] {ON} Syntenic ho...    33   1.4  
Ecym_6211 Chr6 complement(393887..395530) [1644 bp, 547 aa] {ON}...    33   1.4  
Kpol_1036.65 s1036 complement(180839..181954) [1116 bp, 371 aa] ...    33   1.5  
AFR195W Chr6 (792029..793393) [1365 bp, 454 aa] {ON} Syntenic ho...    33   1.5  
NDAI0J00330 Chr10 (54580..55998) [1419 bp, 472 aa] {ON} Anc_7.534      33   1.5  
KAFR0F01060 Chr6 complement(201465..203126) [1662 bp, 553 aa] {O...    33   1.6  
Ecym_6228 Chr6 (425765..427102) [1338 bp, 445 aa] {ON} similar t...    33   1.7  
KAFR0A00690 Chr1 complement(124349..125875) [1527 bp, 508 aa] {O...    33   1.8  
ACR194C Chr3 complement(690186..691727) [1542 bp, 513 aa] {ON} S...    33   1.8  
KLTH0A00880g Chr1 complement(90125..91540) [1416 bp, 471 aa] {ON...    33   1.9  
KLTH0D15840g Chr4 (1305121..1305125,1305195..1307283) [2094 bp, ...    33   1.9  
NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {O...    33   1.9  
KLTH0E15576g Chr5 complement(1384027..1386198) [2172 bp, 723 aa]...    33   1.9  
YGR145W Chr7 (781767..783890) [2124 bp, 707 aa] {ON}  ENP2Essent...    33   1.9  
CAGL0M05291g Chr13 complement(566250..567509) [1260 bp, 419 aa] ...    32   2.0  
TPHA0F00520 Chr6 (121962..124103) [2142 bp, 713 aa] {ON} Anc_4.7...    33   2.0  
Suva_4.449 Chr4 complement(780822..782096) [1275 bp, 424 aa] {ON...    32   2.0  
Kwal_47.17465 s47 (415977..418379) [2403 bp, 800 aa] {ON} YBL008...    33   2.1  
Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR1...    32   2.1  
KAFR0E03180 Chr5 (637055..639499) [2445 bp, 814 aa] {ON} Anc_8.5...    33   2.2  
TPHA0G02940 Chr7 (631081..633837) [2757 bp, 918 aa] {ON} Anc_2.4...    32   2.2  
ZYRO0D08558g Chr4 (736975..739713) [2739 bp, 912 aa] {ON} highly...    32   2.4  
Kwal_56.24399 s56 (981153..982262) [1110 bp, 369 aa] {ON} [conti...    32   2.4  
TPHA0G01840 Chr7 complement(379782..381077) [1296 bp, 431 aa] {O...    32   2.4  
Suva_4.427 Chr4 (751909..752856) [948 bp, 315 aa] {ON} YBR175W (...    32   2.5  
YBR175W Chr2 (582408..583355) [948 bp, 315 aa] {ON}  SWD3Essenti...    32   2.5  
KAFR0A00700 Chr1 (126326..128149) [1824 bp, 607 aa] {ON} Anc_2.4...    32   2.5  
Smik_12.279 Chr12 complement(526367..528820) [2454 bp, 817 aa] {...    32   2.5  
Ecym_7403 Chr7 (829923..831476) [1554 bp, 517 aa] {ON} similar t...    32   2.6  
KAFR0F03630 Chr6 complement(718854..720935) [2082 bp, 693 aa] {O...    32   2.7  
NDAI0G02580 Chr7 complement(590030..592906) [2877 bp, 958 aa] {O...    32   2.7  
YBR198C Chr2 complement(616127..618523) [2397 bp, 798 aa] {ON}  ...    32   2.7  
CAGL0M05335g Chr13 complement(569132..571552) [2421 bp, 806 aa] ...    32   2.7  
Kpol_1038.20 s1038 complement(43719..47660) [3942 bp, 1313 aa] {...    32   2.8  
Kpol_513.12 s513 complement(32164..36762) [4599 bp, 1532 aa] {ON...    32   2.9  
KLLA0A09471g Chr1 complement(827264..831784) [4521 bp, 1506 aa] ...    32   3.0  
NCAS0A10500 Chr1 complement(2087347..2088783) [1437 bp, 478 aa] ...    32   3.0  
KLTH0H12122g Chr8 (1034092..1035003) [912 bp, 303 aa] {ON} highl...    32   3.1  
Suva_15.389 Chr15 complement(680068..684735) [4668 bp, 1555 aa] ...    32   3.1  
Kwal_23.5035 s23 (975572..977806) [2235 bp, 744 aa] {ON} YFL009W...    32   3.2  
KNAG0F00620 Chr6 (105380..106768) [1389 bp, 462 aa] {ON} Anc_1.1...    32   3.3  
CAGL0C03608g Chr3 (360681..362612) [1932 bp, 643 aa] {ON} simila...    32   3.3  
Smik_10.126 Chr10 (196821..198959) [2139 bp, 712 aa] {ON} YJL112...    32   3.3  
TBLA0C01840 Chr3 (435021..436292) [1272 bp, 423 aa] {ON} Anc_8.6...    32   3.3  
NCAS0B02170 Chr2 complement(354274..355518) [1245 bp, 414 aa] {O...    32   3.3  
Smik_6.248 Chr6 (401099..403222) [2124 bp, 707 aa] {ON} YGR145W ...    32   3.4  
KNAG0I00920 Chr9 (173033..174178) [1146 bp, 381 aa] {ON} Anc_8.3...    32   3.5  
NDAI0I02180 Chr9 complement(499955..501394) [1440 bp, 479 aa] {O...    32   3.5  
Skud_2.324 Chr2 complement(583774..586182) [2409 bp, 802 aa] {ON...    32   3.6  
SAKL0H01628g Chr8 (168606..173270) [4665 bp, 1554 aa] {ON} simil...    32   3.6  
Kwal_27.12053 s27 (1065073..1067340) [2268 bp, 755 aa] {ON} YBR1...    32   3.6  
NCAS0A07860 Chr1 (1563830..1565362) [1533 bp, 510 aa] {ON} Anc_2...    32   3.6  
ZYRO0D07744g Chr4 (674077..678654) [4578 bp, 1525 aa] {ON} simil...    32   3.7  
KAFR0H02450 Chr8 complement(468767..470020) [1254 bp, 417 aa] {O...    32   3.7  
NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9      32   3.8  
Skud_13.261 Chr13 complement(445193..447697) [2505 bp, 834 aa] {...    32   3.9  
AER114W Chr5 (850726..850730,850789..852685) [1902 bp, 633 aa] {...    32   3.9  
NDAI0C03540 Chr3 complement(810904..815580) [4677 bp, 1558 aa] {...    32   3.9  
Ecym_8090 Chr8 (194643..196793) [2151 bp, 716 aa] {ON} similar t...    32   3.9  
Suva_14.342 Chr14 (600032..600943) [912 bp, 303 aa] {ON} YNL006W...    31   4.0  
Suva_4.452 Chr4 complement(786121..788523) [2403 bp, 800 aa] {ON...    32   4.0  
TBLA0C03990 Chr3 (960225..961538) [1314 bp, 437 aa] {ON} Anc_4.1...    32   4.0  
Kwal_26.8975 s26 (1026741..1028078) [1338 bp, 445 aa] {ON} YOR27...    32   4.1  
Skud_14.321 Chr14 (586864..587775) [912 bp, 303 aa] {ON} YNL006W...    31   4.1  
NDAI0K01410 Chr11 (321553..324486) [2934 bp, 977 aa] {ON} Anc_2....    32   4.1  
Smik_12.52 Chr12 (114649..116118) [1470 bp, 489 aa] {ON} YLL011W...    32   4.2  
Smik_13.289 Chr13 complement(454351..456864) [2514 bp, 837 aa] {...    32   4.2  
YLR222C Chr12 complement(579318..581771) [2454 bp, 817 aa] {ON} ...    32   4.2  
TPHA0O00710 Chr15 (135136..136050) [915 bp, 304 aa] {ON} Anc_1.3...    31   4.3  
KNAG0D00740 Chr4 complement(115399..116913) [1515 bp, 504 aa] {O...    32   4.3  
Suva_13.280 Chr13 complement(451520..454051) [2532 bp, 843 aa] {...    32   4.3  
NCAS0B01910 Chr2 (312479..313456) [978 bp, 325 aa] {ON} Anc_8.585      31   4.4  
AEL246C Chr5 complement(172849..175296) [2448 bp, 815 aa] {ON} S...    32   4.4  
KNAG0H01690 Chr8 (301564..302475) [912 bp, 303 aa] {ON} Anc_1.39...    31   4.5  
Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON...    32   4.5  
Smik_14.322 Chr14 (578426..579337) [912 bp, 303 aa] {ON} YNL006W...    31   4.5  
YNL006W Chr14 (620067..620978) [912 bp, 303 aa] {ON}  LST8Protei...    31   4.5  
NCAS0A05520 Chr1 complement(1085200..1087215) [2016 bp, 671 aa] ...    32   4.5  
Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON...    32   4.6  
KNAG0F03870 Chr6 complement(731884..733281) [1398 bp, 465 aa] {O...    31   4.7  
KLLA0D02530g Chr4 complement(212703..214826) [2124 bp, 707 aa] {...    32   4.8  
NDAI0C05770 Chr3 complement(1328677..1329684) [1008 bp, 335 aa] ...    31   4.9  
KAFR0C03190 Chr3 complement(639680..641698) [2019 bp, 672 aa] {O...    31   4.9  
KLTH0E10120g Chr5 (916575..919055) [2481 bp, 826 aa] {ON} highly...    32   4.9  
CAGL0H00781g Chr8 complement(77292..78833) [1542 bp, 513 aa] {ON...    31   5.0  
KNAG0B01610 Chr2 (294433..296457) [2025 bp, 674 aa] {ON} Anc_1.2...    31   5.0  
Skud_15.437 Chr15 (771566..772951) [1386 bp, 461 aa] {ON} YOR272...    31   5.1  
TDEL0A07550 Chr1 complement(1314676..1316223) [1548 bp, 515 aa] ...    31   5.2  
KAFR0A00600 Chr1 (108157..110841) [2685 bp, 894 aa] {ON} Anc_2.4...    31   5.2  
KAFR0D03060 Chr4 (604145..606625) [2481 bp, 826 aa] {ON} Anc_2.4...    31   5.3  
Skud_12.198 Chr12 (382439..385270) [2832 bp, 943 aa] {ON} YLR129...    31   5.3  
SAKL0D08756g Chr4 complement(728765..729676) [912 bp, 303 aa] {O...    31   5.3  
Kwal_26.7655 s26 complement(460957..463188) [2232 bp, 743 aa] {O...    31   5.3  
Skud_16.131 Chr16 complement(237797..239152) [1356 bp, 451 aa] {...    31   5.4  
Skud_15.16 Chr15 complement(26552..30550) [3999 bp, 1332 aa] {ON...    31   5.4  
Skud_16.482 Chr16 (834842..836239) [1398 bp, 465 aa] {ON} YPR178...    31   5.4  
CAGL0J01287g Chr10 (120215..122047) [1833 bp, 610 aa] {ON} simil...    31   5.5  
ZYRO0D03828g Chr4 (310049..312229) [2181 bp, 726 aa] {ON} simila...    31   5.6  
KLLA0E04093g Chr5 (371642..372760) [1119 bp, 372 aa] {ON} simila...    31   5.6  
YMR102C Chr13 complement(469848..472352) [2505 bp, 834 aa] {ON} ...    31   5.7  
SAKL0E03058g Chr5 complement(251271..253112) [1842 bp, 613 aa] {...    31   5.7  
Smik_13.277 Chr13 (437902..439443) [1542 bp, 513 aa] {ON} YMR093...    31   5.8  
NCAS0D04610 Chr4 (881005..882552) [1548 bp, 515 aa] {ON} Anc_6.340     31   5.8  
NCAS0C03260 Chr3 complement(640108..643059) [2952 bp, 983 aa] {O...    31   5.8  
KLTH0F16192g Chr6 (1312331..1313719) [1389 bp, 462 aa] {ON} simi...    31   5.9  
CAGL0M02277g Chr13 complement(271836..273119) [1284 bp, 427 aa] ...    31   5.9  
Suva_10.302 Chr10 (532343..533236) [894 bp, 297 aa] {ON} YLR208W...    31   6.0  
AFL157C Chr6 complement(140404..141720) [1317 bp, 438 aa] {ON} S...    31   6.0  
TPHA0B01120 Chr2 (254017..256176) [2160 bp, 719 aa] {ON} Anc_1.2...    31   6.0  
Kpol_1064.35 s1064 (64223..65584) [1362 bp, 453 aa] {ON} (64223....    31   6.0  
KAFR0B01580 Chr2 (298942..303528) [4587 bp, 1528 aa] {ON} Anc_5....    31   6.1  
SAKL0H12760g Chr8 complement(1089272..1091797) [2526 bp, 841 aa]...    31   6.1  
Smik_16.442 Chr16 (754983..756395) [1413 bp, 470 aa] {ON} YPR178...    31   6.2  
NCAS0B03690 Chr2 complement(657488..660925) [3438 bp, 1145 aa] {...    31   6.2  
Suva_10.64 Chr10 (132461..133933) [1473 bp, 490 aa] {ON} YLL011W...    31   6.3  
TBLA0D04870 Chr4 complement(1194448..1195431) [984 bp, 327 aa] {...    31   6.3  
TBLA0H00230 Chr8 complement(31016..35017) [4002 bp, 1333 aa] {ON...    31   6.5  
KNAG0C03850 Chr3 (753590..755101) [1512 bp, 503 aa] {ON} Anc_7.3...    31   6.7  
Kpol_2001.63 s2001 complement(171777..175607) [3831 bp, 1276 aa]...    31   6.7  
Kwal_27.11585 s27 (859952..862423) [2472 bp, 823 aa] {ON} YLR222...    31   6.7  
ZYRO0G21010g Chr7 (1726745..1728547) [1803 bp, 600 aa] {ON} simi...    31   6.7  
Suva_10.316 Chr10 complement(551612..554068) [2457 bp, 818 aa] {...    31   6.8  
Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON...    31   6.9  
ZYRO0A12980g Chr1 (1025863..1028337) [2475 bp, 824 aa] {ON} simi...    31   6.9  
ACR085C Chr3 complement(508364..511228) [2865 bp, 954 aa] {ON} N...    31   6.9  
Kwal_26.7738 s26 (493416..495251) [1836 bp, 611 aa] {ON} YMR092C...    31   6.9  
CAGL0E01485g Chr5 complement(139067..143077) [4011 bp, 1336 aa] ...    31   7.0  
NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {O...    31   7.0  
NDAI0D03780 Chr4 complement(895256..897379) [2124 bp, 707 aa] {O...    31   7.0  
Smik_6.348 Chr6 (556719..558074) [1356 bp, 451 aa] {ON} YPL151C ...    31   7.1  
NCAS0F02050 Chr6 complement(409352..413923) [4572 bp, 1523 aa] {...    31   7.1  
SAKL0H09988g Chr8 complement(853060..855309) [2250 bp, 749 aa] {...    31   7.2  
AEL314W Chr5 (52978..55125) [2148 bp, 715 aa] {ON} Syntenic homo...    31   7.2  
YPL151C Chr16 complement(266180..267535) [1356 bp, 451 aa] {ON} ...    31   7.2  
Kpol_1018.164 s1018 (420666..423203) [2538 bp, 845 aa] {ON} (420...    31   7.4  
ZYRO0F07282g Chr6 (590095..591378) [1284 bp, 427 aa] {ON} simila...    31   7.4  
Kpol_1036.69 s1036 (189457..192267) [2811 bp, 936 aa] {ON} (1894...    31   7.4  
Suva_7.435 Chr7 (752189..754315) [2127 bp, 708 aa] {ON} YGR145W ...    31   7.6  
Ecym_2139 Chr2 complement(262217..263524) [1308 bp, 435 aa] {ON}...    31   7.6  
KNAG0M01750 Chr13 complement(323446..324903) [1458 bp, 485 aa] {...    31   7.6  
ZYRO0E04620g Chr5 (348647..349558) [912 bp, 303 aa] {ON} highly ...    30   7.7  
Kwal_27.12667 s27 complement(1325822..1327987) [2166 bp, 721 aa]...    31   7.8  
KAFR0L01320 Chr12 complement(244228..247950) [3723 bp, 1240 aa] ...    31   7.8  
TDEL0C02130 Chr3 (366855..368435) [1581 bp, 526 aa] {ON} Anc_7.3...    31   7.8  
NCAS0B00480 Chr2 (69598..70968) [1371 bp, 456 aa] {ON} Anc_8.721       30   8.0  
YLR208W Chr12 (559551..560444) [894 bp, 297 aa] {ON}  SEC13Struc...    30   8.1  
Skud_12.272 Chr12 (506157..507050) [894 bp, 297 aa] {ON} YLR208W...    30   8.3  
NCAS0C01680 Chr3 (309670..310965) [1296 bp, 431 aa] {ON} Anc_8.672     30   8.4  
TBLA0B04390 Chr2 (1014987..1015997) [1011 bp, 336 aa] {ON} Anc_8...    30   8.5  
Kwal_56.24163 s56 complement(879667..881856) [2190 bp, 729 aa] {...    31   8.6  
NCAS0B01660 Chr2 complement(270046..271320) [1275 bp, 424 aa] {O...    30   8.7  
TDEL0E01960 Chr5 (369744..371102) [1359 bp, 452 aa] {ON} Anc_5.4...    30   8.7  
KLTH0H13420g Chr8 (1172833..1175793) [2961 bp, 986 aa] {ON} high...    31   8.7  
TDEL0B03020 Chr2 complement(534847..537342) [2496 bp, 831 aa] {O...    30   8.8  
Smik_2.335 Chr2 complement(596903..598171) [1269 bp, 422 aa] {ON...    30   9.1  
KAFR0I02860 Chr9 (573406..577503) [4098 bp, 1365 aa] {ON} Anc_3....    31   9.1  
ZYRO0G02618g Chr7 (201987..204629) [2643 bp, 880 aa] {ON} simila...    30   9.1  
Ecym_7028 Chr7 (52132..52136,52211..54083) [1878 bp, 625 aa] {ON...    30   9.1  
KLLA0E20967g Chr5 (1872227..1876192) [3966 bp, 1321 aa] {ON} sim...    30   9.2  
TBLA0G02090 Chr7 (545989..547911) [1923 bp, 640 aa] {ON} Anc_4.3...    30   9.3  
NDAI0J01180 Chr10 complement(273472..276876) [3405 bp, 1134 aa] ...    30   9.5  
KLLA0D12760g Chr4 complement(1090428..1091909) [1482 bp, 493 aa]...    30   9.7  
NCAS0B04470 Chr2 complement(811894..813396) [1503 bp, 500 aa] {O...    30   9.7  
TDEL0G04620 Chr7 (842202..843380) [1179 bp, 392 aa] {ON} Anc_6.9...    30   9.8  
SAKL0G02398g Chr7 complement(200123..201538) [1416 bp, 471 aa] {...    30   9.8  
NCAS0G02040 Chr7 complement(367514..370882) [3369 bp, 1122 aa] {...    30   9.9  
NDAI0I00880 Chr9 complement(203097..205763) [2667 bp, 888 aa] {O...    30   10.0 

>ADL218C Chr4 complement(319674..320885) [1212 bp, 403 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL035C
          Length = 403

 Score =  810 bits (2093), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/403 (97%), Positives = 394/403 (97%)

Query: 1   MSYILQQKVSFGADNWCLRLRPLYQAGVLAALSNGHVHLVDWATGKSVLDVAAHESSING 60
           MSYILQQKVSFGADNWCLRLRPLYQAGVLAALSNGHVHLVDWATGKSVLDVAAHESSING
Sbjct: 1   MSYILQQKVSFGADNWCLRLRPLYQAGVLAALSNGHVHLVDWATGKSVLDVAAHESSING 60

Query: 61  LQVLDSAHDRGTVFATAADDGVKLFDIRTRGCVATLTDANGAPALSLDSRHGMLAFGTEL 120
           LQVLDSAHDRGTVFATAADDGVKLFDIRTRGCVATLTDANGAPALSLDSRHGMLAFGTEL
Sbjct: 61  LQVLDSAHDRGTVFATAADDGVKLFDIRTRGCVATLTDANGAPALSLDSRHGMLAFGTEL 120

Query: 121 VGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQS 180
           VGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQS
Sbjct: 121 VGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQS 180

Query: 181 EEDEALHQVINFASIHSCGWLSPKRIWSLSHMETFAIHELNDKSEHANEPQPQLFGDVRE 240
           EEDEALHQVINFASIHSCGWLSPKRIWSLSHMETFAIHELNDKSEHANEPQPQLFGDVRE
Sbjct: 181 EEDEALHQVINFASIHSCGWLSPKRIWSLSHMETFAIHELNDKSEHANEPQPQLFGDVRE 240

Query: 241 PWACDYVVDVYPGFIAAGSTRENAGELRLLPLRDECVDAANAIVLPQAHGDEVVRDVLVP 300
           PWACDYVVDVYPGFIAAGSTRENAGELRLLPLRDECVDAANAIVLPQAHGDEVVRDVLVP
Sbjct: 241 PWACDYVVDVYPGFIAAGSTRENAGELRLLPLRDECVDAANAIVLPQAHGDEVVRDVLVP 300

Query: 301 ASSPELLYSAGEDGNMAIWKSTLGPLNVPVDFWDYSKKETVLEDLPSSGLDDTHSAQHND 360
           ASSPELLYSAGEDGNMAIWKSTLGPLNVPVDFWDYSKKETVLEDLPSSGLDDTHSAQHND
Sbjct: 301 ASSPELLYSAGEDGNMAIWKSTLGPLNVPVDFWDYSKKETVLEDLPSSGLDDTHSAQHND 360

Query: 361 QASSLSGQSQPEQQEYRQVQSDGMRRNRXXXXXXXXXARFTPY 403
           QASSLSGQSQPEQQEYRQVQSDGMRRNR         ARFTPY
Sbjct: 361 QASSLSGQSQPEQQEYRQVQSDGMRRNRSSKHSKKHSARFTPY 403

>Ecym_3321 Chr3 complement(615730..616959) [1230 bp, 409 aa] {ON}
           similar to Ashbya gossypii ADL218C
          Length = 409

 Score =  472 bits (1215), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 227/411 (55%), Positives = 291/411 (70%), Gaps = 10/411 (2%)

Query: 1   MSYILQQKVSFGADNWCLRLRPLYQAGVLAALSNGHVHLVDWATGKSVLDVAAHESSING 60
           MSY     +SFG+DNWCL+L+PLY  G+L+ALSNGHVHL+DW +  S+ D+  H +SI+ 
Sbjct: 1   MSYTKCDTISFGSDNWCLKLQPLYSRGLLSALSNGHVHLIDWNSLTSIQDIPVHGTSISA 60

Query: 61  LQVLDSAHDRGTVFATAADDGVKLFDIRTRGCVATLTDANGAPALSLDSRHGMLAFGTEL 120
           L+VLD+  D G  F TA++D VK+FD+R   CVAT+ +A  +P +SLDSRHGMLA GTEL
Sbjct: 61  LKVLDNDVDSGNTFVTASEDSVKIFDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTEL 120

Query: 121 VGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQS 180
            G DA + L+ L +   P+R+F DSHHDD+TD+KFH +D ++LLSGSTDGYVNVYDLKQ 
Sbjct: 121 SGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQ 180

Query: 181 EEDEALHQVINFASIHSCGWLSPKRIWSLSHMETFAIHELNDKSEHANEPQPQLFGDVRE 240
           EE+EALHQVINFASIHSCGWLSPKRIW+LSHMETF+IHELNDKS+   EP+P  FGD+R+
Sbjct: 181 EEEEALHQVINFASIHSCGWLSPKRIWALSHMETFSIHELNDKSDELVEPKPLEFGDIRK 240

Query: 241 PWACDYVVDVYPGFIAAGSTRENAGELRLLPLRDECVDAANAIVLPQAHGDEVVRDVLVP 300
           PW CDYVVD++PG I  GST+E +  L+LLP  +E VD  N+I++P+AHGDEVVRD L+ 
Sbjct: 241 PWNCDYVVDIFPGCIITGSTQEQSM-LQLLPFSNEEVDTTNSIIIPRAHGDEVVRDALIH 299

Query: 301 ASSPELLYSAGEDGNMAIWKSTLGPLNVPVDFWDYSKKETVLEDLPSSGLDDTHS---AQ 357
            ++ EL YS GEDGN+ +WKS  G LNVP +FW+Y +K  VL D P+  +D T     A 
Sbjct: 300 KTTSELFYSGGEDGNIVLWKSNRGSLNVPTEFWNYQEKLNVLHD-PNIEIDMTVEKDIAF 358

Query: 358 HNDQASSLSGQSQPEQQEYRQVQSDGMRRNRX-----XXXXXXXXARFTPY 403
            ++          PE +    +Q +  RRN                RFTPY
Sbjct: 359 ESEHGIPTDFNKTPETEAEFGIQKESKRRNHTHDRNNEKKRKLKSHRFTPY 409

>SAKL0E07766g Chr5 (628373..629569) [1197 bp, 398 aa] {ON} similar
           to uniprot|P53962 Saccharomyces cerevisiae YNL035C
           Hypothetical ORF
          Length = 398

 Score =  463 bits (1191), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 209/354 (59%), Positives = 272/354 (76%), Gaps = 1/354 (0%)

Query: 1   MSYILQQKVSFGADNWCLRLRPLYQAGVLAALSNGHVHLVDWATGKSVLDVAAHESSING 60
           MSY      SFG +NWCL+L+PLY  G+L +LSNGH+HLVDW TG+ + + AAH +SI+ 
Sbjct: 1   MSYSKLHTASFGCENWCLQLQPLYNRGLLTSLSNGHIHLVDWCTGEIIHEFAAHSASISN 60

Query: 61  LQVLDSAHDRGTVFATAADDGVKLFDIRTRGCVATLTDANGAPALSLDSRHGMLAFGTEL 120
           L+VL++      +FA+A+ D VK+FD+RT  CVATL +   AP LSLDSRH MLA GTEL
Sbjct: 61  LKVLNNEFTNSDLFASASKDSVKIFDVRTSSCVATLHNDKSAPFLSLDSRHDMLACGTEL 120

Query: 121 VGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQS 180
            GVDA + ++ + +  +PLR+FVDSHHDD+TD KFHP D  +L+SGSTDGYVN+YDL  S
Sbjct: 121 SGVDAELHIYDIKKLSKPLRSFVDSHHDDITDTKFHPGDPGVLMSGSTDGYVNIYDLTNS 180

Query: 181 EEDEALHQVINFASIHSCGWLSPKRIWSLSHMETFAIHELNDKSEHANEPQPQLFGDVRE 240
           +E++ALHQVINFAS+HSCGWL+P+RI++LSHMETFAIHELNDKS+   EP+P  FGDVR+
Sbjct: 181 DEEDALHQVINFASVHSCGWLAPRRIYTLSHMETFAIHELNDKSDDLREPKPVEFGDVRQ 240

Query: 241 PWACDYVVDVYPGFIAAGSTRENAGELRLLPLRDECVDAANAIVLPQAHGDEVVRDVLVP 300
           PW CDY++++ PGFIAAG ++E  GEL+L+   DE VD  N + +PQAHGDE++RDVL+P
Sbjct: 241 PWGCDYIININPGFIAAGRSQETQGELKLIAFNDEKVDTTNVLTIPQAHGDEIIRDVLIP 300

Query: 301 ASSPELLYSAGEDGNMAIWKSTLGPLNVPVDFWDYSKKETVLED-LPSSGLDDT 353
             + ++LYS GEDG + IWKS  GPLN+  DFWDYSK+  V ED +    +DDT
Sbjct: 301 DQTTDMLYSCGEDGCLNIWKSQTGPLNISRDFWDYSKRFNVFEDTVVEVDMDDT 354

>Skud_14.298 Chr14 complement(546083..547252) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score =  462 bits (1189), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 213/343 (62%), Positives = 267/343 (77%)

Query: 2   SYILQQKVSFGADNWCLRLRPLYQAGVLAALSNGHVHLVDWATGKSVLDVAAHESSINGL 61
           SY L +  SFG++NWCL+L+P Y+ G+L  LSNG + L+DW +G+S+  + A E+SIN L
Sbjct: 3   SYSLVESNSFGSENWCLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDL 62

Query: 62  QVLDSAHDRGTVFATAADDGVKLFDIRTRGCVATLTDANGAPALSLDSRHGMLAFGTELV 121
           +V+DS    G + ++A+ D VK+FDIRT  CVA + +   +P +SLDSRHG+LA GTEL 
Sbjct: 63  KVIDSDFAAGHLVSSASIDAVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLACGTELQ 122

Query: 122 GVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSE 181
           G+DA V ++ +  W  PLR+ +DSHHDDVT +KFHP+D N+LLSGSTDGY N+YDLKQ E
Sbjct: 123 GIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDE 182

Query: 182 EDEALHQVINFASIHSCGWLSPKRIWSLSHMETFAIHELNDKSEHANEPQPQLFGDVREP 241
           E++ALHQVIN+ASIHSCGWLS KRI++LSHMETFAIHELNDKS+   EP+P  FGD+RE 
Sbjct: 183 EEDALHQVINYASIHSCGWLSQKRIYTLSHMETFAIHELNDKSDEFKEPRPADFGDIREA 242

Query: 242 WACDYVVDVYPGFIAAGSTRENAGELRLLPLRDECVDAANAIVLPQAHGDEVVRDVLVPA 301
           W CDYVVDVYPG IA G T+E AGELRLLP RDE VDA N IV+P+AHGDEVVRDV + A
Sbjct: 243 WNCDYVVDVYPGLIATGKTQEGAGELRLLPFRDEKVDAENEIVIPRAHGDEVVRDVFISA 302

Query: 302 SSPELLYSAGEDGNMAIWKSTLGPLNVPVDFWDYSKKETVLED 344
              +LLYS GEDG + IWK+ LGPLN P  FWDYS+K  VL++
Sbjct: 303 LQSDLLYSCGEDGFVKIWKNNLGPLNTPESFWDYSEKLNVLDE 345

>Smik_14.296 Chr14 complement(535060..536229) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score =  458 bits (1179), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 208/343 (60%), Positives = 266/343 (77%)

Query: 2   SYILQQKVSFGADNWCLRLRPLYQAGVLAALSNGHVHLVDWATGKSVLDVAAHESSINGL 61
           SY L +   FG++NWCL+L+P Y+ G+L  LSNG + L+DWAT KS+ ++ A E++IN L
Sbjct: 3   SYSLVESNFFGSENWCLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKASETAINDL 62

Query: 62  QVLDSAHDRGTVFATAADDGVKLFDIRTRGCVATLTDANGAPALSLDSRHGMLAFGTELV 121
           +V+DS    G + ++A+ D VK+FDIRT  C+AT+ + + +P LSLDSRHG+LA GTEL 
Sbjct: 63  KVIDSDFSAGHLVSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTELQ 122

Query: 122 GVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSE 181
           G+DA V ++ + +W  PLR+ +DSHHDDVT +KFHP+D N+LLSGSTDGY N+YDLKQ E
Sbjct: 123 GIDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDE 182

Query: 182 EDEALHQVINFASIHSCGWLSPKRIWSLSHMETFAIHELNDKSEHANEPQPQLFGDVREP 241
           E++ALHQVIN+ASIHSCGWLSPKRI++LSHMETFAIHELNDKS+   EPQP  FGDVR+ 
Sbjct: 183 EEDALHQVINYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDELREPQPLDFGDVRKA 242

Query: 242 WACDYVVDVYPGFIAAGSTRENAGELRLLPLRDECVDAANAIVLPQAHGDEVVRDVLVPA 301
           W CDYVVD+YPG IA G T+ENAGELRL+P ++E +      V+P AHGDEVVRD+ + A
Sbjct: 243 WDCDYVVDIYPGLIATGKTQENAGELRLIPFKNEKIYTEKCFVIPHAHGDEVVRDIFISA 302

Query: 302 SSPELLYSAGEDGNMAIWKSTLGPLNVPVDFWDYSKKETVLED 344
              ++LYS GEDG + IWKST GPLN P  FWDYS+K  VL D
Sbjct: 303 HQSDMLYSCGEDGYVKIWKSTQGPLNTPETFWDYSEKMNVLGD 345

>Suva_14.311 Chr14 complement(553987..555156) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score =  456 bits (1173), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 207/343 (60%), Positives = 267/343 (77%)

Query: 2   SYILQQKVSFGADNWCLRLRPLYQAGVLAALSNGHVHLVDWATGKSVLDVAAHESSINGL 61
           SY L    SFG++NWCL+L+P Y+ G+L  LSNG + L+DW TGK +  + A E++IN +
Sbjct: 3   SYSLVDLNSFGSENWCLKLQPAYKHGLLTGLSNGEICLLDWNTGKPLQKIRASETAINDM 62

Query: 62  QVLDSAHDRGTVFATAADDGVKLFDIRTRGCVATLTDANGAPALSLDSRHGMLAFGTELV 121
           +++DS    G + ++A+ D VK+FDIR+  CVA + +   +P LSLDSRHG+LA GTEL 
Sbjct: 63  KIIDSDFVAGNLISSASIDSVKVFDIRSNDCVAKINNETNSPFLSLDSRHGLLACGTELQ 122

Query: 122 GVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSE 181
           G+DA + ++ + +W  PLR+ VDSHHDDVT +KFHP+D N+LLSGSTDGY N+YDLKQ +
Sbjct: 123 GIDAAIHIYDVRKWDAPLRSLVDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDD 182

Query: 182 EDEALHQVINFASIHSCGWLSPKRIWSLSHMETFAIHELNDKSEHANEPQPQLFGDVREP 241
           E++ALHQVIN+ASIHSCGWLSPKRI++LSHMETF+IHELNDKS+   EPQP  FGD+R+ 
Sbjct: 183 EEDALHQVINYASIHSCGWLSPKRIYTLSHMETFSIHELNDKSDELKEPQPLDFGDIRKA 242

Query: 242 WACDYVVDVYPGFIAAGSTRENAGELRLLPLRDECVDAANAIVLPQAHGDEVVRDVLVPA 301
           W CDYVVDVYPGFIA G T+E AGELRLLP +DE +D  N IV+P AHGDEVVRDV V  
Sbjct: 243 WNCDYVVDVYPGFIATGKTQEGAGELRLLPFKDEKIDTGNGIVIPHAHGDEVVRDVFVSE 302

Query: 302 SSPELLYSAGEDGNMAIWKSTLGPLNVPVDFWDYSKKETVLED 344
            + ++LYS GEDG + IWK++LG LN P  FWDYS++ +VLED
Sbjct: 303 QNTDVLYSCGEDGCVKIWKNSLGCLNTPASFWDYSERISVLED 345

>YNL035C Chr14 complement(568522..569691) [1170 bp, 389 aa] {ON}
           Putative protein of unknown function with similarity to
           proteins containing WD-40 domains; green fluorescent
           protein (GFP)-fusion protein localizes to the nucleus;
           YNL035C is not an essential gene
          Length = 389

 Score =  455 bits (1171), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 208/343 (60%), Positives = 265/343 (77%)

Query: 2   SYILQQKVSFGADNWCLRLRPLYQAGVLAALSNGHVHLVDWATGKSVLDVAAHESSINGL 61
           SY L +  SFG++NWCL+L+P Y+ G+L  LSNG + L+DW+TGKSV  + A E++IN +
Sbjct: 3   SYSLVESNSFGSENWCLKLQPSYKHGLLTGLSNGEIRLLDWSTGKSVQKIKASETAINDM 62

Query: 62  QVLDSAHDRGTVFATAADDGVKLFDIRTRGCVATLTDANGAPALSLDSRHGMLAFGTELV 121
           +V+ S    G + ++A+ D VK+FDIRT   +A + +   +P +SLDSRHG+LA GTEL 
Sbjct: 63  KVIGSDFSAGHLVSSASIDAVKVFDIRTNDRIAQIQNEANSPFISLDSRHGLLACGTELQ 122

Query: 122 GVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSE 181
           G+DA V ++ + +W  PLR+ +DSHHDDVT +KFHP+D N+LLSGSTDGY N+YDLKQ E
Sbjct: 123 GIDAAVYIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDE 182

Query: 182 EDEALHQVINFASIHSCGWLSPKRIWSLSHMETFAIHELNDKSEHANEPQPQLFGDVREP 241
           E++ALHQVIN+ASIHSCGWLSPKRI++LSHMETFAIHELNDKS+   EPQP  FGDVRE 
Sbjct: 183 EEDALHQVINYASIHSCGWLSPKRIFTLSHMETFAIHELNDKSDELKEPQPLDFGDVREI 242

Query: 242 WACDYVVDVYPGFIAAGSTRENAGELRLLPLRDECVDAANAIVLPQAHGDEVVRDVLVPA 301
           W CDYVVD+YPG IA G T+EN GEL LLP +DE VD  N IV+P AHGDEVVRD+ +PA
Sbjct: 243 WNCDYVVDIYPGLIATGKTQENCGELCLLPFKDEKVDTENGIVIPHAHGDEVVRDIFIPA 302

Query: 302 SSPELLYSAGEDGNMAIWKSTLGPLNVPVDFWDYSKKETVLED 344
               +LYS GEDG + IW++  GPL++P +FWDYSKK  VL D
Sbjct: 303 QHSNMLYSCGEDGCVKIWENKQGPLDIPENFWDYSKKMNVLGD 345

>KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {ON}
           similar to uniprot|P53962 Saccharomyces cerevisiae
           YNL035C Hypothetical ORF
          Length = 426

 Score =  454 bits (1168), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 202/342 (59%), Positives = 264/342 (77%)

Query: 1   MSYILQQKVSFGADNWCLRLRPLYQAGVLAALSNGHVHLVDWATGKSVLDVAAHESSING 60
           MSY   + + FG +NWCL+L+P+Y +G+L +LSNG V L+DWAT KS+L +  H +S+N 
Sbjct: 20  MSYSKLESIEFGPNNWCLKLQPIYNSGLLTSLSNGRVELIDWATHKSILQIQTHATSVND 79

Query: 61  LQVLDSAHDRGTVFATAADDGVKLFDIRTRGCVATLTDANGAPALSLDSRHGMLAFGTEL 120
           + ++++    G++ ATAA+D VK++D+++  CVATL +   AP LSLDSRHG+L  GTEL
Sbjct: 80  MVIINNDRMNGSLIATAAEDAVKIYDLKSNDCVATLKNGKSAPFLSLDSRHGLLGCGTEL 139

Query: 121 VGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQS 180
            GVDA + ++ +  W +PLR+ VDSHHDD+T +KFHP+D N+LLSGSTDGYVN+YDL Q 
Sbjct: 140 SGVDAELHVYDIRSWQQPLRSLVDSHHDDITSIKFHPSDPNVLLSGSTDGYVNIYDLTQQ 199

Query: 181 EEDEALHQVINFASIHSCGWLSPKRIWSLSHMETFAIHELNDKSEHANEPQPQLFGDVRE 240
           EED+ALHQVINFASIHSCGWLSPKRI++LSHMET+ IHELNDK +   EP+P  FGDVR+
Sbjct: 200 EEDDALHQVINFASIHSCGWLSPKRIYTLSHMETYGIHELNDKRDEPTEPKPVDFGDVRK 259

Query: 241 PWACDYVVDVYPGFIAAGSTRENAGELRLLPLRDECVDAANAIVLPQAHGDEVVRDVLVP 300
           PW C+YV+DVYPGFIA G + E  GEL+L+PL  E  +  +AI +P AH DEVVRDVLVP
Sbjct: 260 PWDCNYVIDVYPGFIATGKSEEGRGELKLIPLDHEKPELQSAITIPSAHDDEVVRDVLVP 319

Query: 301 ASSPELLYSAGEDGNMAIWKSTLGPLNVPVDFWDYSKKETVL 342
               +LLYS GEDG++ +WKS+ GPLNVP +FW YS+K  V 
Sbjct: 320 FQHEDLLYSCGEDGSLKVWKSSAGPLNVPQEFWQYSEKIDVF 361

>KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} similar
           to uniprot|P53962 Saccharomyces cerevisiae YNL035C
           Hypothetical ORF
          Length = 422

 Score =  446 bits (1148), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 199/344 (57%), Positives = 262/344 (76%)

Query: 1   MSYILQQKVSFGADNWCLRLRPLYQAGVLAALSNGHVHLVDWATGKSVLDVAAHESSING 60
           MS+   +   F  +NWCL+L+PLYQ G++ ++S+G VHL+DW   K++  +  H +SIN 
Sbjct: 1   MSFNKYKCRYFEENNWCLKLQPLYQHGLMTSISDGSVHLLDWGNLKTISSIQCHTTSIND 60

Query: 61  LQVLDSAHDRGTVFATAADDGVKLFDIRTRGCVATLTDANGAPALSLDSRHGMLAFGTEL 120
           ++V++S  D G VFATAA+DGVK++DIR R  VA+L +   +P  SLDSRH MLA GTEL
Sbjct: 61  MKVINSDFDTGAVFATAAEDGVKVWDIRARNNVASLQNDKASPFFSLDSRHNMLACGTEL 120

Query: 121 VGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQS 180
              DA + ++ +  W +P+R+FVDSHHDD+TD+KFHP DSNLL+SGSTDGYVN+YDL Q 
Sbjct: 121 KDYDAELHIYDIRNWTKPVRSFVDSHHDDITDIKFHPCDSNLLMSGSTDGYVNIYDLTQD 180

Query: 181 EEDEALHQVINFASIHSCGWLSPKRIWSLSHMETFAIHELNDKSEHANEPQPQLFGDVRE 240
           +E++ALHQVINFASIHSCGWL PKRIWSLSHMETF IHELNDKS+   EP+P  FGDVR+
Sbjct: 181 DEEDALHQVINFASIHSCGWLGPKRIWSLSHMETFGIHELNDKSDEMIEPKPLEFGDVRD 240

Query: 241 PWACDYVVDVYPGFIAAGSTRENAGELRLLPLRDECVDAANAIVLPQAHGDEVVRDVLVP 300
            W CDYV+D+YP FIA G T E+ GEL+++P ++E VD ++A+V+P AHG+EV+RDVL+P
Sbjct: 241 KWGCDYVIDIYPSFIATGKTHESQGELKIIPFQNEQVDVSSALVIPDAHGNEVIRDVLIP 300

Query: 301 ASSPELLYSAGEDGNMAIWKSTLGPLNVPVDFWDYSKKETVLED 344
            +   LLYS GEDG + +WK T   LNVP +FWDY+   T  E+
Sbjct: 301 KNQTSLLYSCGEDGYVNVWKDTTNSLNVPHNFWDYTLPFTAFEN 344

>Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035C -
           Hypothetical ORF [contig 27] FULL
          Length = 407

 Score =  441 bits (1133), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 202/342 (59%), Positives = 258/342 (75%)

Query: 1   MSYILQQKVSFGADNWCLRLRPLYQAGVLAALSNGHVHLVDWATGKSVLDVAAHESSING 60
           MSY     ++FGADNWCL+L+PLY  G+LA+LSNG V L+DW   K +  + AH ++I+ 
Sbjct: 1   MSYSKVDSINFGADNWCLKLQPLYNRGLLASLSNGSVQLIDWVKNKQISQIQAHGTTISD 60

Query: 61  LQVLDSAHDRGTVFATAADDGVKLFDIRTRGCVATLTDANGAPALSLDSRHGMLAFGTEL 120
           + VL++  + G + ATAA+D VK+FD+R+   VATL +   AP LSLDSRHGMLA GTEL
Sbjct: 61  MVVLNNDRNNGFLIATAAEDSVKIFDLRSSDTVATLKNEKSAPFLSLDSRHGMLACGTEL 120

Query: 121 VGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQS 180
            GVDA + ++ +  W +PLR+ VDSHHDD+T++KFHPTD N+LLSGSTDGYVN+YDL Q 
Sbjct: 121 SGVDAELHIYDMKAWHQPLRSLVDSHHDDITNIKFHPTDPNVLLSGSTDGYVNIYDLTQP 180

Query: 181 EEDEALHQVINFASIHSCGWLSPKRIWSLSHMETFAIHELNDKSEHANEPQPQLFGDVRE 240
           EED+ALHQVINFASIHS GW +PKRI++LSHMETF IHELNDK E   EP P+ FGD+R+
Sbjct: 181 EEDDALHQVINFASIHSSGWCAPKRIYTLSHMETFGIHELNDKLEEPTEPHPKDFGDIRQ 240

Query: 241 PWACDYVVDVYPGFIAAGSTRENAGELRLLPLRDECVDAANAIVLPQAHGDEVVRDVLVP 300
            W CDYVVDVYPGFIA G ++E  GE++L+P   E +D  +A+ +P AHGDEVVRDVLVP
Sbjct: 241 SWGCDYVVDVYPGFIATGKSQEGQGEVKLIPFTGEDLDLDSAVTIPSAHGDEVVRDVLVP 300

Query: 301 ASSPELLYSAGEDGNMAIWKSTLGPLNVPVDFWDYSKKETVL 342
               ++LY+ GEDG +  WKS  GPLNVP +FW Y+ +  V 
Sbjct: 301 FQHEDMLYTCGEDGCVNAWKSNRGPLNVPQEFWSYADQIDVF 342

>ZYRO0A01804g Chr1 complement(150103..151233) [1131 bp, 376 aa] {ON}
           similar to uniprot|P53962 Saccharomyces cerevisiae
           YNL035C Hypothetical ORF
          Length = 376

 Score =  438 bits (1127), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 198/346 (57%), Positives = 266/346 (76%)

Query: 1   MSYILQQKVSFGADNWCLRLRPLYQAGVLAALSNGHVHLVDWATGKSVLDVAAHESSING 60
           MSY L    SFG +NWCL L+P YQ  +LA+LSNG VH +DW TGKS+  +   E ++N 
Sbjct: 1   MSYSLVNSESFGNNNWCLNLQPAYQHSLLASLSNGQVHQLDWQTGKSIAHIKTGEVAVNK 60

Query: 61  LQVLDSAHDRGTVFATAADDGVKLFDIRTRGCVATLTDANGAPALSLDSRHGMLAFGTEL 120
           L+++++ H+  + +ATA    VK++DIR+  C+AT+++   AP LSLDSRH MLA GTEL
Sbjct: 61  LKLINNDHENESTYATATMGAVKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTEL 120

Query: 121 VGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQS 180
            G DA + ++ + +W  PLR+ VDSHHDD+TD+ FHP+D N+L+SGSTDGY N+YDL+Q+
Sbjct: 121 SGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQA 180

Query: 181 EEDEALHQVINFASIHSCGWLSPKRIWSLSHMETFAIHELNDKSEHANEPQPQLFGDVRE 240
           EE++ALHQVINFASIHSCGWL+P+RI++LSHMETF+IHELNDKS+ A EP+P  F DVRE
Sbjct: 181 EEEDALHQVINFASIHSCGWLAPRRIFTLSHMETFSIHELNDKSDEAKEPRPVEFNDVRE 240

Query: 241 PWACDYVVDVYPGFIAAGSTRENAGELRLLPLRDECVDAANAIVLPQAHGDEVVRDVLVP 300
            W CDYVVD++PG++A G+++E  G+LR+LP + E VD  NAI +  AHGDEVVRDV VP
Sbjct: 241 SWGCDYVVDIHPGYVACGNSQEGIGKLRILPFQGEQVDTNNAIDINAAHGDEVVRDVFVP 300

Query: 301 ASSPELLYSAGEDGNMAIWKSTLGPLNVPVDFWDYSKKETVLEDLP 346
           A + +LLYS GEDG++  W++  GPLNV  +FWDYS+   VL++ P
Sbjct: 301 ARNSKLLYSCGEDGSVKTWENKSGPLNVTDEFWDYSQLLNVLDEQP 346

>TDEL0G02140 Chr7 complement(420388..421566) [1179 bp, 392 aa] {ON}
           Anc_2.283 YNL035C
          Length = 392

 Score =  423 bits (1087), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 193/334 (57%), Positives = 252/334 (75%)

Query: 11  FGADNWCLRLRPLYQAGVLAALSNGHVHLVDWATGKSVLDVAAHESSINGLQVLDSAHDR 70
           FG+DNWCL L+P Y   +L +LSNG VH +DW TGKSV    A  SSIN L+++DS  + 
Sbjct: 12  FGSDNWCLGLQPFYNHHLLTSLSNGEVHHIDWVTGKSVRVDQAGNSSINKLKIIDSNFNE 71

Query: 71  GTVFATAADDGVKLFDIRTRGCVATLTDANGAPALSLDSRHGMLAFGTELVGVDAVVSLF 130
           G+ +A A++D V + D+R+R  +A+L +   AP LSLDSRHGMLA GTEL GVDA + ++
Sbjct: 72  GSSYAVASNDSVNILDVRSRDKLASLKNDKNAPFLSLDSRHGMLACGTELSGVDAELHIY 131

Query: 131 ALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEEDEALHQVI 190
            +  W  P+R+FVDSHHDDVTD++FHP+D N+LLSGSTDGY NVYDLKQ EED+ALHQVI
Sbjct: 132 DVRNWSTPIRSFVDSHHDDVTDIRFHPSDRNVLLSGSTDGYTNVYDLKQQEEDDALHQVI 191

Query: 191 NFASIHSCGWLSPKRIWSLSHMETFAIHELNDKSEHANEPQPQLFGDVREPWACDYVVDV 250
           N+ASIHSCGWLSPKRI++LSHMET A+HELNDKS+   EPQP  FGD+RE W C YVVD+
Sbjct: 192 NYASIHSCGWLSPKRIFTLSHMETLAMHELNDKSDELREPQPLDFGDIREKWGCSYVVDL 251

Query: 251 YPGFIAAGSTRENAGELRLLPLRDECVDAANAIVLPQAHGDEVVRDVLVPASSPELLYSA 310
           YPG++A GS++E +  L+L+ L +E ++   ++V+P AHG+EVVRDVL+P  +  +LYS 
Sbjct: 252 YPGYVAVGSSQERSSFLKLMALENEQIETEKSLVIPSAHGEEVVRDVLIPPQNCNMLYSC 311

Query: 311 GEDGNMAIWKSTLGPLNVPVDFWDYSKKETVLED 344
           GEDG + IWK+     ++   FWDYSKK  V  +
Sbjct: 312 GEDGTVKIWKTKDTGFHIEPGFWDYSKKMDVFSE 345

>Kpol_1003.34 s1003 complement(85833..86999) [1167 bp, 388 aa] {ON}
           complement(85833..86999) [1167 nt, 389 aa]
          Length = 388

 Score =  419 bits (1077), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 195/345 (56%), Positives = 253/345 (73%), Gaps = 2/345 (0%)

Query: 2   SYILQQKVSFGADNWCLRLRPLYQAGVLAALSNGHVHLVDWATGKSVLDVAAHESSINGL 61
           SY L    S G  +WCL L+PLY+ G+L++LSNG V+L+DW TG  +  V A  +SIN +
Sbjct: 3   SYSLLHSNSLGRTDWCLELQPLYRHGLLSSLSNGDVNLLDWNTGNCIRTVKAGNTSINRM 62

Query: 62  QVLDSAHDRGTVFATAADDGVKLFDIRTRG--CVATLTDANGAPALSLDSRHGMLAFGTE 119
           +VLDS +D G+VF+ A +D VK+ D+R +G   VA L +    P LSLDSRHGMLA GTE
Sbjct: 63  RVLDSDYDNGSVFSVAMNDAVKVLDLRVQGNSIVAELNNEKKTPFLSLDSRHGMLACGTE 122

Query: 120 LVGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQ 179
           L GVDA + ++ +  + +P+R  VDSHHDDVTD+KFHP+D N+LLSGSTDGY NVYDL Q
Sbjct: 123 LSGVDAEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQ 182

Query: 180 SEEDEALHQVINFASIHSCGWLSPKRIWSLSHMETFAIHELNDKSEHANEPQPQLFGDVR 239
            EE++ALHQVIN+ S+HSCGWLSPKRI++LSHMETFAIHELN+KS+   EP+P  FGD+R
Sbjct: 183 VEEEDALHQVINYESVHSCGWLSPKRIYTLSHMETFAIHELNNKSDELTEPKPLDFGDIR 242

Query: 240 EPWACDYVVDVYPGFIAAGSTRENAGELRLLPLRDECVDAANAIVLPQAHGDEVVRDVLV 299
             W CDYVVDVYPG+IA G + EN G L+++P  +E ++  ++I +P AHGDEVVRDV +
Sbjct: 243 GTWDCDYVVDVYPGYIAVGKSEENNGNLKIIPFHNELLNINDSISIPNAHGDEVVRDVFI 302

Query: 300 PASSPELLYSAGEDGNMAIWKSTLGPLNVPVDFWDYSKKETVLED 344
              S  ++YS GEDG++  WK     L VP  FWDYS +  VL+D
Sbjct: 303 SPKSQNIMYSCGEDGSVKTWKIENNSLQVPPGFWDYSTQINVLDD 347

>KAFR0H03340 Chr8 (637913..639016) [1104 bp, 367 aa] {ON} Anc_2.283
           YNL035C
          Length = 367

 Score =  416 bits (1070), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 184/343 (53%), Positives = 256/343 (74%)

Query: 1   MSYILQQKVSFGADNWCLRLRPLYQAGVLAALSNGHVHLVDWATGKSVLDVAAHESSING 60
           MSY L Q+ SFG+DNWCL+ +PLY  G+L +LSNG V L+DW T   V +    + SIN 
Sbjct: 1   MSYSLVQEQSFGSDNWCLKFQPLYNHGLLTSLSNGEVKLLDWETLNPVRNFKIDQVSINS 60

Query: 61  LQVLDSAHDRGTVFATAADDGVKLFDIRTRGCVATLTDANGAPALSLDSRHGMLAFGTEL 120
           ++++++ ++  ++FATA  + VK++DI++  C+AT+T+   +P LSLDSRH MLA GTEL
Sbjct: 61  MKLINNDYNNASLFATATLNSVKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTEL 120

Query: 121 VGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQS 180
            GVDA + ++ +  W  P+++FVDSHHDD+TD+KFHP+DSN LLSGSTDGY NVYDL Q 
Sbjct: 121 QGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQ 180

Query: 181 EEDEALHQVINFASIHSCGWLSPKRIWSLSHMETFAIHELNDKSEHANEPQPQLFGDVRE 240
           EED+AL+QVIN+ASIHSCGWLSP+RI++LSHMETF+I ELND+++   EPQP  FGD+R+
Sbjct: 181 EEDDALYQVINYASIHSCGWLSPRRIYTLSHMETFSISELNDRTDELREPQPLDFGDIRD 240

Query: 241 PWACDYVVDVYPGFIAAGSTRENAGELRLLPLRDECVDAANAIVLPQAHGDEVVRDVLVP 300
            W CDYV+D+YPG+IA G ++E  G L+++P+  E V+++ AI + +AH DEV+RDV +P
Sbjct: 241 QWNCDYVIDIYPGYIATGRSQEGNGNLQIIPMDGETVESSKAITIDRAHSDEVIRDVFIP 300

Query: 301 ASSPELLYSAGEDGNMAIWKSTLGPLNVPVDFWDYSKKETVLE 343
            +   +LYS GEDG +  WKS         +FWDYS++  V E
Sbjct: 301 RNHHNVLYSCGEDGTVKSWKSPHSQSTALEEFWDYSQRFNVFE 343

>NCAS0G03870 Chr7 (717809..718978) [1170 bp, 389 aa] {ON} Anc_2.283
          Length = 389

 Score =  417 bits (1072), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 195/345 (56%), Positives = 254/345 (73%), Gaps = 2/345 (0%)

Query: 2   SYILQQKVSFGADNWCLRLRPLYQA--GVLAALSNGHVHLVDWATGKSVLDVAAHESSIN 59
           SY L    SFG++NW L+L+PL     G+L +LSNG VH +D +T  ++      E+SIN
Sbjct: 4   SYSLVNSRSFGSNNWALKLQPLQHGNNGLLTSLSNGEVHYLDPSTLTTIQKYNISETSIN 63

Query: 60  GLQVLDSAHDRGTVFATAADDGVKLFDIRTRGCVATLTDANGAPALSLDSRHGMLAFGTE 119
            LQ+++       +F TA  + VK+FDI +   VAT+      P  SLDSRHG+LA GTE
Sbjct: 64  DLQLINHNPTSSPLFTTATSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLLACGTE 123

Query: 120 LVGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQ 179
           L GVDA + ++ + +W +P+R+ VDSHHDDVT +K+HP D N+LLSGSTDGY NVYDL +
Sbjct: 124 LKGVDAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSE 183

Query: 180 SEEDEALHQVINFASIHSCGWLSPKRIWSLSHMETFAIHELNDKSEHANEPQPQLFGDVR 239
           +EE+++LHQVINFASIHSCGWLSP+RI++LSHMETFAIHELNDKS+   EPQP   GDVR
Sbjct: 184 AEEEDSLHQVINFASIHSCGWLSPRRIFTLSHMETFAIHELNDKSDTLKEPQPIDMGDVR 243

Query: 240 EPWACDYVVDVYPGFIAAGSTRENAGELRLLPLRDECVDAANAIVLPQAHGDEVVRDVLV 299
           E W CDYVVDVYPGFIA G ++E  GEL+L+PL+DE +D  N+IV+P AH DEV+RDV +
Sbjct: 244 EKWGCDYVVDVYPGFIATGKSQERQGELKLIPLQDETIDLTNSIVIPGAHDDEVIRDVYI 303

Query: 300 PASSPELLYSAGEDGNMAIWKSTLGPLNVPVDFWDYSKKETVLED 344
           P+    ++Y+ GEDGN+ +WK+  GPLNVP   WDYSK+  +LED
Sbjct: 304 PSHDSVMMYTCGEDGNVKLWKNNNGPLNVPEQLWDYSKRVNMLED 348

>KNAG0H02040 Chr8 (366384..367583) [1200 bp, 399 aa] {ON} Anc_2.283
           YNL035C
          Length = 399

 Score =  416 bits (1068), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 187/335 (55%), Positives = 250/335 (74%), Gaps = 1/335 (0%)

Query: 11  FGADNWCLRLRPLYQAGVLAALSNGHVHLVDWATGKSVLDVAAHESSINGLQVLDSAHDR 70
           FG++NWC +++PLY+AG+L +LSNG VHL+DW + KS+    + E++IN LQ++++    
Sbjct: 12  FGSENWCFQIQPLYKAGILTSLSNGEVHLMDWKSNKSINKFKSDETAINALQIVNTDWHN 71

Query: 71  GTVFATAADDGVKLFDIRTRGCVATLTDANGAPALSLDSRHGMLAFGTELVGVDAVVSLF 130
            T F TA+   VKLFD+R+  C+ T+ +  GAP LSLDSR+  +A GTEL GVDA + +F
Sbjct: 72  ETRFITASMHAVKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTELKGVDAQLHIF 131

Query: 131 ALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEEDEALHQVI 190
            L +   P ++ VDSHHDD+T +KFHP+D N+LLSGSTDGY N+YDL Q EED++LHQVI
Sbjct: 132 DLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQEEEDDSLHQVI 191

Query: 191 NFASIHSCGWLSPKRIWSLSHMETFAIHELNDKSEHANEPQPQLFGDVREPWACDYVVDV 250
           NF SIHSCGW++PKRI++LSHMETFAIHELN+KS+   EPQP  FGD+R  W CDYVVD+
Sbjct: 192 NFTSIHSCGWVNPKRIYTLSHMETFAIHELNNKSDELTEPQPLDFGDIRAAWGCDYVVDI 251

Query: 251 YPGFIAAG-STRENAGELRLLPLRDECVDAANAIVLPQAHGDEVVRDVLVPASSPELLYS 309
           YPG++A G S  E  GEL+L+PL+ E V   N I +P AHGDEV+RDV +P  + E++YS
Sbjct: 252 YPGYVATGKSHEEGKGELKLIPLKGENVVIDNTISIPSAHGDEVIRDVFIPEQNSEVVYS 311

Query: 310 AGEDGNMAIWKSTLGPLNVPVDFWDYSKKETVLED 344
            GEDG + IW++  GPLNVP  FW+Y     VL++
Sbjct: 312 CGEDGYLNIWRNNSGPLNVPEKFWNYDIPMNVLDE 346

>NDAI0G00630 Chr7 complement(137826..139019) [1194 bp, 397 aa] {ON}
           Anc_2.283 YNL035C
          Length = 397

 Score =  415 bits (1066), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 193/338 (57%), Positives = 253/338 (74%), Gaps = 2/338 (0%)

Query: 3   YILQQKVSFGADNWCLRLRPLYQA-GVLAALSNGHVHLVDWATGKSVLDVAAHESSINGL 61
           Y L    SFG++NWC + +PL +A G+L +LSNG +H +D+ T +S   +     SIN L
Sbjct: 6   YSLLNSHSFGSNNWCFKFQPLDKANGLLLSLSNGEIHCLDFGTCQSKQSIRVSNLSINDL 65

Query: 62  QVLDSAHDRGTVFATAADDGVKLFDIRTR-GCVATLTDANGAPALSLDSRHGMLAFGTEL 120
           ++L+S    G++F+TA  + VK+FDI +  G +ATL +    P LSLDSRHG+LA GTEL
Sbjct: 66  KILNSDFHCGSLFSTATAESVKIFDINSNNGPIATLHNDKNVPFLSLDSRHGLLAMGTEL 125

Query: 121 VGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQS 180
            GVDA ++++ + +W  PLR+ +DSHHDDVT +KFHP+D  +LLSGSTDGY NVYDL Q 
Sbjct: 126 QGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQQ 185

Query: 181 EEDEALHQVINFASIHSCGWLSPKRIWSLSHMETFAIHELNDKSEHANEPQPQLFGDVRE 240
           +ED+ALHQV+N+ASIHSCGWLSP RI++LSHMETFAIHELNDKSE   EPQP  FGDVRE
Sbjct: 186 DEDDALHQVMNYASIHSCGWLSPNRIFTLSHMETFAIHELNDKSEELKEPQPLDFGDVRE 245

Query: 241 PWACDYVVDVYPGFIAAGSTRENAGELRLLPLRDECVDAANAIVLPQAHGDEVVRDVLVP 300
            W CDYV+DVYPG+IAAG ++E  G+L+L+P   E +   +++V+P AHGDEV+RDV +P
Sbjct: 246 KWGCDYVIDVYPGYIAAGKSQEGNGQLKLIPTNGENISVKDSVVIPSAHGDEVIRDVFIP 305

Query: 301 ASSPELLYSAGEDGNMAIWKSTLGPLNVPVDFWDYSKK 338
            S  EL+YS GEDG + +WK+  G LNVP  FWDYSK+
Sbjct: 306 PSHSELVYSCGEDGFVNLWKNNNGALNVPEQFWDYSKR 343

>TBLA0B05920 Chr2 complement(1390257..1391468) [1212 bp, 403 aa]
           {ON} Anc_2.283 YNL035C
          Length = 403

 Score =  409 bits (1052), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 177/349 (50%), Positives = 258/349 (73%), Gaps = 4/349 (1%)

Query: 1   MSYILQQKVSFGADNWCLRLRPLYQAGVLAALSNGHVHLVDWATGKSVLDVAAHESSING 60
           MS I     SFG++NWCL+ +PLY  G+L +LSNG + ++DW T +    +   E+SIN 
Sbjct: 1   MSVIPINLTSFGSNNWCLKFKPLYNYGLLTSLSNGEISILDWKTNQIKDKIKIGETSIND 60

Query: 61  LQVLDSAHDRGTVFATAADDGVKLFDIRTRGCVATLTDANGAPALSLDSRHGMLAFGTEL 120
            +++++ ++ G++  TA ++ VK++D+++  C+ T+T+   +P LSLDS H M+A GTEL
Sbjct: 61  FEIVNNNYNGGSLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTEL 120

Query: 121 VGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQS 180
            GVDA + ++ +  W  P+R+FVDSHHDD+TD+KFHP DS +L+SGSTDGY N+YDL ++
Sbjct: 121 SGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTET 180

Query: 181 EEDEALHQVINFASIHSCGWLSPKRIWSLSHMETFAIHELNDKSEHANEPQPQLFGDVRE 240
           EE+++LHQVIN++SIHSCGWLS +RI++LSHMETFAIH+LNDKSE   EP+P  FGD+R 
Sbjct: 181 EEEDSLHQVINYSSIHSCGWLSSRRIFTLSHMETFAIHQLNDKSEVLKEPKPIEFGDIRN 240

Query: 241 PWACDYVVDVYPGFIAAGSTRENAGELRLLPLRDECVDAA--NAIVLPQAHGDEVVRDVL 298
            W C+YV+DVYPG+IA G T E+ G+L++ P  +E +D A  N I++PQAHGDEV+RDV 
Sbjct: 241 DWGCNYVIDVYPGYIATGKTEESKGQLKISPFNNEKIDLAEDNNIIIPQAHGDEVIRDVF 300

Query: 299 VPASSPELLYSAGEDGNMAIWK--STLGPLNVPVDFWDYSKKETVLEDL 345
           +  + P  +YS GEDGN+ +WK  +T   L +P  F+DYS +  VL+++
Sbjct: 301 INPNDPSNMYSCGEDGNVKLWKIDTTTKSLKIPEHFFDYSLRLNVLDEI 349

>TPHA0C03370 Chr3 complement(738736..739977) [1242 bp, 413 aa] {ON}
           Anc_2.283 YNL035C
          Length = 413

 Score =  395 bits (1015), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 184/351 (52%), Positives = 252/351 (71%), Gaps = 7/351 (1%)

Query: 1   MSYILQQKVSFGADNWCLRLRPLYQAGVLAALSNGHVHLVDWATGKSVLDVAAHESSING 60
           MS  L  +++FG DNWCL L+PLY  G+L + SNG V+L+DW +   +      E++IN 
Sbjct: 1   MSAKLVNQITFGNDNWCLELKPLYSRGLLCSSSNGSVNLIDWNSPSIIKKFEVGETNINS 60

Query: 61  LQVLDSAHDRGTVFATAADDGVKLFDIRTRGC-VATLTDANGAPALSLDSRHGMLAFGTE 119
           L+V+++  + G +FA  +   VK++D+R     VAT+ +   +  LSL+SRH ML  GTE
Sbjct: 61  LRVINNDFENGCIFAATSLASVKIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGTE 120

Query: 120 LVGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQ 179
           L GVDA + ++ +  + +P+RAFVDSHHDD+TD+KFHP+D N+LLSGSTDGY N+YDL Q
Sbjct: 121 LTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQ 180

Query: 180 SEEDEALHQVINFASIHSCGWLSPKRIWSLSHMETFAIHELNDKSEHANEPQPQLFGDVR 239
            +EDEALHQVIN+ASIHSCGWLSPKRI++LSHMETFAIHELNDKS+   EP+P  FGD+R
Sbjct: 181 EDEDEALHQVINYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDELTEPRPLDFGDIR 240

Query: 240 EPWACDYVVDVYPGFIAAGSTRENAGELRLLPLRDECVDAANAIVLPQAHGDEVVRDVLV 299
             W CDYVVD+YPG++A G + ENAGEL++    +E ++  N I++P AHGDEV+RDV +
Sbjct: 241 GQWDCDYVVDLYPGYVAMGKSAENAGELKICGFENEIMNTENHIIIPNAHGDEVIRDVFI 300

Query: 300 PASS----PELLYSAGEDGNMAIWKS--TLGPLNVPVDFWDYSKKETVLED 344
           P  +     +++YS GEDGN+ IW +      LNV  DFW+ +++  VL D
Sbjct: 301 PPGNLNNHSDIIYSCGEDGNVNIWHAPRCSSILNVSKDFWNATEQLDVLSD 351

>CAGL0G01628g Chr7 complement(151262..152392) [1131 bp, 376 aa] {ON}
           similar to uniprot|P53962 Saccharomyces cerevisiae
           YNL035c
          Length = 376

 Score =  381 bits (978), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 182/342 (53%), Positives = 245/342 (71%), Gaps = 6/342 (1%)

Query: 3   YILQQKVSFGADNWCLRLRPLYQAGVLAALSNGHVHLVDWATGKSVLDVAAHESSINGLQ 62
           Y L    +FG++NWCL+L+P++  G+L ++S+G VHL+     K        E+SIN L 
Sbjct: 2   YSLAGSCNFGSNNWCLKLQPVHN-GILTSVSSGEVHLLGLDLSKQD-SFKVGETSINALS 59

Query: 63  VLDSAHDRGTVFATAADDGVKLFDIRTRGCVATLTDANGAPALSLDSRHGMLAFGTELVG 122
            +D   +   +FA +  + VK+FD+R    VATL   NGA  LSL S HGMLA+G+E  G
Sbjct: 60  RVDGQEN---LFAASNGNKVKVFDLRENKEVATLEQENGANVLSLGSGHGMLAYGSEQQG 116

Query: 123 VDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEE 182
           VDA + LF +  W +P+R+FVDSH DD+T + FHP D+N+LLSGSTDGY NVYDL + EE
Sbjct: 117 VDAHLHLFDIRNWSKPVRSFVDSHQDDITSIAFHPADANVLLSGSTDGYTNVYDLLEPEE 176

Query: 183 DEALHQVINFASIHSCGWLSPKRIWSLSHMETFAIHELNDKSEHANEPQPQLFGDVREPW 242
           ++ALHQVIN+ASIHSCGWL+P+RI++LSHMETFAIHELNDKSE   EPQP  FGD+R+PW
Sbjct: 177 EDALHQVINYASIHSCGWLAPRRIFTLSHMETFAIHELNDKSEELREPQPLDFGDIRQPW 236

Query: 243 ACDYVVDVYPGFIAAGSTRENAGELRLLPLRDECVDAANAIVLPQAHGDEVVRDVLVPAS 302
            C+YVVD+YPG+I+AG + E  G LR++P R+E V A + I + QAHGDE+VRD  +  S
Sbjct: 237 DCNYVVDIYPGYISAGVSEEGKGALRIIPFRNEHVQAKDTITISQAHGDEIVRDTYILPS 296

Query: 303 SPELLYSAGEDGNMAIWKSTLGPLNVPVDFWDYSKKETVLED 344
             ++LYS GEDG +  W++ +  L++P  FWDYS K ++L D
Sbjct: 297 QSDMLYSCGEDGQVKAWRNDI-KLDIPETFWDYSTKMSLLSD 337

>Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {ON}
           complement(56019..57566) [1548 nt, 516 aa]
          Length = 515

 Score = 56.2 bits (134), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 83/184 (45%), Gaps = 10/184 (5%)

Query: 14  DNWCLRLRPLYQAG-VLAALSNGHVHLVDWATGKSVLDVAAHESSIN-GLQVLDSAHDRG 71
           + + L   PL ++G +L    +G V+     T K V D      S N  ++ +  +    
Sbjct: 280 EGYALDWSPLIRSGALLTGDCSGQVYFTQRHTSKWVTDKQPFTVSNNKSIEDIQWSRTEA 339

Query: 72  TVFATAADDG-VKLFDIRTRG---CVATLTDANGAPALSLDSRHGMLAFGTELVGVDAVV 127
           TVFATA  DG ++++D R++     ++T         +S + + G L    +  G   V 
Sbjct: 340 TVFATAGCDGYIRVWDTRSKKHKPAISTKASNTDVNVISWNEKMGYLLASGDDNGTWGVW 399

Query: 128 SLFAL---GEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEEDE 184
            L       E  +P+  + D H   +T + FHPTD +++   S D  V ++DL    +DE
Sbjct: 400 DLRQFSPSNENAQPVAQY-DFHKGAITSISFHPTDESIVAVASEDNTVTLWDLSVEADDE 458

Query: 185 ALHQ 188
            + Q
Sbjct: 459 EIKQ 462

 Score = 33.5 bits (75), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 65/322 (20%), Positives = 116/322 (36%), Gaps = 47/322 (14%)

Query: 18  LRLRPLYQAG--VLAAL--SNGHVHLVDWATGKSVLDVAAHESSINGLQVLDSAHDRGTV 73
           LR+ P   +G  VL A    NG V++ D A      D   ++      + + +  + G V
Sbjct: 220 LRVSPFASSGQEVLTATMSENGEVYIFDIAPQSRAFDTPGYQIPKTAKRPIHTIRNHGNV 279

Query: 74  FATAADDGVKLFDIRTRGCVATLTDANGAPALSLDSRHGMLAFGTELVGVDAVVSLFALG 133
              A D     +    R       D +G   +    RH                      
Sbjct: 280 EGYALD-----WSPLIRSGALLTGDCSGQ--VYFTQRH--------------------TS 312

Query: 134 EWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEEDEALHQVINFA 193
           +W    + F  S++  + D+++  T++ +  +   DGY+ V+D +  +   A+    +  
Sbjct: 313 KWVTDKQPFTVSNNKSIEDIQWSRTEATVFATAGCDGYIRVWDTRSKKHKPAISTKASNT 372

Query: 194 SIHSCGWLSPKRIWSLSHME---TFAIHELNDKSEHANEPQPQLFGDVREPWACDYVVDV 250
            ++   W + K  + L+  +   T+ + +L   S      QP    D  +          
Sbjct: 373 DVNVISW-NEKMGYLLASGDDNGTWGVWDLRQFSPSNENAQPVAQYDFHKGAITSISFHP 431

Query: 251 YPGFIAAGSTRENAGELRLLPLR--DECVDAAN------AIVLPQ---AHGDEVVRDVLV 299
               I A ++ +N   L  L +   DE +          A + PQ    H  + V+DV  
Sbjct: 432 TDESIVAVASEDNTVTLWDLSVEADDEEIKQQTAETKELAQIPPQLLFVHWQKEVKDVKW 491

Query: 300 PASSPELLYSAGEDGNMAIWKS 321
               P  L S G DG + IWK+
Sbjct: 492 HKQIPGCLVSTGTDG-LNIWKT 512

>Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {ON}
           YMR131C (REAL)
          Length = 510

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 50/194 (25%), Positives = 88/194 (45%), Gaps = 25/194 (12%)

Query: 12  GADNWCLRLRPLYQAG-VLAALSNGHVHLVD-----WATGKSVLDVAAHESSINGLQVLD 65
             + + L   PL + G +L+   +G ++L       W T K    V+ +ES    ++ + 
Sbjct: 272 NVEGYGLDWSPLIKTGALLSGDCSGQIYLTQRHTSRWVTDKQSFTVSNNES----IEDIQ 327

Query: 66  SAHDRGTVFATAADDG-VKLFDIRTR------GCVATLTDANGAPALSLDSRHGMLAFGT 118
            +    TVFATAA DG ++++D R++         A+ TD N    +S   + G L    
Sbjct: 328 WSRTESTVFATAACDGYIRIWDTRSKKHKPAISVKASNTDVN---VISWSDKIGYLLASG 384

Query: 119 ELVGVDAVVSLFAL----GEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNV 174
           +  G   V  L        +  +P+  + D H   +T + F+P D +++  GS D  V +
Sbjct: 385 DDNGTWGVWDLRQFTPSNADTVQPVAQY-DFHKGAITSIAFNPLDESIVAVGSEDNTVTL 443

Query: 175 YDLKQSEEDEALHQ 188
           +DL    +DE + Q
Sbjct: 444 WDLSVEADDEEIKQ 457

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 12/66 (18%), Positives = 34/66 (51%)

Query: 135 WGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEEDEALHQVINFAS 194
           W    ++F  S+++ + D+++  T+S +  + + DGY+ ++D +  +   A+    +   
Sbjct: 308 WVTDKQSFTVSNNESIEDIQWSRTESTVFATAACDGYIRIWDTRSKKHKPAISVKASNTD 367

Query: 195 IHSCGW 200
           ++   W
Sbjct: 368 VNVISW 373

>TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.401
           YMR131C
          Length = 514

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 48/187 (25%), Positives = 84/187 (44%), Gaps = 11/187 (5%)

Query: 12  GADNWCLRLRPLYQAG-VLAALSNGHVHLVDWATGKSVLDVAAHESSIN-GLQVLDSAHD 69
             + + L   PL + G +L    +G V+L    T K V D      S N  ++ +  +  
Sbjct: 276 NVEGYGLDWSPLIKTGALLTGDCSGQVYLTQRHTSKWVTDKQPFTFSNNKSIEDIQWSRT 335

Query: 70  RGTVFATAADDG-VKLFDIRTRG---CVATLTDANGAPALSLDSRHGMLAFGTELVGVDA 125
             TVFAT+  DG ++++D R++     ++T   A     +S + + G L    +  G   
Sbjct: 336 ESTVFATSGCDGYIRIWDTRSKKHKPAISTRASATDVNVISWNEKIGYLLASGDDDGRWG 395

Query: 126 VVSLFALG----EWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSE 181
           V  L  L     E  +P+  + D H   +T + F+P D +++   S D  V ++DL    
Sbjct: 396 VWDLRQLSPNNSENVQPVAQY-DFHKGAITSISFNPLDESIIAVASEDNTVTLWDLSVEA 454

Query: 182 EDEALHQ 188
           +DE + Q
Sbjct: 455 DDEEIKQ 461

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 12/67 (17%), Positives = 32/67 (47%)

Query: 134 EWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEEDEALHQVINFA 193
           +W    + F  S++  + D+++  T+S +  +   DGY+ ++D +  +   A+    +  
Sbjct: 311 KWVTDKQPFTFSNNKSIEDIQWSRTESTVFATSGCDGYIRIWDTRSKKHKPAISTRASAT 370

Query: 194 SIHSCGW 200
            ++   W
Sbjct: 371 DVNVISW 377

>NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {ON}
           Anc_2.401 YMR131C
          Length = 511

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 50/192 (26%), Positives = 87/192 (45%), Gaps = 25/192 (13%)

Query: 14  DNWCLRLRPLYQAG-VLAALSNGHV-----HLVDWATGKSVLDVAAHESSINGLQVLDSA 67
           + + L   PL + G +L    +G +     H   W T K    VA ++S    ++ +  +
Sbjct: 275 EGYALDWSPLTKTGALLTGDCSGQIYFTQRHTSKWITDKQPFTVANNQS----IEDIQWS 330

Query: 68  HDRGTVFATAADDG-VKLFDIRTR------GCVATLTDANGAPALSLDSRHGMLAFGTEL 120
               TVFA+A  DG ++++D R++         A+ TD N    +S   + G L    + 
Sbjct: 331 RTESTVFASAGCDGYIRIWDTRSKKHKPAISVKASNTDVN---VISWSEKLGYLLASGDD 387

Query: 121 VGVDAVVSL--FALGEWG--RPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYD 176
            G   V  L  F+    G  +P+  + D H   +T + F+P D +++  GS D  V ++D
Sbjct: 388 NGTWGVWDLRQFSPENAGSVQPVAQY-DFHKGAITSISFNPLDESIIAVGSEDNTVTLWD 446

Query: 177 LKQSEEDEALHQ 188
           L    +DE + Q
Sbjct: 447 LSVEADDEEIKQ 458

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 47/203 (23%), Positives = 84/203 (41%), Gaps = 17/203 (8%)

Query: 134 EWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEEDEALHQVINFA 193
           +W    + F  +++  + D+++  T+S +  S   DGY+ ++D +  +   A+    +  
Sbjct: 308 KWITDKQPFTVANNQSIEDIQWSRTESTVFASAGCDGYIRIWDTRSKKHKPAISVKASNT 367

Query: 194 SIHSCGWLSPKRIWSLSHME---TFAIHELNDKS-EHANEPQPQLFGDVREPWACDYVVD 249
            ++   W S K  + L+  +   T+ + +L   S E+A   QP    D  +        +
Sbjct: 368 DVNVISW-SEKLGYLLASGDDNGTWGVWDLRQFSPENAGSVQPVAQYDFHKGAITSISFN 426

Query: 250 VYPGFIAAGSTRENAGELRLLPLR--DECV--DAANAIVLPQ-------AHGDEVVRDVL 298
                I A  + +N   L  L +   DE +   AA    L Q        H  + V+DV 
Sbjct: 427 PLDESIIAVGSEDNTVTLWDLSVEADDEEIKQQAAETKELQQIPPQLLFVHWQKEVKDVK 486

Query: 299 VPASSPELLYSAGEDGNMAIWKS 321
                P  L S G DG + IWK+
Sbjct: 487 WHKQIPGCLVSTGTDG-LNIWKT 508

>CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|Q04225 Saccharomyces
           cerevisiae YMR131c Ribosome assembly protein
          Length = 513

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/199 (25%), Positives = 89/199 (44%), Gaps = 39/199 (19%)

Query: 14  DNWCLRLRPLYQAG-VLAALSNGHVHLVDWATGKSVLDVAAHESSIN-GLQVLDSAHDRG 71
           + + L   PL ++G +L+   +G ++L    T K V D  A+    N  ++ +  +    
Sbjct: 277 EGYGLDWSPLIKSGALLSGDCSGQIYLTQRHTSKWVTDKQAYSVGNNKSIEDIQWSKTES 336

Query: 72  TVFATAADDG-VKLFDIRTR------GCVATLTDANGAPALSLDSRHG-MLAFGTELVGV 123
           TVFATA  DG ++++D R++         A+ TD N    +S + + G +LA G +    
Sbjct: 337 TVFATAGCDGYIRVWDTRSKKHKPAISVKASNTDVN---VISWNEKIGYLLASGDDN--- 390

Query: 124 DAVVSLFALGEWGR-PLRAFV-------------DSHHDDVTDVKFHPTDSNLLLSGSTD 169
                    G WG   LR F              + H   +T + F+P + +++  GS D
Sbjct: 391 ---------GSWGVWDLRQFTPDNAANIQPVAQYNFHKGAITSIAFNPLEESIVAVGSED 441

Query: 170 GYVNVYDLKQSEEDEALHQ 188
             V ++DL    +DE + Q
Sbjct: 442 NTVTLWDLSVEADDEEIKQ 460

 Score = 31.2 bits (69), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 12/67 (17%), Positives = 32/67 (47%)

Query: 134 EWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEEDEALHQVINFA 193
           +W    +A+   ++  + D+++  T+S +  +   DGY+ V+D +  +   A+    +  
Sbjct: 310 KWVTDKQAYSVGNNKSIEDIQWSKTESTVFATAGCDGYIRVWDTRSKKHKPAISVKASNT 369

Query: 194 SIHSCGW 200
            ++   W
Sbjct: 370 DVNVISW 376

>TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.548
           YBR195C
          Length = 419

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 40/189 (21%), Positives = 84/189 (44%), Gaps = 28/189 (14%)

Query: 17  CLRL--RPLYQAGVLAALSNGHVHLVDWATGKSVLDVAAHESSIN-----------GLQV 63
           CL +   P  +  +L+  SNG++HL D+       + ++    IN           G   
Sbjct: 198 CLSIAWNPQQEGQLLSCESNGNIHLWDFQK-----EFSSKNREINNTIWDTNFDDLGCNE 252

Query: 64  LDSAHDRGTVFATAADDG-VKLFDIRTRGCVATLTDAN---GAPALSLDSRHGMLAFGTE 119
           +   +   ++FAT  ++  + +FD R  G V ++   N   G  +   +  + ML    +
Sbjct: 253 VTWMNGHNSIFATCGENNKMAVFDTRKEGIVNSIEQGNHNGGINSCKFNYENAMLLASGD 312

Query: 120 LVGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLS-GSTDGYVNVYDLK 178
             G   +++L+ + +  +P+R     H   ++ +++ P  + ++ S G  DG V ++D+ 
Sbjct: 313 SNG---IINLWDIRKLNKPIRNLY--HGSSISTIEWSPLMNEMIASGGQEDGLVKLWDIS 367

Query: 179 QSEEDEALH 187
             EE   +H
Sbjct: 368 NEEEPIFIH 376

>Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {ON}
           YMR131C (REAL)
          Length = 509

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 51/202 (25%), Positives = 88/202 (43%), Gaps = 41/202 (20%)

Query: 12  GADNWCLRLRPLYQAG-VLAALSNGHV-----HLVDWATGKSVLDVAAHESSINGLQVLD 65
             + + L   PL + G +L+   +G V     H   W T K    V+ ++S    ++ + 
Sbjct: 271 NVEGYGLDWSPLIKTGSLLSGDCSGQVYFTQRHTSRWVTDKQPFTVSNNKS----IEDIQ 326

Query: 66  SAHDRGTVFATAADDG-VKLFDIRTRGCVATLTDANGAPALSLDSRHGMLAFGTELVGVD 124
            +    TVFATA  DG ++++D R++            PA+S+ + +  +     +   D
Sbjct: 327 WSRSESTVFATAGCDGYIRIWDTRSK---------KHKPAISVKASNTDVNV---ISWSD 374

Query: 125 AVVSLFALGE----WGR-PLRAFVDSHHDDV-------------TDVKFHPTDSNLLLSG 166
            +  L A G+    WG   LR F  S+ D V             T + F+P D +++  G
Sbjct: 375 KIGYLLASGDDNGTWGVWDLRQFTPSNADSVQPVAQYDFHKGAITSIAFNPLDESIVAVG 434

Query: 167 STDGYVNVYDLKQSEEDEALHQ 188
           S D  V ++DL    +DE + Q
Sbjct: 435 SEDNTVTLWDLSVEADDEEIKQ 456

>Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {ON}
           YMR131C (REAL)
          Length = 509

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 47/184 (25%), Positives = 83/184 (45%), Gaps = 25/184 (13%)

Query: 22  PLYQAG-VLAALSNGHV-----HLVDWATGKSVLDVAAHESSINGLQVLDSAHDRGTVFA 75
           PL + G +L+   +G +     H   W T K    V+ ++S    ++ +  +    TVFA
Sbjct: 281 PLIKTGALLSGDCSGQIYFTQRHTSRWVTDKQPFTVSNNKS----IEDIQWSRTESTVFA 336

Query: 76  TAADDG-VKLFDIRTR------GCVATLTDANGAPALSLDSRHGMLAFGTELVGVDAVVS 128
           TA  DG ++++D R++         A+ TD N    +S   + G L    +  G   V  
Sbjct: 337 TAGCDGYIRIWDTRSKKHKPAISVKASNTDVN---VISWSDKIGYLLASGDDNGTWGVWD 393

Query: 129 LFAL----GEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEEDE 184
           L        +  +P+  + D H   +T + F+P D +++  GS D  V ++DL    +DE
Sbjct: 394 LRQFTPSNADTVQPVAQY-DFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDE 452

Query: 185 ALHQ 188
            + Q
Sbjct: 453 EIKQ 456

 Score = 31.6 bits (70), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 12/66 (18%), Positives = 31/66 (46%)

Query: 135 WGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEEDEALHQVINFAS 194
           W    + F  S++  + D+++  T+S +  +   DGY+ ++D +  +   A+    +   
Sbjct: 307 WVTDKQPFTVSNNKSIEDIQWSRTESTVFATAGCDGYIRIWDTRSKKHKPAISVKASNTD 366

Query: 195 IHSCGW 200
           ++   W
Sbjct: 367 VNVISW 372

>YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON}
           RRB1Essential nuclear protein involved in early steps of
           ribosome biogenesis; physically interacts with the
           ribosomal protein Rpl3p
          Length = 511

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 48/194 (24%), Positives = 86/194 (44%), Gaps = 25/194 (12%)

Query: 12  GADNWCLRLRPLYQAG-VLAALSNGHV-----HLVDWATGKSVLDVAAHESSINGLQVLD 65
             + + L   PL + G +L+   +G +     H   W T K    V+ ++S    ++ + 
Sbjct: 273 NVEGYGLDWSPLIKTGALLSGDCSGQIYFTQRHTSRWVTDKQPFTVSNNKS----IEDIQ 328

Query: 66  SAHDRGTVFATAADDG-VKLFDIRTR------GCVATLTDANGAPALSLDSRHGMLAFGT 118
            +    TVFATA  DG ++++D R++         A+ TD N    +S   + G L    
Sbjct: 329 WSRTESTVFATAGCDGYIRIWDTRSKKHKPAISVKASNTDVN---VISWSDKIGYLLASG 385

Query: 119 ELVGVDAVVSLFAL----GEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNV 174
           +  G   V  L        +  +P+  + D H   +T + F+P D +++  GS D  V +
Sbjct: 386 DDNGTWGVWDLRQFTPSNADAVQPVAQY-DFHKGAITSIAFNPLDESIVAVGSEDNTVTL 444

Query: 175 YDLKQSEEDEALHQ 188
           +DL    +DE + Q
Sbjct: 445 WDLSVEADDEEIKQ 458

 Score = 31.6 bits (70), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 12/66 (18%), Positives = 31/66 (46%)

Query: 135 WGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEEDEALHQVINFAS 194
           W    + F  S++  + D+++  T+S +  +   DGY+ ++D +  +   A+    +   
Sbjct: 309 WVTDKQPFTVSNNKSIEDIQWSRTESTVFATAGCDGYIRIWDTRSKKHKPAISVKASNTD 368

Query: 195 IHSCGW 200
           ++   W
Sbjct: 369 VNVISW 374

>NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.401
           YMR131C
          Length = 512

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 82/190 (43%), Gaps = 17/190 (8%)

Query: 12  GADNWCLRLRPLYQAG-VLAALSNGHVHLVDWATGKSVLDVAAHESSIN-GLQVLDSAHD 69
             + + L   P  Q G +L    +G ++     T K V D      S N  ++ +  +  
Sbjct: 274 NVEGYALDWSPSIQTGALLTGDCSGQIYFTQRHTSKWVTDKQPFTVSNNKSIEDIQWSRT 333

Query: 70  RGTVFATAADDG-VKLFDIRTR------GCVATLTDANGAPALSLDSRHGMLAFGTELVG 122
            GTVFA+A  DG ++++D R++         A+ TD N    +S   + G L    +  G
Sbjct: 334 EGTVFASAGCDGYIRIWDTRSKKHKPAISVKASNTDVN---VISWSDKLGYLLASGDDNG 390

Query: 123 VDAVVSLFAL----GEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLK 178
           V  V  L           +P+  + D H   +T + F+P D +++   S D  V ++DL 
Sbjct: 391 VWGVWDLRQFSPDTANSVQPVAQY-DFHKGAITSISFNPLDESIVAVASEDNTVTLWDLS 449

Query: 179 QSEEDEALHQ 188
              +DE + Q
Sbjct: 450 VEADDEEIKQ 459

 Score = 31.2 bits (69), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 12/67 (17%), Positives = 31/67 (46%)

Query: 134 EWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEEDEALHQVINFA 193
           +W    + F  S++  + D+++  T+  +  S   DGY+ ++D +  +   A+    +  
Sbjct: 309 KWVTDKQPFTVSNNKSIEDIQWSRTEGTVFASAGCDGYIRIWDTRSKKHKPAISVKASNT 368

Query: 194 SIHSCGW 200
            ++   W
Sbjct: 369 DVNVISW 375

>KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9
           YEL056W
          Length = 391

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 42/174 (24%), Positives = 85/174 (48%), Gaps = 9/174 (5%)

Query: 10  SFGADN-WCLRLRPLYQAGVLAALSNGHVHLVDWATGKSVLDVAAHESSINGL-QVLDSA 67
           S+  DN + L   P+ +  +L+A  +G++ + D    +S   V   +S+ N +   +   
Sbjct: 148 SYHKDNGYGLSFNPISKGQLLSAADDGYIAMYD-INAESEDPVETWQSTDNCIINDIKWH 206

Query: 68  HDRGTVFATAADDG--VKLFDIRTRGCVATLTDANGAPALSLDSRHGMLAFGTELVGVDA 125
           H   T+F T +++   + ++D+RT+  V ++       +L+  S+H    F     G D 
Sbjct: 207 HFDATLFGTVSEEKNTLSIYDLRTKDKVTSIEMEQPFNSLAF-SKHSKNLFSA--AGTDQ 263

Query: 126 VVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQ 179
            V L+ L    + L + +  H   VT+++FH +   +L+S S D  + ++DL +
Sbjct: 264 NVYLYDLRNTRKTLHS-MSGHEGPVTNLEFHDSVDGILVSSSEDRRIIIWDLME 316

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 30/60 (50%), Gaps = 1/60 (1%)

Query: 124 DAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEED 183
           +  VS+F       P++ +   H D+   + F+P     LLS + DGY+ +YD+    ED
Sbjct: 129 NGTVSIFDRNSSDSPVKTY-SYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAESED 187

>ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly
           similar to uniprot|Q04225 Saccharomyces cerevisiae
           YMR131C RRB1 RiboSome Assembly 2
          Length = 516

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 47/190 (24%), Positives = 84/190 (44%), Gaps = 17/190 (8%)

Query: 12  GADNWCLRLRPLYQAG-VLAALSNGHVHLVDWATGKSVLD----VAAHESSINGLQVLDS 66
             + + L   PL + G +L    +G + L    T K + D     AA+  S+  +Q    
Sbjct: 278 NVEGYGLDWSPLIKTGALLTGDCSGQIFLTQRHTSKWITDKQPFTAANNQSVEDIQW--- 334

Query: 67  AHDRGTVFATAADDG-VKLFDIRTRG---CVATLTDANGAPALSLDSRHGMLAFGTELVG 122
           +    TVFAT+  DG V+++D R++     ++T         +S + + G L    +  G
Sbjct: 335 SPTESTVFATSGTDGYVRIWDTRSKKHKPAISTRASNTDVNVISWNEKLGYLLASGDDNG 394

Query: 123 VDAVVSLF----ALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLK 178
              V  L     A  E  +P+  + D H   +T + F+P D +++   S D  V ++DL 
Sbjct: 395 SWGVWDLRQFSPANSEGVQPVAQY-DFHRGPITSISFNPLDDSVVAVASEDNTVTLWDLS 453

Query: 179 QSEEDEALHQ 188
              +D+ + Q
Sbjct: 454 VEADDDEIQQ 463

 Score = 37.7 bits (86), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 15/67 (22%), Positives = 34/67 (50%)

Query: 134 EWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEEDEALHQVINFA 193
           +W    + F  +++  V D+++ PT+S +  +  TDGYV ++D +  +   A+    +  
Sbjct: 313 KWITDKQPFTAANNQSVEDIQWSPTESTVFATSGTDGYVRIWDTRSKKHKPAISTRASNT 372

Query: 194 SIHSCGW 200
            ++   W
Sbjct: 373 DVNVISW 379

>KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} similar
           to uniprot|P39984 Saccharomyces cerevisiae YEL056W
          Length = 398

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 46/180 (25%), Positives = 83/180 (46%), Gaps = 13/180 (7%)

Query: 5   LQQKVSFGADN-WCLRLRPLYQAGVLAALSNGHVHLVDWATGKS--VLDVAAHESSINGL 61
           L  + SF  +N + L    +    +L+   +G + + D  +GK+  V    +H + +N  
Sbjct: 153 LTAEFSFHKENGYGLNFSVISPGELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNEC 212

Query: 62  QVLDSAHDRGT-VFATAADDGVKLF-DIRTRGCVATLTDANGAPALSLDSRHGMLAFGTE 119
           +     H++   +F + +DD   +  D R    V  +  +     L+  S+H    F   
Sbjct: 213 K----WHEKSPFLFGSVSDDSTLIIHDKRIDKPVVKILQSEPYNTLAF-SKHSSNLFAA- 266

Query: 120 LVGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQ 179
             G D+ V L+ L +   P+ + +  HHD VT ++F P    +L SGS+D  V ++DL Q
Sbjct: 267 -AGTDSQVQLYDLRKPEAPIHS-MSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQ 324

>Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {ON}
           YMR131C (RRB1) - RiboSome Assembly 2 [contig 204] FULL
          Length = 523

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 50/199 (25%), Positives = 86/199 (43%), Gaps = 39/199 (19%)

Query: 14  DNWCLRLRPLYQAG-VLAALSNGHVHLVDWATGKSVLDVAAHESSIN-GLQVLDSAHDRG 71
           + + L   PL ++G +L    +G V+L    T K + D  A  +  N  ++ +  +    
Sbjct: 287 EGYALDWSPLNKSGSLLTGDCSGRVYLTQRHTSKWITDKTAFSAGNNQSIEDIQFSRTEA 346

Query: 72  TVFATAADDG-VKLFDIRTR------GCVATLTDANGAPALSLDSRHG-MLAFGTELVGV 123
           TVFAT   DG ++++D R++         A+ TD N    +S + + G +LA G +    
Sbjct: 347 TVFATCGCDGYIRIWDTRSKKHKPAISVKASSTDVN---VISWNEKIGYLLASGDDN--- 400

Query: 124 DAVVSLFALGEWGR-PLRAFVDS-------------HHDDVTDVKFHPTDSNLLLSGSTD 169
                    G WG   LR F  +             H   +T + F+P D +++   S D
Sbjct: 401 ---------GTWGVWDLRQFSPNNAASVSPVAQYSFHKGAITSIAFNPLDDSIIAVASED 451

Query: 170 GYVNVYDLKQSEEDEALHQ 188
             V ++DL    +DE + Q
Sbjct: 452 NTVTLWDLSVEADDEEIKQ 470

 Score = 31.2 bits (69), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 12/67 (17%), Positives = 31/67 (46%)

Query: 134 EWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEEDEALHQVINFA 193
           +W     AF   ++  + D++F  T++ +  +   DGY+ ++D +  +   A+    +  
Sbjct: 320 KWITDKTAFSAGNNQSIEDIQFSRTEATVFATCGCDGYIRIWDTRSKKHKPAISVKASST 379

Query: 194 SIHSCGW 200
            ++   W
Sbjct: 380 DVNVISW 386

>KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {ON}
           highly similar to uniprot|Q04225 Saccharomyces
           cerevisiae YMR131C RRB1 RiboSome Assembly 2
          Length = 522

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/199 (24%), Positives = 87/199 (43%), Gaps = 39/199 (19%)

Query: 14  DNWCLRLRPLYQAG-VLAALSNGHVHLVDWATGKSVLDVAAHESSIN-GLQVLDSAHDRG 71
           + + L   PL ++G +L    +G V+L    T K + D  A  +  N  ++ +  +    
Sbjct: 286 EGYALDWSPLNKSGSLLTGDCSGRVYLTQRHTSKWITDKTAFSAGNNQSIEDIQFSRTEA 345

Query: 72  TVFATAADDG-VKLFDIRTR------GCVATLTDANGAPALSLDSRHG-MLAFGTELVGV 123
           TVFA+   DG ++++D R++         A+ TD N    +S + + G +LA G +    
Sbjct: 346 TVFASCGCDGYIRIWDTRSKKHKPAISVKASATDVN---VISWNEKIGYLLASGDDN--- 399

Query: 124 DAVVSLFALGEWGR-PLRAF-------------VDSHHDDVTDVKFHPTDSNLLLSGSTD 169
                    G WG   LR F              + H   +T + F+P D +++   S D
Sbjct: 400 ---------GSWGVWDLRQFSPNTAASTSPVAQYNFHKGAITSISFNPLDDSIIAVASED 450

Query: 170 GYVNVYDLKQSEEDEALHQ 188
             V+++DL    +DE + Q
Sbjct: 451 NTVSLWDLSVEADDEEIKQ 469

 Score = 32.0 bits (71), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 13/67 (19%), Positives = 31/67 (46%)

Query: 134 EWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEEDEALHQVINFA 193
           +W     AF   ++  + D++F  T++ +  S   DGY+ ++D +  +   A+    +  
Sbjct: 319 KWITDKTAFSAGNNQSIEDIQFSRTEATVFASCGCDGYIRIWDTRSKKHKPAISVKASAT 378

Query: 194 SIHSCGW 200
            ++   W
Sbjct: 379 DVNVISW 385

>TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON}
           Anc_2.401 YMR131C
          Length = 526

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 82/190 (43%), Gaps = 21/190 (11%)

Query: 11  FGADNWCLRLRPLYQAG-VLAALSNGHV-----HLVDWATGKSVLDVAAHESSINGLQVL 64
           FG D W     PL ++G +L    +G +     H   W T K    V  ++S    ++ +
Sbjct: 293 FGLD-WS----PLIKSGALLTGDCSGEIFLTSRHTSKWITEKQSFSVGNNKS----IEDI 343

Query: 65  DSAHDRGTVFATAADDG-VKLFDIRTRG---CVATLTDANGAPALSLDSRHGMLAFGTEL 120
             +    TVFATA  DG ++++D R++     ++T         +S + +   L    + 
Sbjct: 344 QWSKTEQTVFATAGCDGYIRIWDTRSKKHKPAISTRASNVDVNVISWNEKMEYLLASGDD 403

Query: 121 VGVDAVVSL--FALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLK 178
            GV  V  L  F+  +      A  D H   +T + F+P D + +   S D  V ++DL 
Sbjct: 404 KGVWGVWDLRQFSPSQENASPVAQYDFHKGAITSISFNPLDESTVAVASEDNTVTLWDLS 463

Query: 179 QSEEDEALHQ 188
              +DE + Q
Sbjct: 464 VEADDEEIKQ 473

>ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR131C
           (RRB1)
          Length = 521

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 50/191 (26%), Positives = 82/191 (42%), Gaps = 22/191 (11%)

Query: 13  ADNWCLRLRPLYQAG-VLAALSNGHVHLVD-----WATGKSVLDVAAHESSINGLQVLDS 66
            + + L   PL + G +L    +G V L       W T K    V  ++S    ++ +  
Sbjct: 285 VEGYGLDWSPLIKTGALLTGDCSGRVFLTQRTSSKWITDKQPFTVDNNKS----IEDIKW 340

Query: 67  AHDRGTVFATAADDG-VKLFDIRTRGCVATL------TDANGAPALSLDSRHGMLAFGTE 119
           +    TVFAT   DG V+++DIR++     L      TD N    +S + +   L    +
Sbjct: 341 SPSENTVFATCGVDGHVRIWDIRSKKHKPALSVKVSDTDVN---VMSWNQKISYLLATGD 397

Query: 120 LVGVDAVVSL--FALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDL 177
             G   V  L  F+  + G    A  D H   +T + F+P D +++   S D  V ++DL
Sbjct: 398 DNGTWGVWDLRQFSNQQGGVSPVAQYDFHKGAITSISFNPLDESIIAVASEDNTVTLWDL 457

Query: 178 KQSEEDEALHQ 188
               +DE + Q
Sbjct: 458 SVEADDEEIKQ 468

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 12/67 (17%), Positives = 34/67 (50%)

Query: 134 EWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEEDEALHQVINFA 193
           +W    + F   ++  + D+K+ P+++ +  +   DG+V ++D++  +   AL   ++  
Sbjct: 319 KWITDKQPFTVDNNKSIEDIKWSPSENTVFATCGVDGHVRIWDIRSKKHKPALSVKVSDT 378

Query: 194 SIHSCGW 200
            ++   W
Sbjct: 379 DVNVMSW 385

>NDAI0G05340 Chr7 (1301733..1303889) [2157 bp, 718 aa] {ON}
           Anc_1.247
          Length = 718

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 42/170 (24%), Positives = 69/170 (40%), Gaps = 42/170 (24%)

Query: 24  YQAGVLAALSNGHVHLVDWATGKSVLDVAAHESSINGLQVLDSAHDRGTVFATAADDGVK 83
           + A V+    +G V   D  TGK V  +  H SSI  L+      D   +   + D  V+
Sbjct: 571 FDAAVVTGTKDGIVRFWDLRTGKVVRHLEGHTSSITCLKF-----DSKNIITGSTDKTVR 625

Query: 84  LFDIRTRGCVATLTDANGAPALSLDSRHGMLAFGTELVGVDAVVSLFALGEWGRPLRAFV 143
           ++DIR  G +A                 G+L+F T ++ +D      A+G +   ++ + 
Sbjct: 626 VWDIRM-GTLA-----------------GLLSFDTPVLSLDFDTDKIAIGTYDESVKVY- 666

Query: 144 DSHHD-------DVTDVKFHPTD-----------SNLLLSGSTDGYVNVY 175
           D HHD       D  +V   P +           +  L+ G TDG +N +
Sbjct: 667 DRHHDEQWACREDYDNVDEAPAEISSKVETIRYKNGYLVDGRTDGTINTW 716

>TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa]
           {ON} Anc_6.9 YEL056W
          Length = 407

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 78/181 (43%), Gaps = 18/181 (9%)

Query: 8   KVSFGADN-WCLRLRPLYQAGVLAALSNGHVHLVDWATGKSVLDVAAHESSINGLQVLDS 66
           K+S   +N + L   PL +  +L++  +G V    W   KS+  +   E+SI    V  +
Sbjct: 164 KLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAY--WNIQKSIPLLTLQETSIIN-DVRWN 220

Query: 67  AHDRGTVFATAADDGVKLFDIRTRGCVATLTD--------ANGAPALSLDSRHGMLAFGT 118
             ++           + L D+R       +          A  A A S  S + M A G 
Sbjct: 221 QFNQNLFGYVTESSCLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGE 280

Query: 119 ELVGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLK 178
                D+++ L+      +PL  ++  H D VT + FH  +  +++SG +D  V V+DLK
Sbjct: 281 -----DSLIYLYDTRNLNQPLH-YMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLK 334

Query: 179 Q 179
           Q
Sbjct: 335 Q 335

>Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar to
           Ashbya gossypii ADR242C
          Length = 522

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 46/194 (23%), Positives = 83/194 (42%), Gaps = 25/194 (12%)

Query: 12  GADNWCLRLRPLYQAG-VLAALSNGHVHLVD-----WATGKSVLDVAAHESSINGLQVLD 65
             + + L   PL + G +L    +G V+L       W T K    V  ++S    ++ + 
Sbjct: 284 NVEGYGLDWSPLIKTGSILTGDCSGRVYLTQRTASRWVTDKQPFTVGNNKS----IEDIQ 339

Query: 66  SAHDRGTVFATAADDG-VKLFDIRTR------GCVATLTDANGAPALSLDSRHGMLAFGT 118
            +    TVFAT   DG ++++D R++        + + TD N    +S + + G L    
Sbjct: 340 WSRAEMTVFATCGVDGHIRIWDTRSKKHKPALSVMVSDTDVN---VMSWNEKIGYLLASG 396

Query: 119 ELVGVDAVVSLFALG----EWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNV 174
           +  G   V  L        E   P+  + + H   +T + F+P D +++   S D  V +
Sbjct: 397 DDSGTWGVWDLRQFSAQNTEKTTPVAQY-NFHKAAITSISFNPLDESIIAVASEDNTVTL 455

Query: 175 YDLKQSEEDEALHQ 188
           +DL    +DE + Q
Sbjct: 456 WDLSVEADDEEIKQ 469

>Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON}
           (183046..184224) [1179 nt, 393 aa]
          Length = 392

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 51/108 (47%), Gaps = 4/108 (3%)

Query: 73  VFATAADDG-VKLFDIRTRGCVATLTDANGAPALSLDSRHGMLAFGTELVGVDAVVSLFA 131
           +F + ++D  +KL D R+   V     A  A      S+H    F     G+D  + L+ 
Sbjct: 214 LFGSVSEDSTLKLHDKRSTSKVINTIQAKAAFNTLAFSKHSANLFAA--AGLDTNIYLYD 271

Query: 132 LGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQ 179
             +  +PL      H D +T ++FHP +  +L+SG  D  V ++DL +
Sbjct: 272 RRQTTKPLHVMA-GHEDAITCLQFHPKEDGILVSGGADRRVILWDLAE 318

 Score = 31.6 bits (70), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 46/98 (46%), Gaps = 3/98 (3%)

Query: 139 LRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQ-SEEDEALHQVINFASIHS 197
           LR  +  H ++   + F+P  SN L+SGS D  + ++D+   S+  +++   I+   ++ 
Sbjct: 145 LRTTLKYHKENGYGLSFNPNVSNELISGSDDFTIALWDIDSGSKSPKSVWDNIHSDIVND 204

Query: 198 CGW--LSPKRIWSLSHMETFAIHELNDKSEHANEPQPQ 233
           C W         S+S   T  +H+    S+  N  Q +
Sbjct: 205 CSWHHFDENLFGSVSEDSTLKLHDKRSTSKVINTIQAK 242

>Kpol_2002.99 s2002 (237070..238533) [1464 bp, 487 aa] {ON}
           (237070..238533) [1464 nt, 488 aa]
          Length = 487

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 50/113 (44%), Gaps = 5/113 (4%)

Query: 75  ATAADDGVKLFDIRTRGCVATLTDANGAPALSLDSRHGMLAFGTELVGVDAVVSLFALGE 134
           +T +D+ + L+D+RT      +  +  + A+  +    M AF   +   D     + +  
Sbjct: 231 STGSDNSIVLYDLRTNSPTQKIVQSMRSNAICWNP---MEAFNFVIANEDHNAYYYDMRN 287

Query: 135 WGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEEDEALH 187
             R L  F D H   V DV F PT + L+ +GS D  + +YD+      E  H
Sbjct: 288 MSRALNVFKD-HVSAVMDVDFSPTGTELV-TGSYDKTIRIYDIGHGHSREIYH 338

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 31/48 (64%)

Query: 148 DDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEEDEALHQVINFASI 195
           D+VT+VKF+ T++++L S  +D  + +YDL+ +   + + Q +   +I
Sbjct: 214 DNVTNVKFNQTETDILASTGSDNSIVLYDLRTNSPTQKIVQSMRSNAI 261

>KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.401
           YMR131C
          Length = 517

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 46/195 (23%), Positives = 84/195 (43%), Gaps = 23/195 (11%)

Query: 12  GADNWCLRLRPLYQAG-VLAALSNGHVHLVDWATGKSVLD----VAAHESSINGLQVLDS 66
             + + L   P+ + G +L    +G ++     T K + D     A +  S+  +Q    
Sbjct: 279 NVEGYALDWSPMIKNGALLTGDCSGQIYFTQRHTSKWITDKQPFTAENNKSVEDIQW--- 335

Query: 67  AHDRGTVFATAADDG-VKLFDIRTR------GCVATLTDANGAPALSLDSRHGMLAFGTE 119
           +    TVFA+A  DG ++++D R++         A+ TD N    +S   + G L    +
Sbjct: 336 SRTESTVFASAGCDGYIRIWDTRSKKHKPALSVKASNTDVN---VISWSEKIGYLLASGD 392

Query: 120 LVGVDAVVSLFALGEWG----RPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVY 175
             G+  V  L           +P+  + D H   +T + F+P D +++   S D  V ++
Sbjct: 393 DNGLWGVWDLRQFSPDNINDVQPVAQY-DFHKGAITSINFNPLDDSIIAVASEDNTVTLW 451

Query: 176 DLKQSEEDEALHQVI 190
           DL    +DE + Q I
Sbjct: 452 DLSVEADDEEIKQQI 466

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 14/67 (20%), Positives = 31/67 (46%)

Query: 134 EWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEEDEALHQVINFA 193
           +W    + F   ++  V D+++  T+S +  S   DGY+ ++D +  +   AL    +  
Sbjct: 314 KWITDKQPFTAENNKSVEDIQWSRTESTVFASAGCDGYIRIWDTRSKKHKPALSVKASNT 373

Query: 194 SIHSCGW 200
            ++   W
Sbjct: 374 DVNVISW 380

>KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401
           YMR131C
          Length = 516

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 50/204 (24%), Positives = 84/204 (41%), Gaps = 45/204 (22%)

Query: 12  GADNWCLRLRPLYQAG-VLAALSNGHVHLVDWATGKSVLD----VAAHESSINGLQVLDS 66
             + + L   PL + G +L    +G ++L    T K V D       +  S+  +Q    
Sbjct: 278 NVEGYALDWSPLIKTGALLTGDCSGQIYLTQRNTSKWVTDKQPFTVGNNKSVEDIQW--- 334

Query: 67  AHDRGTVFATAADDG-VKLFDIRTR------GCVATLTDANGAPALSLDSRHG-MLAFGT 118
           +    TVFA+   DG V+++D R++         A+ TD N    +S + + G +LA G 
Sbjct: 335 SRTEATVFASCGCDGYVRIWDTRSKQHKPALSVKASNTDVN---VISWNEKIGYLLASGD 391

Query: 119 ELVGVDAVVSLFALGEWGR-PLRAFV-------------DSHHDDVTDVKFHPTDSNLLL 164
           +             G WG   LR F              D H   +T + F+P + +++ 
Sbjct: 392 DN------------GSWGVWDLRQFTPDNINNVQPVAQYDFHKGAITSISFNPLEESIIA 439

Query: 165 SGSTDGYVNVYDLKQSEEDEALHQ 188
             S D  V ++DL    +DE + Q
Sbjct: 440 VASEDNTVTLWDLSVEADDEEIKQ 463

 Score = 30.8 bits (68), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 14/67 (20%), Positives = 31/67 (46%)

Query: 134 EWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEEDEALHQVINFA 193
           +W    + F   ++  V D+++  T++ +  S   DGYV ++D +  +   AL    +  
Sbjct: 313 KWVTDKQPFTVGNNKSVEDIQWSRTEATVFASCGCDGYVRIWDTRSKQHKPALSVKASNT 372

Query: 194 SIHSCGW 200
            ++   W
Sbjct: 373 DVNVISW 379

>KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} highly
           similar to uniprot|Q04225 Saccharomyces cerevisiae
           YMR131C RRB1 essential nuclear protein involved in early
           steps of ribosome biogenesis
          Length = 523

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 50/197 (25%), Positives = 88/197 (44%), Gaps = 37/197 (18%)

Query: 13  ADNWCLRLRPLYQAG-VLAALSNGHV-----HLVDWATGKSVLDVAAHESSINGLQVLDS 66
           A++W     P+ + G +L+   +G V     H   W T K    VA ++S    ++ L  
Sbjct: 290 ANDWS----PIIKTGAMLSGDCSGQVFLTQRHTSKWITDKQAFTVANNKS----IEDLQW 341

Query: 67  AHDRGTVFATAADDG-VKLFDIRTR------GCVATLTDANGAPALSLDSRHG-MLAFGT 118
           +    TVFA+   DG ++++D R++         A+ TD N    +S   + G +LA G 
Sbjct: 342 SRTESTVFASCGIDGYIRIWDTRSKKHKPAISVKASNTDVN---VISWSEKIGYLLASGD 398

Query: 119 ELVGVDAVVSLFALGEWGRPLRAFVDS-------HHDDVTDVKFHPTDSNLLLSGSTDGY 171
           +    D    ++ L ++  P  A   S       H   +T + F+P D +++   S D  
Sbjct: 399 D----DGTWGVWDLRQF-TPQNASTASPVAQYQFHKGAITSISFNPLDESIIAVASEDNT 453

Query: 172 VNVYDLKQSEEDEALHQ 188
           V ++DL    +DE + Q
Sbjct: 454 VTLWDLSVEADDEEIKQ 470

 Score = 32.0 bits (71), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 13/67 (19%), Positives = 33/67 (49%)

Query: 134 EWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEEDEALHQVINFA 193
           +W    +AF  +++  + D+++  T+S +  S   DGY+ ++D +  +   A+    +  
Sbjct: 320 KWITDKQAFTVANNKSIEDLQWSRTESTVFASCGIDGYIRIWDTRSKKHKPAISVKASNT 379

Query: 194 SIHSCGW 200
            ++   W
Sbjct: 380 DVNVISW 386

>Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 520
           aa] {ON} ANNOTATED BY YGOB -
          Length = 520

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/193 (24%), Positives = 81/193 (41%), Gaps = 23/193 (11%)

Query: 12  GADNWCLRLRPLYQAG-VLAALSNGHVHLVDWATGKSVLD----VAAHESSINGLQVLDS 66
             + + L   PL + G +L    +G V+L    T K + D      A+  S+  +Q    
Sbjct: 282 NVEGYALDWSPLIKTGALLTGDCSGQVYLTQRHTSKWISDKEPFTVANNQSVEDIQW--- 338

Query: 67  AHDRGTVFATAADDG-VKLFDIRTR------GCVATLTDANGAPALSLDSRHGMLAFGTE 119
           +    TVFA+   DG ++++D R++         A+ TD N    +S   + G L    +
Sbjct: 339 SRTESTVFASCGCDGYIRVWDTRSKKHKPAISVKASNTDVN---VISWSEKIGYLLASGD 395

Query: 120 LVGVDAVVSLFALGEWGR----PLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVY 175
             G   V  L            P+  + D H   +T + F+P D +++   S D  V ++
Sbjct: 396 DNGTWGVWDLRQFSPSNSNNTSPVAQY-DFHKGAITSISFNPLDESIVAVASEDNTVTLW 454

Query: 176 DLKQSEEDEALHQ 188
           DL    +DE + Q
Sbjct: 455 DLSVEADDEEIKQ 467

 Score = 31.2 bits (69), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 14/68 (20%), Positives = 31/68 (45%)

Query: 133 GEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEEDEALHQVINF 192
            +W      F  +++  V D+++  T+S +  S   DGY+ V+D +  +   A+    + 
Sbjct: 316 SKWISDKEPFTVANNQSVEDIQWSRTESTVFASCGCDGYIRVWDTRSKKHKPAISVKASN 375

Query: 193 ASIHSCGW 200
             ++   W
Sbjct: 376 TDVNVISW 383

>CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056w HAT2
          Length = 419

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 59/131 (45%), Gaps = 14/131 (10%)

Query: 53  AHESSINGLQVLDS-AHDRGTVFATAADDGVKLFDIRTRGCVATLTDANGAPALSLDSRH 111
           AH   IN ++   S AH  G+V   + D  +KLFD R+   +  +        L+     
Sbjct: 225 AHTDIINDVKWHSSEAHIFGSV---SEDSTMKLFDKRSSQIIHNINTKKPYNTLAFS--- 278

Query: 112 GMLAFGTEL---VGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGST 168
               F + L    G D +V L+ + +   PL A    H D VT ++F P +  +L S  +
Sbjct: 279 ---PFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMT-GHEDAVTAIEFDPNNDGILYSSGS 334

Query: 169 DGYVNVYDLKQ 179
           D    V+DL++
Sbjct: 335 DRRTIVWDLQE 345

 Score = 35.0 bits (79), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 44/190 (23%), Positives = 83/190 (43%), Gaps = 9/190 (4%)

Query: 137 RPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEEDEALHQVINFASIH 196
           +P   F D+H D + DVK+H +++++  S S D  + ++D + S   + +H  IN    +
Sbjct: 217 KPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSS---QIIHN-INTKKPY 272

Query: 197 SCGWLSPKRIWSLSHMETFAIHELNDKSEHANEPQPQLFGDVREPWACDYVVDVYPGFIA 256
           +    SP      +   T  +  L D  + +N P   + G      A ++  +      +
Sbjct: 273 NTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSN-PLYAMTGHEDAVTAIEFDPNNDGILYS 331

Query: 257 AGSTRE----NAGELRLLPLRDECVDAANAIVLPQAHGDEVVRDVLVPASSPELLYSAGE 312
           +GS R     +  E+     +DE  D    +++  A     + D+ V  +   L+ SA E
Sbjct: 332 SGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINWLVASAEE 391

Query: 313 DGNMAIWKST 322
           D  + IWK +
Sbjct: 392 DNIVQIWKCS 401

>TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON}
           Anc_6.276 YPL247C Two N bases added to fix a frameshift
           that can't be corrected using the reads.
          Length = 447

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 68/149 (45%), Gaps = 18/149 (12%)

Query: 51  VAAHESSINGLQVLDSAHDRGTVFATAADDG-VKLFDIRTRG---CVATLTDANGAPALS 106
           + AH+S +  ++ L  +     +FA+   DG V++FD+R       +   T  +GAP L 
Sbjct: 250 LIAHDSEVFDVRFLTQSTQ---LFASCGGDGSVRVFDLRCLAHSTIIYEPTIPDGAPDLP 306

Query: 107 LDSRHGML------AFGTELVGVDAV----VSLFALGEWGRPLRAFVDSHHDDVTDVKFH 156
             +    L       F   ++   A+    V +  +   G PL   +++H   +  +K+H
Sbjct: 307 SPTVPPALLRLEPSPFDPNVIATFAIDSSKVLILDMRSPGSPLLT-LEAHTAPINQIKWH 365

Query: 157 PTDSNLLLSGSTDGYVNVYDLKQSEEDEA 185
           PT  N+LLS S D  V  +DL    + E+
Sbjct: 366 PTRRNVLLSASDDCQVLYWDLNTHLDSES 394

>SAKL0D03740g Chr4 (303240..304676) [1437 bp, 478 aa] {ON} similar
           to uniprot|Q12021 Saccharomyces cerevisiae YDR030C RAD28
           Protein involved in transcription-coupled repair
           nucleotide excision repair of UV-induced DNA lesions
           homolog of human CSA protein
          Length = 478

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 28/119 (23%), Positives = 58/119 (48%), Gaps = 14/119 (11%)

Query: 67  AHDRGTVFATAADDGVKLFDIRTRGCVATLTDANGAPALSLDSRHGMLAFGTE-----LV 121
           +HD G  F  ++D  VK++D      V       G     LD++  ++   +E     ++
Sbjct: 212 SHDNGMFFTGSSDREVKIWDTNEFEVVQNF--QLGYRVNQLDTKGDLVIVASEDTYPRVI 269

Query: 122 GVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQS 180
            + ++ S+ +LG   + ++  +++        KF P  ++L+ SG  DG V ++DL++S
Sbjct: 270 DLKSMSSVISLGVKNKKMKFGINT-------AKFAPMGTDLVASGDDDGNVRIWDLRKS 321

>TBLA0H02000 Chr8 complement(474850..476271) [1422 bp, 473 aa] {ON}
           Anc_5.201 YLL011W
          Length = 473

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 47/113 (41%), Gaps = 5/113 (4%)

Query: 75  ATAADDGVKLFDIRTRGCVATLTDANGAPALSLDSRHGMLAFGTELVGVDAVVSLFALGE 134
           +T +D+ + L+D+RT      +       +L  +    M AF       D     + +  
Sbjct: 230 STGSDNSIVLYDLRTNSPTQKIVQTMRTNSLCWNP---MEAFNFVTANEDQNSYYYDMRY 286

Query: 135 WGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEEDEALH 187
             R L  F D H   V DV F PT   ++ +GS D  + +Y++K     E  H
Sbjct: 287 MSRALNVFKD-HVSAVMDVDFSPTGQEIV-TGSYDKTIRIYNIKHGHSREIYH 337

 Score = 31.2 bits (69), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 29/48 (60%)

Query: 148 DDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEEDEALHQVINFASI 195
           D+VT+VKF+  + ++L S  +D  + +YDL+ +   + + Q +   S+
Sbjct: 213 DNVTNVKFNQNEHDILASTGSDNSIVLYDLRTNSPTQKIVQTMRTNSL 260

>Skud_11.271 Chr11 complement(490869..492809) [1941 bp, 646 aa] {ON}
           YKR036C (REAL)
          Length = 646

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 37/155 (23%), Positives = 70/155 (45%), Gaps = 25/155 (16%)

Query: 46  KSVLDVAAHESSINGLQVLDSAHDRGTVFATAADDGVKLFDIRTRGCVATLT-----DAN 100
           ++++    H   ++  ++   + D   + + + D  +  +D+ T  CV  L        N
Sbjct: 413 ETIITPCIHNFELHNDEITALSFDSEALISGSKDKKIFHWDLATGKCVQELNLIFTPTHN 472

Query: 101 GAPALSLDSRHGMLAFGTE--LVGV-------------DAVVSLFALGEWGRPLRAFVDS 145
                +   ++G    GTE  ++G              D VV L+ L   G+P+R+ ++ 
Sbjct: 473 DTKTSTRSGKNGTYLLGTEAPMIGALQCYNSALATGTKDGVVRLWDL-RIGKPVRS-LEG 530

Query: 146 HHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQS 180
           H D +T +KF   DS  L++GS D  V ++DL+ S
Sbjct: 531 HTDGITSLKF---DSEKLVTGSMDNSVRIWDLRTS 562

>Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)
          Length = 401

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 50/185 (27%), Positives = 81/185 (43%), Gaps = 19/185 (10%)

Query: 5   LQQKVSFGADN-WCLRLRPLYQAGVLAALSNGHVHLVDWATGKSVLDVAAHESSINGLQV 63
           LQ  + F  DN + L   PL +  +L+   +  V L D + G            ++   V
Sbjct: 152 LQSTLKFHKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIV 211

Query: 64  LDSA-HD-RGTVFATAADDGV-KLFDIRTRGCVATLTDANGAP------ALSLDSRHGML 114
            DS  H+    +F T ++D + K+ DIR      T  D    P      A S  S + + 
Sbjct: 212 NDSKWHNFNKDLFGTVSEDSLLKINDIRAEN---TTIDTAKCPQPFNTLAFSHHSSNILA 268

Query: 115 AFGTELVGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNV 174
           A      G+D+ V L+ L     PL   +  H D VT+++F P    +++S  +D  + +
Sbjct: 269 A-----AGMDSHVYLYDLRNMKEPLH-HMSGHEDAVTNLEFSPHVDGVVVSSGSDNRLIM 322

Query: 175 YDLKQ 179
           +DLKQ
Sbjct: 323 WDLKQ 327

>Suva_11.268 Chr11 complement(492639..494576) [1938 bp, 645 aa] {ON}
           YKR036C (REAL)
          Length = 645

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 47/80 (58%), Gaps = 10/80 (12%)

Query: 102 APAL-SLDSRHGMLAFGTELVGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDS 160
           AP + +L   +  LA GT+    D VV L+ L   G+P+RA ++ H D +T +KF   DS
Sbjct: 491 APMIGALQCYNSALASGTK----DGVVRLWDL-RIGKPVRA-LEGHTDGITSLKF---DS 541

Query: 161 NLLLSGSTDGYVNVYDLKQS 180
             L++GS D  V ++DL+ S
Sbjct: 542 EKLVTGSMDNSVRIWDLRTS 561

>NCAS0B07840 Chr2 complement(1486900..1488669) [1770 bp, 589 aa]
           {ON} Anc_1.247
          Length = 589

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 33/135 (24%), Positives = 64/135 (47%), Gaps = 18/135 (13%)

Query: 62  QVLDSAHDRGTVFATAADDGVKLFDIRTRGCVATL---------TDANGAPALSLDSRHG 112
           ++   ++D   + + + D  ++ +D+ T  CV TL         T+   +   +L S   
Sbjct: 393 EITSVSYDNEYLLSASRDKSIRQWDLTTGNCVQTLEATLSHNSGTNIKDSTVEALQSVGA 452

Query: 113 MLAFGTELVGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYV 172
            LA G++    D ++ L+ L   G+ +R  +  H   +T ++F   DS  +++GSTD  +
Sbjct: 453 ALATGSK----DGIIRLWDLRS-GKVVRTLL-KHQGPITSLQF---DSTKIITGSTDANI 503

Query: 173 NVYDLKQSEEDEALH 187
           +V DL+     E  H
Sbjct: 504 SVSDLRTGNILETYH 518

>SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 398

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 35/117 (29%), Positives = 57/117 (48%), Gaps = 11/117 (9%)

Query: 75  ATAADDGVKLFDIRTRGCVATLTDANGAPALSLD-SRHGMLAFGTELVGVDAVVSLFALG 133
           + + D  +++ D RT   V  LT +  +P  +LD S+H    F     G D++V L+ L 
Sbjct: 224 SVSEDKTLQIHDKRTNSTVHRLTLS--SPFNTLDFSKHSQNLFAA--AGTDSLVYLYDLR 279

Query: 134 EWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDL-----KQSEEDEA 185
                L   +  H D VT ++F P    +L S  +D  V ++DL     +Q++ED A
Sbjct: 280 NTADALHT-MSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAA 335

>ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 393

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 47/111 (42%), Gaps = 3/111 (2%)

Query: 69  DRGTVFATAADDGVKLFDIRTRGCVATLTDANGAPALSLDSRHGMLAFGTELVGVDAVVS 128
           D+    + + D  ++L D R R        A         S H    F     G D++V 
Sbjct: 212 DQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAA--AGTDSMVY 269

Query: 129 LFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQ 179
           L+      +PL   +  H D VT ++FHP +  +L+S  +D    ++DL +
Sbjct: 270 LYDRRRASKPLH-MMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAE 319

 Score = 33.9 bits (76), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 29/57 (50%), Gaps = 2/57 (3%)

Query: 133 GEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEEDEALHQV 189
           G+   P+  F D H D V D K+H  D N+  S S D  + ++D  Q   D A+ +V
Sbjct: 186 GKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHD--QRIRDAAVEKV 240

>Ecym_2024 Chr2 complement(35886..39839) [3954 bp, 1317 aa] {ON}
           similar to Ashbya gossypii ADL186C
          Length = 1317

 Score = 40.4 bits (93), Expect = 0.009,   Method: Composition-based stats.
 Identities = 17/45 (37%), Positives = 26/45 (57%)

Query: 136 GRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQS 180
           G PL A    H   +  V F+   +NL++SG  DGY+ V+DL+ +
Sbjct: 230 GSPLVATYSEHSRSINSVDFNMGQTNLIISGGQDGYIKVWDLRST 274

>Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON}
           YOL138C - Hypothetical ORF [contig 124] FULL
          Length = 1286

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 34/65 (52%), Gaps = 3/65 (4%)

Query: 120 LVGVDAVVSLFALGEWGR---PLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYD 176
           + G    VS++ + +      PL   +  H   +  V F+   S+LL+SGS DG + V+D
Sbjct: 183 ICGTSTSVSIYDINKANTLEGPLTTILSKHTRSINSVDFNMAQSSLLISGSQDGCIKVWD 242

Query: 177 LKQSE 181
           L+ S+
Sbjct: 243 LRSSQ 247

>Kpol_1028.54 s1028 (125940..128657) [2718 bp, 905 aa] {ON}
           (125940..128657) [2718 nt, 906 aa]
          Length = 905

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 48/223 (21%), Positives = 97/223 (43%), Gaps = 26/223 (11%)

Query: 2   SYILQQKVSFGADNWCLRLRPLYQAGVLAALSN---GHVHLVDWATGKSVLDVAAHESSI 58
           S+ L Q++S G +   +    +   G   A  +   G + + +W +   +L    H  S+
Sbjct: 284 SFTLVQQLSMGQN--AVNTVSINNTGEWLAFGSSALGQLLVYEWQSESYILKQQGHFDSL 341

Query: 59  NGLQVLDSAHDRGTVFATAADDG-VKLFDIRTRGCVATLTDANGAPALSLDSRHGMLAFG 117
           NGL    +    G    TAA+DG +K++D+ +  C+AT ++   +      ++ G + F 
Sbjct: 342 NGL----TYSPDGARVVTAANDGKIKVWDVVSGFCLATFSEHTSSVTAVQFAKRGQVLFS 397

Query: 118 TELVGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGY-VNVYD 176
           + L G      L       R  R F  +       +   P+   ++ +GS+D + ++V+ 
Sbjct: 398 SSLDGTVRAWDLIRF----RNFRTFTSTQRIPFNCLAVDPS-GEVVCAGSSDSFEIHVWS 452

Query: 177 LKQSEEDEAL--HQ----VINFAS----IHSCGWLSPKRIWSL 209
           ++  +  ++L  H+     + F+     + S  W    RIWS+
Sbjct: 453 VQTGQLLDSLDGHEGPVSCLAFSQENSVLASASWDKTIRIWSI 495

>Smik_3.157 Chr3 complement(218522..221296) [2775 bp, 924 aa] {ON}
           YCR057C (REAL)
          Length = 924

 Score = 39.7 bits (91), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 42/187 (22%), Positives = 82/187 (43%), Gaps = 21/187 (11%)

Query: 35  GHVHLVDWATGKSVLDVAAHESSINGLQVLDSAHDRGTVFATAADDG-VKLFDIRTRGCV 93
           G + + +W +   +L    H  S N L    +    G+   TA+DDG +K++DI +  C+
Sbjct: 323 GQLLVYEWQSESYILKQQGHFDSTNSL----AYSPDGSRVVTASDDGKIKVWDITSGFCL 378

Query: 94  ATLTDANGAPALSLDSRHGMLAFGTELVGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDV 153
           AT  +   +      ++ G + F + L   D  V  + L  + R  R F  +       +
Sbjct: 379 ATFEEHTSSVTAVQFAKRGQVMFSSSL---DGTVRAWDLIRY-RNFRTFTGTERIQFNCL 434

Query: 154 KFHPTDSNLLLSGSTDGY-VNVYDLKQSEEDEALH------QVINFAS----IHSCGWLS 202
              P+   ++ +GS D + ++V+ ++  +  +AL         ++F+     + S  W  
Sbjct: 435 AVDPS-GEVVCAGSLDNFDIHVWSVQTGQLLDALSGHEGPVSCLSFSQENSVLASASWDK 493

Query: 203 PKRIWSL 209
             RIWS+
Sbjct: 494 TIRIWSI 500

>Skud_3.133 Chr3 complement(204741..207488) [2748 bp, 916 aa] {ON}
           YCR057C (REAL)
          Length = 916

 Score = 39.3 bits (90), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 42/187 (22%), Positives = 82/187 (43%), Gaps = 21/187 (11%)

Query: 35  GHVHLVDWATGKSVLDVAAHESSINGLQVLDSAHDRGTVFATAADDG-VKLFDIRTRGCV 93
           G + + +W +   +L    H  S N L    +    G+   TA+DDG +K++DI +  C+
Sbjct: 320 GQLLVYEWQSESYILKQQGHFDSTNCL----AYSPDGSRVVTASDDGKIKVWDITSGFCL 375

Query: 94  ATLTDANGAPALSLDSRHGMLAFGTELVGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDV 153
           AT  +   +      ++ G + F + L   D  V  + L  + R  R F  +       +
Sbjct: 376 ATFEEHTSSVTAVQFAKRGQVMFSSSL---DGTVRAWDLIRY-RNFRTFTGTERIQFNCL 431

Query: 154 KFHPTDSNLLLSGSTDGY-VNVYDLKQSEEDEALH------QVINFAS----IHSCGWLS 202
              P+   ++ +GS D + ++V+ ++  +  +AL         ++F+     + S  W  
Sbjct: 432 AVDPS-GEVVCAGSLDNFDIHVWSVQTGQLLDALSGHEGPVSCLSFSQENSVLASASWDK 490

Query: 203 PKRIWSL 209
             RIWS+
Sbjct: 491 TIRIWSI 497

>YKR036C Chr11 complement(508702..510633) [1932 bp, 643 aa] {ON}
           CAF4WD40 repeat-containing protein associated with the
           CCR4-NOT complex, interacts in a Ccr4p-dependent manner
           with Ssn2p; also interacts with Fis1p, Mdv1p and Dnm1p
           and plays a role in mitochondrial fission
          Length = 643

 Score = 38.9 bits (89), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 46/80 (57%), Gaps = 10/80 (12%)

Query: 102 APAL-SLDSRHGMLAFGTELVGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDS 160
           AP + +L   +  LA GT+    D +V L+ L   G+P+R  ++ H D +T +KF   DS
Sbjct: 489 APMIGALQCYNSALATGTK----DGIVRLWDL-RVGKPVR-LLEGHTDGITSLKF---DS 539

Query: 161 NLLLSGSTDGYVNVYDLKQS 180
             L++GS D  V ++DL+ S
Sbjct: 540 EKLVTGSMDNSVRIWDLRTS 559

>AAR057W Chr1 (442821..445589) [2769 bp, 922 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR057C (PWP2)
          Length = 922

 Score = 38.9 bits (89), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 41/187 (21%), Positives = 82/187 (43%), Gaps = 21/187 (11%)

Query: 35  GHVHLVDWATGKSVLDVAAHESSINGLQVLDSAHDRGTVFATAADDG-VKLFDIRTRGCV 93
           G + + +W +   +L    H  ++N L    +    G    TAA+DG +K++DI +  C+
Sbjct: 336 GQLLVYEWQSESYILKQQGHFDALNAL----AYSPDGARIVTAAEDGKIKIWDIVSGFCL 391

Query: 94  ATLTDANGAPALSLDSRHGMLAFGTELVGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDV 153
           AT  +   +      +++G + F + L   D  V  + L  + R  R F  +     + +
Sbjct: 392 ATFEEHTSSVTSVQFAKNGQIMFSSSL---DGTVKAWDLMRF-RNFRTFTATERIQFSCL 447

Query: 154 KFHPTDSNLLLSGSTDGY-VNVYDLKQSEEDEALH------QVINFAS----IHSCGWLS 202
              PT   ++ +GS D Y + V+ ++  +  + L         ++F+     + S  W  
Sbjct: 448 AADPT-GEVVCAGSLDNYDIQVWSVQTGQLLDTLSGHEGPVSCLSFSRENSILASASWDK 506

Query: 203 PKRIWSL 209
             R+WS+
Sbjct: 507 TIRVWSI 513

>KLTH0D05346g Chr4 complement(475917..477440) [1524 bp, 507 aa] {ON}
           highly similar to uniprot|Q04305 Saccharomyces
           cerevisiae YMR093W UTP15 Nucleolar protein component of
           the small subunit (SSU) processome containing the U3
           snoRNA that is involved in processing of pre-18S rRNA
          Length = 507

 Score = 38.5 bits (88), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 53/116 (45%), Gaps = 14/116 (12%)

Query: 74  FATAADDGVKLFDIRTRGCVATLT---DANGAPALSLDSRHGMLAFGTELVGVDAV--VS 128
           FA  +   V+LF  RTR  + T +   D   + +   D +  +LA G      DA   VS
Sbjct: 55  FAITSSTRVQLFSSRTRQVIKTFSRFKDVVYSASFRQDGK--LLAMG------DATGRVS 106

Query: 129 LFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEEDE 184
           ++        L +   S H      KFHP DS  L++ S D  V V+D+ Q++E +
Sbjct: 107 IYDSYNPRTQLVSIAASSHPTHV-AKFHPADSRTLVTASDDRVVRVWDITQAQEPQ 161

 Score = 31.6 bits (70), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 36/72 (50%), Gaps = 11/72 (15%)

Query: 148 DDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEEDEALHQ--------VINFASIHSCG 199
           D V  V   P   +L+++GS DG+V ++D + +E    L Q         ++   + SCG
Sbjct: 169 DYVRSVCMVPQAPHLVVTGSYDGFVRLFDTRSNEAATTLVQGMPVEDVIAVSPTQLVSCG 228

Query: 200 WLSPK-RIWSLS 210
              PK ++W L+
Sbjct: 229 --GPKFKVWDLT 238

>YCR057C Chr3 complement(220457..223228) [2772 bp, 923 aa] {ON}
           PWP2Conserved 90S pre-ribosomal component essential for
           proper endonucleolytic cleavage of the 35 S rRNA
           precursor at A0, A1, and A2 sites; contains eight
           WD-repeats; PWP2 deletion leads to defects in cell cycle
           and bud morphogenesis
          Length = 923

 Score = 38.5 bits (88), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 41/187 (21%), Positives = 82/187 (43%), Gaps = 21/187 (11%)

Query: 35  GHVHLVDWATGKSVLDVAAHESSINGLQVLDSAHDRGTVFATAADDG-VKLFDIRTRGCV 93
           G + + +W +   +L    H  S N L    +    G+   TA++DG +K++DI +  C+
Sbjct: 325 GQLLVYEWQSESYILKQQGHFDSTNSL----AYSPDGSRVVTASEDGKIKVWDITSGFCL 380

Query: 94  ATLTDANGAPALSLDSRHGMLAFGTELVGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDV 153
           AT  +   +      ++ G + F + L   D  V  + L  + R  R F  +       +
Sbjct: 381 ATFEEHTSSVTAVQFAKRGQVMFSSSL---DGTVRAWDLIRY-RNFRTFTGTERIQFNCL 436

Query: 154 KFHPTDSNLLLSGSTDGY-VNVYDLKQSEEDEALH------QVINFAS----IHSCGWLS 202
              P+   ++ +GS D + ++V+ ++  +  +AL         ++F+     + S  W  
Sbjct: 437 AVDPS-GEVVCAGSLDNFDIHVWSVQTGQLLDALSGHEGPVSCLSFSQENSVLASASWDK 495

Query: 203 PKRIWSL 209
             RIWS+
Sbjct: 496 TIRIWSI 502

>Kwal_26.7736 s26 complement(491687..493210) [1524 bp, 507 aa] {ON}
           YMR093W (UTP15) - Protein required for cell viability
           [contig 55] FULL
          Length = 507

 Score = 38.1 bits (87), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 35/117 (29%), Positives = 55/117 (47%), Gaps = 16/117 (13%)

Query: 74  FATAADDGVKLFDIRTRGCVATLT---DANGAPALSLDSRHGMLAFGTELVGVDAV--VS 128
           FA  +   V+LF  RTR  + T +   D   + +   D +  +LA G      DA   VS
Sbjct: 55  FAITSSTRVQLFSSRTRQVIKTFSRFKDVVYSASFRQDGK--LLAMG------DATGRVS 106

Query: 129 LF-ALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEEDE 184
           ++ +     + +     SH   V   KFHP DS  L++ S D  V V+D+ Q++E +
Sbjct: 107 VYDSYNPRAQLVSIAASSHPTHVA--KFHPADSRTLVTASDDRVVRVWDITQAQEPQ 161

 Score = 31.2 bits (69), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 35/72 (48%), Gaps = 11/72 (15%)

Query: 148 DDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEEDEALHQ--------VINFASIHSCG 199
           D V  V   P   +L+++GS DG V ++D + +E    L Q         ++   + SCG
Sbjct: 169 DYVRSVCMVPQAPHLVVTGSYDGQVRLFDTRTNERATTLAQGMPVEDVIAVSATQLVSCG 228

Query: 200 WLSPK-RIWSLS 210
              PK ++W L+
Sbjct: 229 --GPKFKVWDLT 238

>ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL056W (HAT2)
          Length = 423

 Score = 37.7 bits (86), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 51/109 (46%), Gaps = 6/109 (5%)

Query: 73  VFATAADDG-VKLFDIRTR-GCVATLTDANGAPALSLDSRHGMLAFGTELVGVDAVVSLF 130
           VF T ++D  +++ D R R   V  L  A+    LS  S+H          GVD+ + L+
Sbjct: 245 VFGTVSEDKTLQVHDKRVRLEPVKKLPTASPFNTLSF-SKHSRNLLAA--AGVDSQIYLY 301

Query: 131 ALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQ 179
            + +   PL   +  H D VT V+F P    ++ S  +D    ++DL Q
Sbjct: 302 DMRDMSSPLHV-MSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQ 349

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 37/71 (52%), Gaps = 7/71 (9%)

Query: 114 LAFGTELVGV------DAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGS 167
           LAF   + G       D  V+L+ +    +P ++ + SH D V DVK+H  +SN+  + S
Sbjct: 192 LAFNPHISGELLSGSDDTTVALWDIEAAKKP-KSILTSHDDIVNDVKWHEFESNVFGTVS 250

Query: 168 TDGYVNVYDLK 178
            D  + V+D +
Sbjct: 251 EDKTLQVHDKR 261

>KLTH0F19294g Chr6 complement(1560167..1561522) [1356 bp, 451 aa]
           {ON} similar to uniprot|P42841 Saccharomyces cerevisiae
           YNL317W PFS2 Integral subunit of the pre-mRNA cleavage
           and polyadenylation factor (CPF) complex plays an
           essential role in mRNA 3'-end formation by bridging
           different processing factors and thereby promoting the
           assembly of the processing complex
          Length = 451

 Score = 37.7 bits (86), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 77/166 (46%), Gaps = 19/166 (11%)

Query: 36  HVHLVDW-ATGKSVLDVAAHESSINGLQVLDSAHD---RG-------TVFATAADDGV-K 83
           + H  DW  +G S   +   + + N ++VLD AH    RG       + F T +DD + K
Sbjct: 133 YSHAGDWLISGDSDGTIKIWQPNFNMVKVLDEAHTQCIRGISFSGTDSKFVTCSDDNILK 192

Query: 84  LFDIRTRGCVATLTDAN-GAPALSLDSRHGMLAFGTELVGVDAVVSLFALGEWGRPLRAF 142
           +++       +TLT  +    +       G++A G++    D ++ L+     G+ +   
Sbjct: 193 IWNFSNGQQESTLTGHHWDVRSCDWHPTMGLIASGSK----DNLIKLWDPRS-GQCISTI 247

Query: 143 VDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEEDEALHQ 188
           +   H  +   KF PT  N+L   S D    V+D++Q+ ++ A+++
Sbjct: 248 LGCKHT-IISTKFQPTKGNMLAVISKDKSCRVFDIRQNMKELAVYR 292

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 25/117 (21%), Positives = 54/117 (46%), Gaps = 8/117 (6%)

Query: 71  GTVFATAADDGVKLFDIRTRGCVATLTDANGAPALSL--DSRHGMLAFGTELVGVDAVVS 128
           G + + + D+ +KL+D R+  C++T+         +    ++  MLA    ++  D    
Sbjct: 222 GLIASGSKDNLIKLWDPRSGQCISTILGCKHTIISTKFQPTKGNMLA----VISKDKSCR 277

Query: 129 LFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEEDEA 185
           +F + +  + L  + D    D   + +HP + ++   G  DG +  +DL Q  +D +
Sbjct: 278 VFDIRQNMKELAVYRD--ESDYMSLTWHPINESIFTVGCYDGSMKHFDLMQEPQDSS 332

>KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 408

 Score = 37.7 bits (86), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 51/110 (46%), Gaps = 7/110 (6%)

Query: 70  RGTVFATAADDGVKLF-DIRTRGCVATLTDANGAPALSLDSR-HGMLAFGTELVGVDAVV 127
           + ++F T ++D   +  D  +   +  L+ ++    L+   R   +LA      G D+ V
Sbjct: 227 QSSLFGTVSEDNTLIIHDTNSDRAIQKLSVSSAFNTLAFSKRSENLLAAA----GTDSNV 282

Query: 128 SLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDL 177
            L+ L    +PL +    H D VT ++F P    LL S  +D  + ++DL
Sbjct: 283 YLYDLRRLQKPLHSMA-GHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDL 331

>Smik_15.454 Chr15 (782403..783788) [1386 bp, 461 aa] {ON} YOR272W
           (REAL)
          Length = 461

 Score = 37.4 bits (85), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 30/137 (21%), Positives = 65/137 (47%), Gaps = 9/137 (6%)

Query: 62  QVLDSAHDRGTVFATAADDGVKLFDIRTRGCVATLTDANGAPALSLDSRHGMLAFGTELV 121
           QV+  + D    ++ + D  +K +D+ T  C+ T T +    +++      +LA+G+   
Sbjct: 293 QVIFDSSDNTVGYSVSQDHSIKTWDLVTARCIDTRTTSYSLLSIAQLPSLNLLAYGSSAR 352

Query: 122 GVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQ-- 179
            +   +    +G   +  +  +  H + V+ +   P +  +L SGS DG V V+D++   
Sbjct: 353 HI--TLHDPRIGASSKVTQQQLIGHKNFVSSLDSCPENEYILCSGSHDGTVKVWDVRSTS 410

Query: 180 -----SEEDEALHQVIN 191
                + ED+++ + IN
Sbjct: 411 PMYTITREDKSVQKGIN 427

>Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {ON}
           complement(61507..62967) [1461 nt, 487 aa]
          Length = 486

 Score = 37.4 bits (85), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 63/144 (43%), Gaps = 18/144 (12%)

Query: 51  VAAHESSINGLQVLDSAHDRGTVFATAADDGVKLFDIRTRGCVATL----TDANGAPALS 106
           + AH+S +  ++ L  AH      +   D  V++FD+R+      +    +D NG+  L+
Sbjct: 262 LIAHDSEVFDVKFL--AHSTQLFASCGGDGSVRVFDLRSLAHSTIIYESNSDQNGSDTLT 319

Query: 107 LDSRHGMLAFGTELVGVDA-VVSLFALGEW----------GRPLRAFVDSHHDDVTDVKF 155
            + +        +    D  V++ FAL             G P+   ++ H   V  +K+
Sbjct: 320 DNEKSPSALLRLQPSPSDPNVMATFALDSKSILILDMRNPGSPVLT-LEGHSAAVNQIKW 378

Query: 156 HPTDSNLLLSGSTDGYVNVYDLKQ 179
           HP  SN+LLS   D  V  +DL +
Sbjct: 379 HPKKSNVLLSCGDDCQVLYWDLNE 402

>SAKL0C13332g Chr3 (1177358..1181419) [4062 bp, 1353 aa] {ON}
           similar to uniprot|Q92271 Saccharomyces cerevisiae
           YOL138C Hypothetical ORF
          Length = 1353

 Score = 37.4 bits (85), Expect = 0.071,   Method: Composition-based stats.
 Identities = 16/44 (36%), Positives = 26/44 (59%)

Query: 138 PLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSE 181
           PL   +  H   +  V F+ + +NLL+SG  DG + V+DL+ S+
Sbjct: 220 PLVTTLSEHTRSINSVDFNMSQTNLLISGGQDGCIKVWDLRSSQ 263

>KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa]
           {ON} similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1101

 Score = 37.4 bits (85), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 23/35 (65%)

Query: 146 HHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQS 180
           H   +TD+ FHPT+  +L + S D YV+ +D++ S
Sbjct: 113 HSRAITDINFHPTNPEILATCSIDAYVHAWDMRSS 147

>KLLA0F15598g Chr6 (1439610..1441046) [1437 bp, 478 aa] {ON} highly
           similar to uniprot|P33750 Saccharomyces cerevisiae
           YLL011W
          Length = 478

 Score = 37.0 bits (84), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 27/113 (23%), Positives = 48/113 (42%), Gaps = 5/113 (4%)

Query: 75  ATAADDGVKLFDIRTRGCVATLTDANGAPALSLDSRHGMLAFGTELVGVDAVVSLFALGE 134
           +T +D+ V L+D+RT      +       ++  +    + AF   +   D     + +  
Sbjct: 230 STGSDNSVVLYDLRTNSPTQKIVQTMRTNSICWNP---VEAFNFVIANEDHNAYYYDMRN 286

Query: 135 WGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEEDEALH 187
             + L  F D H   V DV F PT  + +++GS D  + +Y +K     E  H
Sbjct: 287 MSKALHVFKD-HVSAVMDVDFSPT-GDEVVTGSYDKTIRIYQVKHGHSREIYH 337

>Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)
          Length = 401

 Score = 37.0 bits (84), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 47/191 (24%), Positives = 81/191 (42%), Gaps = 31/191 (16%)

Query: 5   LQQKVSFGADN-WCLRLRPLYQAGVLAALSNGHVHLVDWATGKSVLDVAAHESSINGLQV 63
           LQ  + F  +N + L   PL + G+L + S+ H          ++ DV  +  S   ++ 
Sbjct: 152 LQSTLKFHEENGYALSFSPLVE-GLLLSGSDDHT--------VALWDVNGNSDSTRPIRT 202

Query: 64  LDSAHD-----------RGTVFATAADDGV-KLFDIR---TRGCVATLTDANGAPALSLD 108
               H               +F T ++D + K+ D+R   T    A   +     A S  
Sbjct: 203 WSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLRVENTTTGTAKCPEPFNTLAFSHH 262

Query: 109 SRHGMLAFGTELVGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGST 168
           S + + A GT     D+ V L+ L     PL   +  H D VT+++F P    +++S  +
Sbjct: 263 SSNLLAAAGT-----DSHVYLYDLRNMKEPLH-HMSGHEDAVTNLEFSPHVDGVVVSSGS 316

Query: 169 DGYVNVYDLKQ 179
           D  + ++DLKQ
Sbjct: 317 DNRLIMWDLKQ 327

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 61/131 (46%), Gaps = 14/131 (10%)

Query: 54  HESSINGLQVLDSAHDRGTVFATAADDGVKLFDIRTRGCVATLT--DANGAPALSLDSR- 110
           HE  I   + +    + GTV AT    G      R+ G  +TL   + NG  ALS     
Sbjct: 117 HEEEITRARYM--PQNPGTV-ATINGQGTVFIYSRSEGLQSTLKFHEENGY-ALSFSPLV 172

Query: 111 HGMLAFGTELVGVDAVVSLFALG---EWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGS 167
            G+L  G++    D  V+L+ +    +  RP+R + D H D V D K+H  + +L  + S
Sbjct: 173 EGLLLSGSD----DHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVS 228

Query: 168 TDGYVNVYDLK 178
            D  + + DL+
Sbjct: 229 EDSLLKINDLR 239

>TBLA0H03060 Chr8 complement(748221..750413) [2193 bp, 730 aa] {ON}
           Anc_1.247 YKR036C
          Length = 730

 Score = 37.0 bits (84), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 39/70 (55%), Gaps = 13/70 (18%)

Query: 114 LAFGTELVGVDAVVSLFAL--GEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGY 171
           LA GT+    D ++ L+ L  GE  R L      H D +T +KF   D+N ++SGS DG 
Sbjct: 594 LATGTK----DGIIRLWDLRSGEIARKLIG----HQDAITSLKF---DTNNIISGSLDGS 642

Query: 172 VNVYDLKQSE 181
             ++DL+Q +
Sbjct: 643 TRIWDLRQDQ 652

>KLLA0E04819g Chr5 (428278..429657) [1380 bp, 459 aa] {ON} similar
           to uniprot|P20053 Saccharomyces cerevisiae YPR178W PRP4
           Splicing factor component of the U4/U6-U5 snRNP complex
          Length = 459

 Score = 36.6 bits (83), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 83/173 (47%), Gaps = 22/173 (12%)

Query: 39  LVDWATGKSVLDVAAHESSINGLQVLDSAHDRGTVFATAADDGVKL-FDIRTRGCVATLT 97
           L+D      +L    H + +  L    S H+ G++ +TA  D + L +DIR+   + +L 
Sbjct: 289 LIDTVKQAPILIQEGHSAEVFSL----SFHNDGSLVSTAGLDAIALIWDIRSGKNIMSLQ 344

Query: 98  DANGAPALSLD-SRHG-MLAFGTELVGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKF 155
             +  P  S+D S++G  LA G+     D  + ++ + + G      + +H+  V+ VKF
Sbjct: 345 -GHSKPIYSVDWSQNGYQLASGSG----DGTIKVWDIRKKGNV--ETILAHNSIVSQVKF 397

Query: 156 HPTDSNLLLSGSTDGYVNVYD----LKQSEEDEALHQVINF----ASIHSCGW 200
           +  +   L+S   D  VN+++    +K+   +  L +V++       I+S GW
Sbjct: 398 NKQNGGYLVSSGYDKKVNIFNDGNWIKERSLEGHLDKVMSIDIVGPDIYSAGW 450

>ACR137W Chr3 (590077..591354) [1278 bp, 425 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL151C (PRP46)
          Length = 425

 Score = 36.6 bits (83), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 51/105 (48%), Gaps = 9/105 (8%)

Query: 57  SINGLQVLDSAHDRGTVFATAADDGVKLFDIRTRGCVATLTDANGAPALSLDSRHGMLAF 116
           +++G+  +D       + +   D  V+++DIR+R CV TL    G       ++   L  
Sbjct: 197 TLSGVHSVDLHPSLDLIVSAGRDSVVRVWDIRSRSCVLTLAGHRGPI-----NKVRCLPV 251

Query: 117 GTELV--GVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTD 159
             ++V    DA V L+ L   G+P++     H  +V D+ F+PT+
Sbjct: 252 DPQIVSCSTDATVKLWDLVA-GKPMKTLT-HHKRNVRDLAFNPTE 294

>Smik_11.298 Chr11 complement(497968..499956) [1989 bp, 662 aa] {ON}
           YKR036C (REAL)
          Length = 662

 Score = 37.0 bits (84), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 44/85 (51%), Gaps = 9/85 (10%)

Query: 96  LTDANGAPALSLDSRHGMLAFGTELVGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKF 155
           L D +     +L      LA GT+    D +V L+ L   G+P+R  +  H D +T +KF
Sbjct: 503 LLDTDAPMIGALQCYKSALATGTK----DGIVRLWDL-RVGKPVR-LLRGHTDGITSLKF 556

Query: 156 HPTDSNLLLSGSTDGYVNVYDLKQS 180
              DS  L++GS D  V ++DL+ S
Sbjct: 557 ---DSEKLVTGSMDNSVRIWDLRTS 578

>TPHA0E03080 Chr5 complement(646691..648157) [1467 bp, 488 aa] {ON}
           Anc_5.201 YLL011W
          Length = 488

 Score = 36.6 bits (83), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 43/186 (23%), Positives = 77/186 (41%), Gaps = 40/186 (21%)

Query: 148 DDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEEDEALHQVINFASIHSCGWLSPKRIW 207
           D+VT VKF+ T++++L S  +D  + +YDL+ +   + + Q +   +I  C        W
Sbjct: 214 DNVTSVKFNQTETDILASTGSDNSIVLYDLRTNSPTQKIRQSMRTNAI--C--------W 263

Query: 208 SLSHMETFAIHELNDKSEHANEPQPQLFGDVREPWACDYVVDVYPGFIAAGSTRENAGEL 267
           +      F I         ANE     + D+R        ++V+   ++A        ++
Sbjct: 264 NPMEAFNFVI---------ANEDHNAYYYDMRN---MSRALNVFKDHVSA------VMDV 305

Query: 268 RLLPLRDECVDAANAIVLP-----QAHGDEV-----VRDVLVPASSPELLY--SAGEDGN 315
              P  DE V  +    +      Q H  EV     ++ V     S +  Y  S  +DGN
Sbjct: 306 DFSPTGDEIVTGSYDKTIRIYKTNQGHSREVYHTKRMQHVFQVKYSMDSKYIISGSDDGN 365

Query: 316 MAIWKS 321
           + +W+S
Sbjct: 366 VRLWRS 371

>Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C
           (REAL)
          Length = 523

 Score = 36.6 bits (83), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 37/148 (25%), Positives = 68/148 (45%), Gaps = 21/148 (14%)

Query: 51  VAAHESSINGLQVLDSAHDRGTVFATAADDG-VKLFDIRTRGCVATLTD--ANGAPALSL 107
           + AH+S +  ++ L  +     +FA+   DG V++FD+R+      + +  A+ AP L+ 
Sbjct: 283 LIAHDSEVFDVRFLTKS---TQLFASCGGDGSVRVFDLRSLAHSTIIYEPPASSAPGLNA 339

Query: 108 DSRHGMLAFGTELVGVDA------VVSLFA-------LGEWGRPLRAFVD--SHHDDVTD 152
           D+          L+ ++       V++ FA       + +   P    ++   H   V +
Sbjct: 340 DTTTPASKGSDALLRLEPSPYDPNVLATFAAESNKIIILDMRNPESPILNLEGHSSSVNE 399

Query: 153 VKFHPTDSNLLLSGSTDGYVNVYDLKQS 180
           +K+HPT  N+LLS   D  V  +DL  S
Sbjct: 400 IKWHPTKRNVLLSCGDDCQVLYWDLNNS 427

>Kwal_55.22067 s55 complement(1094600..1095955) [1356 bp, 451 aa]
           {ON} YNL317W (PFS2) - Polyadenylation Factor I subunit
           [contig 124] FULL
          Length = 451

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 42/184 (22%), Positives = 81/184 (44%), Gaps = 19/184 (10%)

Query: 18  LRLRPLYQAGVLAALSNGHVHLVDW-ATGKSVLDVAAHESSINGLQVLDSAHD---RG-- 71
                + QA   A     + H  DW  +G S   +   + + N ++VLD AH    RG  
Sbjct: 115 FNFESIMQAHDSAVAVMKYSHAGDWLISGDSDGTIKIWQPNFNMVKVLDEAHTQCIRGIS 174

Query: 72  -----TVFATAADDGV-KLFDIRTRGCVATLTDAN-GAPALSLDSRHGMLAFGTELVGVD 124
                + F T +DD + K+++       +TL+  +    +       G++A G++    D
Sbjct: 175 FSGTDSKFVTCSDDNILKIWNFSNGQQESTLSGHHWDVRSCDWHPTMGLIASGSK----D 230

Query: 125 AVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEEDE 184
            +V L+     G+ +   +   H  +   KF PT  N+L   S D    ++D++Q+ ++ 
Sbjct: 231 NLVKLWD-PRAGQCISTILGCKHT-IISTKFQPTKGNMLAVISKDKSCRIFDIRQNMKEL 288

Query: 185 ALHQ 188
           A+++
Sbjct: 289 AVYR 292

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 26/117 (22%), Positives = 53/117 (45%), Gaps = 8/117 (6%)

Query: 71  GTVFATAADDGVKLFDIRTRGCVATLTDANGAPALSL--DSRHGMLAFGTELVGVDAVVS 128
           G + + + D+ VKL+D R   C++T+         +    ++  MLA    ++  D    
Sbjct: 222 GLIASGSKDNLVKLWDPRAGQCISTILGCKHTIISTKFQPTKGNMLA----VISKDKSCR 277

Query: 129 LFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEEDEA 185
           +F + +  + L  + D    D   + +HP + ++   G  DG +  +DL Q  +D +
Sbjct: 278 IFDIRQNMKELAVYRD--ESDYMSLTWHPINESMFTVGCYDGSMKHFDLLQEPQDSS 332

>KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} similar
           to uniprot|P42841 Saccharomyces cerevisiae YNL317W PFS2
           Integral subunit of the pre-mRNA cleavage and
           polyadenylation factor (CPF) complex plays an essential
           role in mRNA 3'-end formation by bridging different
           processing factors and thereby promoting the assembly of
           the processing complex
          Length = 452

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 25/124 (20%), Positives = 53/124 (42%), Gaps = 6/124 (4%)

Query: 71  GTVFATAADDGVKLFDIRTRGCVATLTD-ANGAPALSLDSRHGMLAFGTELVGVDAVVSL 129
           G + + + D+ +K +D R+  CV+T+    +   +     + G L     ++  D    +
Sbjct: 220 GLIVSGSKDNLIKFWDPRSGSCVSTMLGFKHTIISTKFQPKQGNLL---SVISKDKTCKV 276

Query: 130 FALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEEDEALHQV 189
           + + +  + L +  D    D   +++HP D  +   G  DG +  +DL Q  +       
Sbjct: 277 YDIRQQAKELFSVRDD--VDYMTLQWHPIDETVFTVGCYDGSIKHFDLSQENQPNKPTHN 334

Query: 190 INFA 193
           I +A
Sbjct: 335 IPYA 338

>SAKL0C13266g Chr3 complement(1171961..1173340) [1380 bp, 459 aa]
           {ON} highly similar to uniprot|Q75AV4 Ashbya gossypii
           ADL184W PSF2 Polyadenylation factor subunit 2 and
           similar to YNL317W uniprot|P42841 Saccharomyces
           cerevisiae YNL317W PFS2 Integral subunit of the pre-mRNA
           cleavage and polyadenylation factor (CPF) complex plays
           an essential role in mRNA 3'-end formation by bridging
           different processing factors and thereby promoting the
           assembly of the processing complex
          Length = 459

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 25/117 (21%), Positives = 53/117 (45%), Gaps = 20/117 (17%)

Query: 71  GTVFATAADDGVKLFDIRTRGCVATLTDANGAPALSLDSRHGMLAFGTE--------LVG 122
           G + + + D+ +KL+D R+  C++T+          L  +H ++    +        +V 
Sbjct: 220 GLIVSGSKDNLIKLWDPRSGQCISTI----------LGFKHTIIKTKFQPTKGNLLAVVA 269

Query: 123 VDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQ 179
            D    +F + +  + L++F D    D   + +HP + ++   G  DG +  +DL Q
Sbjct: 270 KDKSCKIFDIRQNMKELKSFRD--ESDYMSLTWHPINESIFTVGCYDGSLKHFDLLQ 324

>TPHA0A00380 Chr1 complement(55881..59813) [3933 bp, 1310 aa] {ON}
           Anc_3.22 YOL138C
          Length = 1310

 Score = 36.6 bits (83), Expect = 0.12,   Method: Composition-based stats.
 Identities = 30/130 (23%), Positives = 54/130 (41%), Gaps = 22/130 (16%)

Query: 94  ATLTDANGAPALSLDSRHGMLAFGT---------------ELVGVDAVVSLFALGEWGRP 138
           A+ + +N A + +L+ RH  L   T                +     V+S++ + +  + 
Sbjct: 157 ASSSISNAAVSSNLNKRHRQLKLSTIADVKTGFNNYKNYVAICAKSTVISIYDINKAEKL 216

Query: 139 LRAFVDS---HHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEEDEALHQVINFA-- 193
            +  + S   H   V    F+  DSNLL+SG  DG + ++DL+    + +    IN    
Sbjct: 217 DKTLITSYSEHTRAVNSFDFNMVDSNLLISGGQDGCIKIWDLRTGSLNGSTRSDININTA 276

Query: 194 --SIHSCGWL 201
             SI    W+
Sbjct: 277 SDSIRDVKWM 286

>NCAS0F01450 Chr6 complement(287070..289796) [2727 bp, 908 aa] {ON}
           Anc_2.450 YKL121W
          Length = 908

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 32/60 (53%), Gaps = 3/60 (5%)

Query: 122 GVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSE 181
            +D  V L+ L E    L+ F   H D VT V+FHPTD    +SG  D  V ++ + ++E
Sbjct: 346 SMDRTVKLWHL-ERQTSLKTF--QHQDFVTCVRFHPTDDRFFISGCLDHKVRLWSILENE 402

>TPHA0L01690 Chr12 (355859..358357) [2499 bp, 832 aa] {ON} Anc_8.544
           YBR198C
          Length = 832

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 58/107 (54%), Gaps = 9/107 (8%)

Query: 73  VFATAADDGVKLFDIRTRGCVATLTDANGAPALSLD-SRHGM-LAFGTELVGVDAVVSLF 130
           +F  ++D   +++DI T G    L   + AP LS+  +  G+ LA G+E    D V+ ++
Sbjct: 652 IFTGSSDKTCRMWDITT-GESVRLFIGHTAPILSVAVAPDGLRLATGSE----DGVIHIW 706

Query: 131 ALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDL 177
            +G  G+ L+  +      V  + ++  +SN+L+SG +D  V ++DL
Sbjct: 707 DIGT-GKSLKKLIGHGKSAVNSLSYN-KESNILVSGGSDNSVRIWDL 751

>Ecym_3012 Chr3 complement(24573..25766) [1194 bp, 397 aa] {ON}
           similar to Ashbya gossypii ACR017W
          Length = 397

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 45/184 (24%), Positives = 77/184 (41%), Gaps = 21/184 (11%)

Query: 5   LQQKVSFGADN-WCLRLRPLYQAGVLAALSNGHVHLVDW-ATGKSVLDVAAHESSINGLQ 62
           L + +S+  DN + L   P  +  +L+A  +  V L D  +T + V  V  H   +N  +
Sbjct: 152 LCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINSTDRPVSIVMNHTDIVNDSK 211

Query: 63  VLDSAHDRGTVFATAADDG-VKLFDIRTRGCVATLTDANGAPALSLDSRHGMLAFGTE-- 119
             +   +   +F T ++D  +++ D R+         +N A  L ++     LAF     
Sbjct: 212 WHEFDEN---IFGTVSEDKTLQVHDKRSL--------SNSAQVLPVEKPLNALAFSKHSK 260

Query: 120 ----LVGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVY 175
                 G D  V L+ L     PL      H D VT ++F      +L S  +D  + ++
Sbjct: 261 NLIAAAGTDTRVYLYDLRRLSEPLHTMA-GHQDAVTSIEFSSHKDGILCSSGSDRRLFIW 319

Query: 176 DLKQ 179
           DL Q
Sbjct: 320 DLTQ 323

>KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {ON}
           Anc_6.9 YEL056W
          Length = 414

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 52/112 (46%), Gaps = 9/112 (8%)

Query: 70  RGTVFATAADDG-VKLFDIRTRGCVATLTDANGAPALSLDSRH--GMLAFGTELVGVDAV 126
           + ++F T ++D  +++ D R    VAT+        LS  S H   +LA G    GV++ 
Sbjct: 234 QKSLFGTVSEDSSLQIHDTRESKPVATINGTKPFNTLSF-SHHSENLLATG----GVNSE 288

Query: 127 VSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLK 178
           V L+       PL   +  H D VT + F   D  ++LS   D  V ++D+ 
Sbjct: 289 VYLYDRRYVEEPLH-LMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDIN 339

>TDEL0A00410 Chr1 complement(70940..74728) [3789 bp, 1262 aa] {ON}
           Anc_3.22 YOL138C
          Length = 1262

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 46/98 (46%), Gaps = 8/98 (8%)

Query: 125 AVVSLFALGEWGRPLRAFVDS---HHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQS- 180
             +S+F +   G    +FV +   H   +    F+   +NL++SG  D  + V+DL+ S 
Sbjct: 198 TAISVFDMNRTGSSESSFVTALSEHTRSINSFDFNTVQTNLIISGGQDSCIKVWDLRSSN 257

Query: 181 -EEDEALHQVINFA--SIHSCGWLSPKRIWSLSHMETF 215
            +  +     IN A  SI    W+ P + ++ +H + F
Sbjct: 258 AKNSKNCDLSINTASDSIRDVKWM-PFQNYAFNHQQEF 294

>CAGL0H08932g Chr8 (871668..871685,872089..874779) [2709 bp, 902 aa]
           {ON} highly similar to uniprot|P41811 Saccharomyces
           cerevisiae YGL137w SEC27
          Length = 902

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 30/57 (52%), Gaps = 2/57 (3%)

Query: 42  WATGKSVLDVAAHESSINGLQVLD--SAHDRGTVFATAADDGVKLFDIRTRGCVATL 96
           W+ G+S  +   H     G+  +D     D+  +  ++ D  VK+FD +T+ CVATL
Sbjct: 168 WSLGQSTPNFTLHTGQEKGVNYVDYYPLPDKPYMITSSDDTTVKIFDYQTKSCVATL 224

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 36/162 (22%), Positives = 68/162 (41%), Gaps = 11/162 (6%)

Query: 28  VLAALSNGHVHLVDWATGKSVLDVAAHESSINGLQVLDSAHDRGTVFATAADDGVKLFDI 87
           VL  L +G V + ++ T + V  +   ++ +   + +     +  +   + D+ V++F+ 
Sbjct: 28  VLTTLYSGRVEIWNYETQQEVRSIQVTDTPVRAGKFITR---KNWIVVGSDDNKVRVFNY 84

Query: 88  RTRGCVATLT-DANGAPALSLDSRHGMLAFGTELVGVDAVVSLFAL-GEWGRPLRAFVDS 145
            T   VA      +   ++++      +  G++    D  V L+    +W   L      
Sbjct: 85  NTGEKVADFVAHPDYIRSIAVHPSKPYILTGSD----DLTVKLWNWENDWS--LEQTFKG 138

Query: 146 HHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEEDEALH 187
           H   V  V F+P D N+  SG  D  V V+ L QS  +  LH
Sbjct: 139 HEHFVMCVAFNPKDPNVFASGCLDHKVKVWSLGQSTPNFTLH 180

>TPHA0P01490 Chr16 complement(302996..304375) [1380 bp, 459 aa] {ON}
           Anc_3.25 YNL317W
          Length = 459

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 33/135 (24%), Positives = 63/135 (46%), Gaps = 26/135 (19%)

Query: 69  DRGTVFATAADDGVKLFDIRTRGCVATLTDANGAPALSLDSRHGMLAFGTELVGVDAVVS 128
           + G + + + D+ +KL+D R+  CV+TL          L+ +H +L   T+        +
Sbjct: 223 EMGLIVSASKDNLIKLWDPRSGQCVSTL----------LNFKHTVLK--TKFQPTKG--N 268

Query: 129 LFALGEWGRPLRAF-VDSHHDDVTDVK---------FHPTDSNLLLSGSTDGYVNVYDLK 178
           L A     +  R F +  H  ++T ++         +HPT+ ++    S DG +  +D+ 
Sbjct: 269 LLAAISKDKSCRVFDIRYHMKELTVIRDEVDYMTLLWHPTNESMFTIASYDGAIKHFDIL 328

Query: 179 QSEEDEALHQVINFA 193
           Q+ E+    QVI +A
Sbjct: 329 QNLEEP--QQVIPYA 341

>KAFR0G03590 Chr7 (740652..741776) [1125 bp, 374 aa] {ON} Anc_6.162
           YBR246W
          Length = 374

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 29/48 (60%)

Query: 150 VTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEEDEALHQVINFASIHS 197
           V D+K  P +  L+ +  + G + +++LK++E+D  L +V+NF    S
Sbjct: 64  VLDLKLSPFNDKLVATAHSTGNITIWELKETEKDIILTEVVNFVVFDS 111

>TPHA0G02500 Chr7 (515975..518812) [2838 bp, 945 aa] {ON} Anc_2.450
           YMR102C
          Length = 945

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 37/74 (50%), Gaps = 8/74 (10%)

Query: 105 LSLD-SRHGMLAFGTELVGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLL 163
           L LD SR+G +   +    +D  V L+   +  + LR F  SH D VT VKFHP D    
Sbjct: 412 LDLDWSRNGFILTSS----IDKTVKLWHTDK-NKSLRTF--SHPDFVTTVKFHPIDDRFF 464

Query: 164 LSGSTDGYVNVYDL 177
           +SG  D    ++ +
Sbjct: 465 ISGCIDQKCRLWSI 478

>YJL112W Chr10 (205305..207449) [2145 bp, 714 aa] {ON}
           MDV1Peripheral protein of the cytosolic face of the
           mitochondrial outer membrane, required for mitochondrial
           fission; interacts with Fis1p and with the
           dynamin-related GTPase Dnm1p; contains WD repeats
          Length = 714

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 31/84 (36%), Positives = 46/84 (54%), Gaps = 10/84 (11%)

Query: 96  LTDANGAPAL-SLDSRHGMLAFGTELVGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVK 154
           LT  N  P++ +L S    LA GT+    D VV L+ L   G+ +R  +  H D +T +K
Sbjct: 560 LTQRNERPSIGALQSFDAALATGTK----DGVVRLWDL-RSGKVIRT-LKGHTDAITSLK 613

Query: 155 FHPTDSNLLLSGSTDGYVNVYDLK 178
           F   DS  L++GS D  V ++DL+
Sbjct: 614 F---DSACLVTGSYDRTVRIWDLR 634

>TPHA0K00780 Chr11 (163003..164088) [1086 bp, 361 aa] {ON} Anc_7.405
           YER107C
          Length = 361

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 53/112 (47%), Gaps = 7/112 (6%)

Query: 73  VFATAADDG-VKLFDIRTRGCVATLTDANGAPALSLDSRHGMLAFGTELV--GVDAVVSL 129
           VF+ ++ DG VK+++I      A    ++ AP LS          GT++   G D +V L
Sbjct: 48  VFSASSWDGKVKIWNINNGNPQAVAQYSHSAPVLSTR----WSGDGTKVASGGCDNIVKL 103

Query: 130 FALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSE 181
           F L           DS   ++  V   PT+S  L++GS D  +  +DL+Q +
Sbjct: 104 FDLTTNQEQQVGTHDSAIKNLRFVNCGPTNSQCLVTGSWDKTIKYWDLRQQQ 155

>KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {ON}
           Anc_8.548 YBR195C
          Length = 426

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 43/181 (23%), Positives = 71/181 (39%), Gaps = 17/181 (9%)

Query: 66  SAHDRGTVFATAADDGVKLFDIRTRGCVATLTD---ANGAPALSLDSRHGMLAFGTELVG 122
           S HD          D + LFD R +  VA + +   + G  A   +  + +L   T+  G
Sbjct: 258 SQHDSILAACGERSDSLALFDTRAQNAVAKIRNQFKSEGINACKFNWENNLLLASTDSTG 317

Query: 123 VDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLS-GSTDGYVNVYDLKQSE 181
              +  +  L     P+  F   H   V+ ++++P D ++L + G +DG + ++D     
Sbjct: 318 RTNLWDVRKLS--AEPIVHF--DHGGSVSTLEWNPHDHSVLATAGQSDGLIKIWDTSLEI 373

Query: 182 EDEALHQVINFASIHSCGWLSPKRI-WSLSHMETFAIHELNDKSEHANEPQPQLFGDVRE 240
           ED+ +        +HS   L    I W L H         ND S H  +P   L      
Sbjct: 374 EDKTIF-------VHSGHMLGVNDIAWDL-HDPWLMCSVSNDNSVHVWKPAANLVQRCTS 425

Query: 241 P 241
           P
Sbjct: 426 P 426

>KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 418

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 26/115 (22%), Positives = 55/115 (47%), Gaps = 10/115 (8%)

Query: 77  AADDGVKLFDIRT----RGCVATLTDANGAPALSLDSRHGMLAFGTELVGVDAVVSLFAL 132
           + D+ V + DIR     +   +    +NG      +    ML    +  G    ++L+ +
Sbjct: 264 SEDNLVGIMDIRNPEKGQSSGSNPHHSNGINTCQFNYHRDMLLCSADSAGR---INLWDI 320

Query: 133 GEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTD-GYVNVYDLKQSEEDEAL 186
             + +PL+  +  H+D ++ ++++P +  +L +G  D G V ++DL Q E  E +
Sbjct: 321 RNFTQPLKTLL--HNDSISVLQWNPREPTVLATGGQDGGLVKIWDLSQPEGQELI 373

>TDEL0A05770 Chr1 (1018340..1019641) [1302 bp, 433 aa] {ON}
           Anc_8.631 YOR212W
          Length = 433

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 41/80 (51%), Gaps = 10/80 (12%)

Query: 33  SNGHVHLVDWATGKSVLDVAAHESSINGLQVLDSAHDRGTVFATAADDG-VKLFDIRTRG 91
           S+G+++L D  TG         +S IN +Q        G   A+ +DDG ++LFD+R+  
Sbjct: 257 SDGYIYLWDVRTGSVAQTFFVSDSDINAVQFFKD----GNALASGSDDGIIRLFDLRSDC 312

Query: 92  CVATLTDANGAPALSLDSRH 111
            + T + A+     SLDS+ 
Sbjct: 313 QIGTYSLAD-----SLDSKR 327

>YOR272W Chr15 (832813..834195) [1383 bp, 460 aa] {ON}
           YTM1Constituent of 66S pre-ribosomal particles, forms a
           complex with Nop7p and Erb1p that is required for
           maturation of the large ribosomal subunit; has seven
           C-terminal WD repeats
          Length = 460

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 30/137 (21%), Positives = 65/137 (47%), Gaps = 9/137 (6%)

Query: 62  QVLDSAHDRGTVFATAADDGVKLFDIRTRGCVATLTDANGAPALSLDSRHGMLAFGTELV 121
           QV+  + D    ++ + D  +K +D+ T  C+ T T +    +++  S   +LA G+   
Sbjct: 292 QVIFDSTDNTVGYSVSQDHTIKTWDLVTARCIDTRTTSYSLLSIAQLSTLNLLACGSSAR 351

Query: 122 GVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQ-- 179
            +   +    +G   +  +  +  H + V+ +   P +  +L SGS DG V V+D++   
Sbjct: 352 HI--TLHDPRVGASSKVTQQQLIGHKNFVSSLDTCPENEYILCSGSHDGTVKVWDVRSTS 409

Query: 180 -----SEEDEALHQVIN 191
                + ED+++ + +N
Sbjct: 410 PMYTITREDKSVQKGVN 426

>Kwal_56.23207 s56 (446947..449748) [2802 bp, 933 aa] {ON} YOL087C -
           Hypothetical ORF [contig 183] FULL
          Length = 933

 Score = 35.8 bits (81), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 60/117 (51%), Gaps = 11/117 (9%)

Query: 28  VLAALSNGHVHLVDWATGKSVLDVAAHESSINGLQVLDSAHDRGTVFATAADDGVKLFDI 87
           ++A  +NG++ L+  +TGK    ++AH ++I  + ++D   +   + +T++D  +KL+D+
Sbjct: 182 LIAGDNNGNLILISSSTGKQYAVISAHATNIKLIHLMD---NDTKILSTSSDGMLKLWDL 238

Query: 88  RTRGCVATLTDAN------GAPALSLDSRHGMLAFGTELVGVDAVVSLFALGEWGRP 138
           +  G   T+ DA        AP  S++  +    F  +  G    +  F+ GEW  P
Sbjct: 239 QKLG-KETIDDALIHSWKWAAPVWSIEGSNFHDFFVGDSRGAITHID-FSNGEWEAP 293

>SAKL0G01628g Chr7 complement(133626..136505) [2880 bp, 959 aa] {ON}
           conserved hypothetical protein
          Length = 959

 Score = 35.4 bits (80), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 54/121 (44%), Gaps = 15/121 (12%)

Query: 127 VSLFALGEWGRPLRAFVDSHHD-DVTDVKFHPTDSNLLLSGS--TDGYVNVYDLKQSEED 183
           V L++L        AFV  HH   + ++KFHPTD  + LS     DG+++++ L+ +   
Sbjct: 161 VLLYSLAPDSNDFPAFVIHHHSYGIANLKFHPTDPKIFLSLGLINDGFLHIWRLQGTG-- 218

Query: 184 EALHQVINFASIHSCGWLSPKRIWSLSHMETFAIHELND-KSEHANEPQPQLFGDVREPW 242
                 I   + +    +    IW   ++ T+ +  L   K EH N+   QL   V  P 
Sbjct: 219 ------IQLIASNKTSAIVKDVIWCDKNIITYGVRHLKVWKFEHPND---QLKSKVVVPR 269

Query: 243 A 243
           A
Sbjct: 270 A 270

>YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit of
           the Hat1p-Hat2p histone acetyltransferase complex;
           required for high affinity binding of the complex to
           free histone H4, thereby enhancing Hat1p activity;
           similar to human RbAp46 and 48; has a role in telomeric
           silencing
          Length = 401

 Score = 35.4 bits (80), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 52/111 (46%), Gaps = 9/111 (8%)

Query: 73  VFATAADDGVKLFDIRTRGCVATLT-DANGAPALSLDSR-HGMLAFGTELVGVDAVVSLF 130
           + AT    G      R+ G  +TL    +   ALS  +   G L  G++    D  V+L+
Sbjct: 133 IVATINGQGTVFLYSRSEGLQSTLKFHKDNGYALSFSTLVKGRLLSGSD----DHTVALW 188

Query: 131 ALGEWG---RPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLK 178
            +G  G   +P+R + D H D + D K+H  + +L  + S D  + + D++
Sbjct: 189 EVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKINDVR 239

 Score = 30.8 bits (68), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 52/114 (45%), Gaps = 16/114 (14%)

Query: 73  VFATAADDGV-KLFDIRTRGCVATLTDANGAP------ALSLDSRHGMLAFGTELVGVDA 125
           +F T ++D + K+ D+R      T  D    P      A S  S + + A      G+D+
Sbjct: 223 LFGTVSEDSLLKINDVRANN---TTIDTVKCPQPFNTLAFSHHSSNLLAA-----AGMDS 274

Query: 126 VVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQ 179
            V L+ L     PL   +  H D V +++F      +++S  +D  + ++DLKQ
Sbjct: 275 YVYLYDLRNMKEPLH-HMSGHEDAVNNLEFSTHVDGVVVSSGSDNRLMMWDLKQ 327

>KNAG0D03460 Chr4 (622817..624055) [1239 bp, 412 aa] {ON} Anc_4.119
           YGL004C
          Length = 412

 Score = 35.4 bits (80), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 36/74 (48%), Gaps = 14/74 (18%)

Query: 118 TELVGVDAV---VSLFALG----------EWGRPLRAFVDSHHDDVTDVKFHPTDSNLLL 164
           TE   VDA+    S + LG          E   PL    ++H  D+T VKF P+   L+L
Sbjct: 98  TEWTAVDAIDTPTSQYVLGDSNGNIHLYYELFNPLYKIEEAHFGDITSVKFFPS-GKLIL 156

Query: 165 SGSTDGYVNVYDLK 178
           S STD  + ++ L+
Sbjct: 157 SASTDMRMKIWSLE 170

>KLTH0G15620g Chr7 complement(1363249..1366056) [2808 bp, 935 aa]
           {ON} similar to uniprot|Q99247 Saccharomyces cerevisiae
           YOL087C Hypothetical ORF
          Length = 935

 Score = 35.4 bits (80), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 40/167 (23%), Positives = 74/167 (44%), Gaps = 17/167 (10%)

Query: 51  VAAHESSINGLQVLDSAHDRGTVFATAA-DDGVKLFDIRTRGCVATLTDANGAPALSLDS 109
           +  H+     + VL +  D G  FAT   D  +K++ ++  G    L   + A  L   S
Sbjct: 107 IGYHDDYAKCVAVLGATADGGIKFATCGLDMKLKVWLLKDNGTSNLLHSFDNAQPLDSGS 166

Query: 110 RHGMLAFGTELVGVDAVV-----SLFALGEWGRPLRAFVDSHHDDVTDVK-FHPTDS-NL 162
            + +++   E +  D +      +   +      L AFV + HD  T++K  H  D    
Sbjct: 167 LYALVSADFEGIPFDLIAGDNNGNFILMSSDTGELVAFVQAAHD--TNIKLLHLMDEGRK 224

Query: 163 LLSGSTDGYVNVYDLKQSEEDEALHQVINFASIHSCGWLSPKRIWSL 209
           +LS S+DG + ++D+++   +      +  A IH+  W SP  +W +
Sbjct: 225 MLSTSSDGILKLWDVQRLATNN-----VESALIHTWKWASP--VWCV 264

>Kpol_1013.37 s1013
           complement(88637..88936,88986..88994,89037..90134) [1407
           bp, 468 aa] {ON}
           complement(88637..88936,88986..88994,89037..90134) [1407
           nt, 469 aa]
          Length = 468

 Score = 35.0 bits (79), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 51/192 (26%), Positives = 79/192 (41%), Gaps = 39/192 (20%)

Query: 38  HLVDWATGKSVLDVAAHESSINGLQVLDSAHDRGTVFATAADDGVKL-FDIRTRGCVATL 96
            L D  T   +L    H   I  L    S    G++ ATA  D V + +D+R+   + +L
Sbjct: 293 RLWDIVTNSELLLQEGHSKEIYSL----SFQTDGSLIATAGADKVGIIWDLRSGKNILSL 348

Query: 97  TDANGAPALSLD-SRHGMLAF----GT----ELVGVDAVVSLFALGEWGRPLRAFVDSHH 147
              +  P    D S++G        GT    +L  VD V ++ A              H 
Sbjct: 349 V-GHAKPIYCSDWSQNGYQXXXSGDGTIKIWDLRKVDDVETILA--------------HK 393

Query: 148 DDVTDVKFHPTDSNLLLSGSTDGYVNVYD--------LKQSEEDEALHQVI--NFASIHS 197
           + VTD+KF   +S  L+S S D  +NV+           Q   D+ L   I  ++ +I S
Sbjct: 394 NVVTDLKFEKENSKFLISSSYDKDINVFSSDSWVKIHTLQGHNDKILSIDISSDYQTIVS 453

Query: 198 CGWLSPKRIWSL 209
            GW    ++WS+
Sbjct: 454 GGWDRSVKLWSM 465

>Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa]
           {ON} YDR128W - Hypothetical ORF [contig 174] FULL
          Length = 1102

 Score = 35.4 bits (80), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 21/33 (63%)

Query: 146 HHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLK 178
           H   +TD+ FHPT   +L + S D YV+ +D++
Sbjct: 113 HSRAITDINFHPTHPEILATCSIDAYVHAWDMR 145

>KLTH0F19338g Chr6 (1564555..1568427) [3873 bp, 1290 aa] {ON}
           similar to uniprot|Q92271 Saccharomyces cerevisiae
           YOL138C Hypothetical ORF
          Length = 1290

 Score = 35.4 bits (80), Expect = 0.32,   Method: Composition-based stats.
 Identities = 15/44 (34%), Positives = 25/44 (56%)

Query: 138 PLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSE 181
           P    +  H   +  V F+   ++LL+SGS DG + V+DL+ S+
Sbjct: 204 PASMVLSKHTRSINSVDFNMAQTSLLISGSQDGCIKVWDLRSSQ 247

>NDAI0E04440 Chr5 (1002113..1003858) [1746 bp, 581 aa] {ON}
           Anc_7.356 YLR196W
          Length = 581

 Score = 35.0 bits (79), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 62/262 (23%), Positives = 114/262 (43%), Gaps = 27/262 (10%)

Query: 124 DAVVSLFALGEWGRPLRAFVDSHH-DDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEE 182
           D  V L+ L   G+  R+    H   +V+  ++HPT+ ++LL+G  D  V + D++ S E
Sbjct: 313 DHTVKLWDLNN-GQTARSLASVHSGKNVSASEWHPTNGSILLTGGYDSRVALSDVRISNE 371

Query: 183 DEALH--QVINFASIHSCGWLSPKRIWSLSHMETFAIHELNDKSEHANEPQPQLFGDVRE 240
            E      V++   I    + +   I  L   ++  I+  + ++   ++P   L     +
Sbjct: 372 KEMSKYWSVMSGEEIECTTFANENII--LCGTDSGNIYSFDIRNNENSKPVWTL--KAHD 427

Query: 241 PWACDYVVDVY-PGFIAAGSTRENAGELRLLPLRDECVDAAN---AIVLPQAHGDEVVRD 296
                   + + PG ++ G+  E A +L   PL D   + A     +VL +   D  V +
Sbjct: 428 AGISTLSTNSFIPGLMSTGAMGEKAVKLWKFPLGDGVNNNAGKGPGMVLSR---DFDVGN 484

Query: 297 VLVPASSPELLYSAGEDGNMAIWKSTLGPLNVPVDFWDYSKKETVLEDLPSSGLDDTHSA 356
           VL  + SP++  +    G M +     G +N  +  WD     TV +      L D   A
Sbjct: 485 VLTTSFSPDIEVA----GTMVV-----GGVNKGLKLWDVFSNRTVRKSFAKE-LKDVQ-A 533

Query: 357 QHNDQASSLSGQSQPEQQEYRQ 378
           +  D+A ++ G+S    ++Y Q
Sbjct: 534 RARDEAKNV-GRSSRIARKYTQ 554

>ZYRO0A09636g Chr1 (779501..781927) [2427 bp, 808 aa] {ON} highly
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222C UTP13 Nucleolar protein component of the small
           subunit (SSU) processome containing the U3 snoRNA that
           is involved in processing of pre-18S rRNA
          Length = 808

 Score = 35.0 bits (79), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 62/126 (49%), Gaps = 12/126 (9%)

Query: 55  ESSINGLQVLDSAHDRGTVFATAADDGVKLFDIRTRGCVATLTDANGAPALSLDSRHGML 114
           E  I  L++  +A  R   FA+ A   +K+FD+R    V ++  ++ +  +  DS   +L
Sbjct: 60  EQDITALKL--TADGRYLCFASQAQ-LLKIFDLREGKIVRSMKISSPSYVVDSDSTSTLL 116

Query: 115 AFGTELVGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSN---LLLSGSTDGY 171
           A G    G D  +++  + E G    + +  H   ++ VKF+   +    LL SG T+G 
Sbjct: 117 AIG----GTDGSITVVDV-ENGYVTHS-LKGHGGTISSVKFYGEQNGEVWLLASGDTNGM 170

Query: 172 VNVYDL 177
           V ++DL
Sbjct: 171 VKIWDL 176

>NDAI0B05190 Chr2 complement(1269217..1271223) [2007 bp, 668 aa]
           {ON} Anc_1.247 YJL112W
          Length = 668

 Score = 35.0 bits (79), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 65/142 (45%), Gaps = 21/142 (14%)

Query: 48  VLDVAAHESSINGLQVLDSAHDRGTVFATAADDGVKLFDIRTRGCVATL-------TDAN 100
           VL   +H   I  L     + D   + + + D  V+ +DI +  C  TL       +  N
Sbjct: 446 VLTFDSHSDEITAL-----SFDGEYLISASRDKTVRQYDIISGKCFQTLATNFGSISKTN 500

Query: 101 GAPALSLDS--RHGMLAFGTELV--GVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFH 156
           G   +S +S     +  + T L+    D +  L+ L   G+ +R+ ++ H+  +T ++F 
Sbjct: 501 GDMLMSRNSPVVGALQYYNTALITGSSDGIARLWDL-RIGKVVRS-MEGHNGAITSLQFD 558

Query: 157 PTDSNLLLSGSTDGYVNVYDLK 178
           P     L + STDG + V+DL+
Sbjct: 559 PIK---LTTSSTDGDIRVWDLR 577

>ABL024W Chr2 (353682..355886) [2205 bp, 734 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR102C and YKL121W
          Length = 734

 Score = 35.0 bits (79), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 24/48 (50%), Gaps = 2/48 (4%)

Query: 139 LRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEEDEAL 186
           L+ FV  H D VT V+FHP D     SG  D  V  + + + E  EA 
Sbjct: 248 LKTFV--HPDFVTCVRFHPHDDRFFFSGCLDHTVRTWSILEGEVAEAF 293

>TDEL0E04280 Chr5 complement(799966..801411) [1446 bp, 481 aa] {ON}
           Anc_5.201 YLL011W
          Length = 481

 Score = 35.0 bits (79), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 33/151 (21%), Positives = 61/151 (40%), Gaps = 7/151 (4%)

Query: 37  VHLVDWATGKSVLDVAAHESSINGLQVLDSAHDRGTVFATAADDGVKLFDIRTRGCVATL 96
           + L D A  K + +++    +I  ++   +  D   + +T +D+ + L+D+RT      +
Sbjct: 195 IQLWDTARSKPLSNLSWGADNITSVKFNQTETD--ILASTGSDNSIVLYDVRTNSPTQKI 252

Query: 97  TDANGAPALSLDSRHGMLAFGTELVGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFH 156
                  A+  +    M AF       D     + +    R L  F D H   V DV F 
Sbjct: 253 VQRLRTNAICWNP---MEAFNFVTANEDHNAYYYDMRNMSRALNVFKD-HVSAVMDVDFA 308

Query: 157 PTDSNLLLSGSTDGYVNVYDLKQSEEDEALH 187
           PT  + +++GS D  + ++        E  H
Sbjct: 309 PT-GDEIVTGSYDKTIRIFKTNHGHSREIYH 338

 Score = 30.8 bits (68), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 13/48 (27%), Positives = 30/48 (62%)

Query: 148 DDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEEDEALHQVINFASI 195
           D++T VKF+ T++++L S  +D  + +YD++ +   + + Q +   +I
Sbjct: 214 DNITSVKFNQTETDILASTGSDNSIVLYDVRTNSPTQKIVQRLRTNAI 261

>Ecym_2401 Chr2 complement(781043..782323) [1281 bp, 426 aa] {ON}
           similar to Ashbya gossypii ACR137W
          Length = 426

 Score = 34.7 bits (78), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 27/115 (23%), Positives = 54/115 (46%), Gaps = 9/115 (7%)

Query: 57  SINGLQVLDSAHDRGTVFATAADDGVKLFDIRTRGCVATLTDANGAPALSLDSRHGMLAF 116
           +++G+  +D       + +   D  V+++DIR+R CV TL    G       ++   LA 
Sbjct: 198 TLSGVYSVDVHPTLDLIVSAGRDSVVRIWDIRSRTCVMTLAGHKGPI-----NKARCLAV 252

Query: 117 GTELV--GVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTD 169
             ++V    DA V L+ +   G+ ++     H  +V D+ F+P + +   + + D
Sbjct: 253 DPQVVSCSTDATVRLWDITA-GKTIKTLT-HHKRNVRDITFNPAEFSFTTACTDD 305

>TPHA0B04250 Chr2 complement(995664..997187) [1524 bp, 507 aa] {ON}
           Anc_1.107 YNL253W
          Length = 507

 Score = 35.0 bits (79), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 32/134 (23%), Positives = 53/134 (39%), Gaps = 9/134 (6%)

Query: 46  KSVLDVAAHESSINGLQVLDSAHDRGTVFATAADDGVKL-FDIRTRGCVATLTDANGAPA 104
           K+++ V AH   I GL+V       G    +  +DG  L +D+ +  C++T+ +      
Sbjct: 268 KNIIKVPAHRGKITGLKVTP----LGDKLVSVGEDGACLIWDLESLTCISTIVECESNIR 323

Query: 105 LSLDSRHGMLAFGTELVGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLL 164
               S  G L       G      +    +    +  +   H D    VKF+P  S L++
Sbjct: 324 TFDLSPSGKLLVVVSEEGKFRFYDMITTEK----INDYDQKHLDSDFIVKFYPNKSWLMI 379

Query: 165 SGSTDGYVNVYDLK 178
           SG  D    +Y  K
Sbjct: 380 SGENDTLCRLYSEK 393

>Suva_6.187 Chr6 complement(344709..346853) [2145 bp, 714 aa] {ON}
           YJL112W (REAL)
          Length = 714

 Score = 35.0 bits (79), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 31/84 (36%), Positives = 47/84 (55%), Gaps = 10/84 (11%)

Query: 96  LTDANGAPAL-SLDSRHGMLAFGTELVGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVK 154
           LT  +  P++ +L S    LA GT+    D VV L+ L   G+ +R  ++ H D +T +K
Sbjct: 560 LTQRSERPSIGALQSFDAALATGTK----DGVVRLWDLRS-GKVIRT-LEGHTDAITSLK 613

Query: 155 FHPTDSNLLLSGSTDGYVNVYDLK 178
           F   DS  L++GS D  V V+DL+
Sbjct: 614 F---DSACLVTGSYDRTVRVWDLR 634

>SAKL0H15708g Chr8 (1370148..1371254) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|Q750X9 Ashbya gossypii AGL190W
           AGL190Wp and similar to YDR142C uniprot|P39108
           Saccharomyces cerevisiae YDR142C PEX7 May serve as
           intraperoxisomal receptor for type 2 peroxisomal
           proteins (such as thiolase) Member of
           beta-transducin-related (WD- 40) protein family
          Length = 368

 Score = 34.7 bits (78), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 51/128 (39%), Gaps = 25/128 (19%)

Query: 66  SAHDRGTVFATAADDGVKLFDIR--TRGCVATLTDANGAPALSLD---SRHGMLAFGTEL 120
           S HD   +   A +  V LFD+R  T           G   L+ D    R  ++A G   
Sbjct: 185 SPHDPNLIMCCAGNSYVTLFDLRQPTNTNQQNFMSHGGLETLTCDFNKYRPHIVATG--- 241

Query: 121 VGVDAVVSLFALGEWGRPLRAF------------VDSHHDDVTDVKFHPTDSNLLLSGST 168
            GVD +V ++ L    R +R F            +  H   +  V + P  SNL+LS S 
Sbjct: 242 -GVDKLVKIWDL----RMVRKFSNPLQQPMSINEIPGHELAIRKVSWSPHHSNLVLSTSY 296

Query: 169 DGYVNVYD 176
           D    V+D
Sbjct: 297 DMTCRVWD 304

>NDAI0E01500 Chr5 complement(295871..297157) [1287 bp, 428 aa] {ON}
           Anc_8.631
          Length = 428

 Score = 34.7 bits (78), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 63/138 (45%), Gaps = 22/138 (15%)

Query: 53  AHESSINGLQVLDSAHDRGTVFATAADDGVKLFDIRTRGCVATLTDANG-APALSLDSRH 111
            H   I+ ++  D++H    V  ++ D    L++I     +   +D  G   AL++ SR 
Sbjct: 177 GHTCYISDIEFWDNSH----VITSSGDMTCALWNIPKAKRLREYSDHLGDVLALAMPSRQ 232

Query: 112 GMLAFGTELVGVDAVVSLFA-LGEWG----------RPLRAFVDSHHDDVTDVKFHPTDS 160
           G     TE  G     S+FA  G  G            ++ F  S   DVT +KF   D 
Sbjct: 233 G----ATETDGESNDSSIFASCGSDGYTYIWDTRSPSAVQKFFVSD-SDVTSIKFFK-DG 286

Query: 161 NLLLSGSTDGYVNVYDLK 178
           N +++GS DG +N++DL+
Sbjct: 287 NSIITGSDDGIINMFDLR 304

>ZYRO0B10450g Chr2 complement(825240..826688) [1449 bp, 482 aa] {ON}
           highly similar to uniprot|P33750 Saccharomyces
           cerevisiae YLL011W
          Length = 482

 Score = 34.7 bits (78), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 48/208 (23%), Positives = 82/208 (39%), Gaps = 49/208 (23%)

Query: 148 DDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEEDEALHQVINFASIHSCGWLSPKRIW 207
           D++T VKF+  DSN+L S  +D  + +YDL+ +   + + Q +   S+  C        W
Sbjct: 213 DNITSVKFNQNDSNILASTGSDNSIVLYDLRTNSPTQKIVQQMRTNSL--C--------W 262

Query: 208 SLSHMETFAIHELNDKSEHANEPQPQLFGDVREPWACDYVVDVYPGFIAAGSTRENAGEL 267
           +   ME F            NE     + D+R+    +  ++V+   ++A        ++
Sbjct: 263 NP--MEPFNFVT-------GNEDHNAYYYDMRK---MNRALNVFKDHVSA------VMDV 304

Query: 268 RLLPLRDECVDAA-----NAIVLPQAHGDEV-----VRDVLVPASSPELLY--SAGEDGN 315
              P  DE V  +             H  EV     ++ V     S +  Y  S  +DGN
Sbjct: 305 DFAPTGDEIVTGSYDKTIRIFKTNHGHSREVYHTKRMQHVFQVKYSMDSKYIVSGSDDGN 364

Query: 316 MAIWKSTLGPLNVPVDFWDYSKKETVLE 343
           + +W+S           WD S  +T  E
Sbjct: 365 VRLWRSKA---------WDRSNAKTSRE 383

>KLTH0B03410g Chr2 complement(276115..277548) [1434 bp, 477 aa] {ON}
           highly similar to uniprot|P33750 Saccharomyces
           cerevisiae YLL011W
          Length = 477

 Score = 34.7 bits (78), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 40/175 (22%), Positives = 76/175 (43%), Gaps = 21/175 (12%)

Query: 30  AALSNGHVHLVDWATGKSVLDVAAHESSINGL----QVLDSAHDRGTVFATAADDGVKLF 85
           +A ++G V   + +T + +    AH   ++GL    Q L +  +   + +   D  VKL+
Sbjct: 85  SASADGVVKYWNMSTREEICSFKAHYGLVHGLCVTPQHLSANKNENYMLSCGDDKTVKLW 144

Query: 86  DIRTRGCVATLTDANGAPALSL-DSRHGMLAFGTELVGVDA-------VVSLFALGEW-- 135
            + T    ++  D   +    L  + HG  AF    +G+D        V +   +  W  
Sbjct: 145 SVNTEDFSSSKNDEEQSSTDGLIKTFHGDYAF----LGIDHHRSKPYFVTAGAEINLWDS 200

Query: 136 --GRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEEDEALHQ 188
              RP  A +    D+V+ VKF+  ++++  S  +D  V +YDL+ +   +   Q
Sbjct: 201 SRSRPT-ANLSWGADNVSTVKFNQNETDIFASAGSDNSVVLYDLRTNSPTQKFTQ 254

>SAKL0H22396g Chr8 complement(1949474..1951141) [1668 bp, 555 aa]
           {ON} similar to uniprot|P53197 Saccharomyces cerevisiae
           YGL003C CDH1 CDC20 homolog 1 protein required for Clb2
           and Ase1 degradation
          Length = 555

 Score = 34.7 bits (78), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 51/196 (26%), Positives = 79/196 (40%), Gaps = 19/196 (9%)

Query: 13  ADNWCLRLRPLYQAGVLAALSNGHVHLVDWATGKSV--LDVAAHESSINGLQVLDSAHDR 70
           AD++   L       VL  +    V L D AT + V   D     +SIN +         
Sbjct: 250 ADDFYFDLVDWSSTDVLGVVLGKSVFLTDNATNEVVQLCDTENEYTSINWVGA------- 302

Query: 71  GTVFATAADDG-VKLFDIRTRGCVATLTDANGAPALSLDSRHGMLAFGTELVGVDAVVSL 129
           G+  A    +G V+++DI  R C+ TL+      A  L   + +L  G+    +     L
Sbjct: 303 GSHLAVGQGNGLVEIYDIVKRKCIRTLSGHMDRVAC-LSWNNHILTSGSRDRKI-----L 356

Query: 130 FALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEEDEALHQV 189
                   P    V++H  +V  +K++ TD N L SG  D  V VYD   +     L   
Sbjct: 357 HRDVRMPEPYFEQVETHTQEVCGLKWN-TDENRLASGGNDNVVYVYD--GTSRKPTLKLA 413

Query: 190 INFASIHSCGWLSPKR 205
            + A++ +  W   KR
Sbjct: 414 EHTAAVKAIAWSPHKR 429

>NCAS0A01850 Chr1 complement(356138..358243) [2106 bp, 701 aa] {ON}
           Anc_4.77 YGR145W
          Length = 701

 Score = 34.7 bits (78), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 49/108 (45%), Gaps = 10/108 (9%)

Query: 98  DANGAPALSLDSRHGMLAFGTELVGVDAVVSLFALGEWGRPLRAFVDSHHDD----VTDV 153
           D+ G   +S++S +G++A G E    + VV  +      R  + F+++  D+    VT  
Sbjct: 179 DSEGVNHVSVNSTNGLVATGME----ENVVEFWDPRSRSRVAKLFLENQFDNNAFQVTTT 234

Query: 154 KFHPTDSNLLLSGSTDGYVNVYDLKQSEEDEALHQVINFASIHSCGWL 201
            F     N    G+++GY  +YDL+ SE      Q   F  I    WL
Sbjct: 235 SFRNDGLNFAC-GTSNGYTYLYDLRSSEPITVKDQGYGF-DIKKIIWL 280

>KNAG0E02470 Chr5 (490378..491907) [1530 bp, 509 aa] {ON} Anc_2.469
           YMR093W
          Length = 509

 Score = 34.3 bits (77), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 47/113 (41%), Gaps = 12/113 (10%)

Query: 74  FATAADDGVKLFDIRTRGCVATLTDANGAPALSLDSRHGMLAFGTELVGVDAVVSLFALG 133
           FA  +   V++F  RTR  V T +        +        A G  LV  DA   L ++ 
Sbjct: 55  FAVTSSTRVQIFSSRTRQVVKTFSRFKDVVYCA-----NFRADGKLLVAGDAT-GLVSVY 108

Query: 134 EWGRPLRAFVD----SHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEE 182
           +   P    V     +H   VT  KFHP DS  L++ S D    ++D+  + E
Sbjct: 109 DSYNPRNVLVSIQASTHPTHVT--KFHPMDSKTLITSSDDRVTRLWDISHAYE 159

>ABL044C Chr2 complement(312376..313932) [1557 bp, 518 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR093W
          Length = 518

 Score = 34.3 bits (77), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 46/109 (42%), Gaps = 4/109 (3%)

Query: 74  FATAADDGVKLFDIRTRGCVATLTDANGAPALSLDSRHGMLAFGTELVGVDAVVSLFALG 133
           FA  +   V+LF  RTR  + T +        S     G L    +  G+ +V   +   
Sbjct: 55  FAVTSSTRVQLFSSRTRQVIKTFSRFKDVVYSSSFRPDGKLLAAGDATGLVSVYDSYNPR 114

Query: 134 EWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEE 182
                ++A   +H   VT  KFHP D   L++ + D  V V+D+  + E
Sbjct: 115 NLLVSIKA--STHPAHVT--KFHPLDKQTLVTATDDRVVRVWDISHAYE 159

>Ecym_7105 Chr7 complement(205465..206919) [1455 bp, 484 aa] {ON}
           similar to Ashbya gossypii AAL157C
          Length = 484

 Score = 34.3 bits (77), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 30/48 (62%)

Query: 148 DDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEEDEALHQVINFASI 195
           D++T VKF+  +++LLLS  +D  V +YDL+ +   + + Q +   S+
Sbjct: 216 DNITAVKFNQNEADLLLSSGSDNSVVLYDLRTNSPTQKIVQTMKTNSM 263

>Ecym_2093 Chr2 (165578..168349) [2772 bp, 923 aa] {ON} similar to
           Ashbya gossypii AAR057W
          Length = 923

 Score = 34.3 bits (77), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 40/187 (21%), Positives = 81/187 (43%), Gaps = 21/187 (11%)

Query: 35  GHVHLVDWATGKSVLDVAAHESSINGLQVLDSAHDRGTVFATAADDG-VKLFDIRTRGCV 93
           G + + +W +   +L    H  ++N L    +    G+   TA+ DG +K++DI +  C+
Sbjct: 337 GQLLVYEWQSESYILKQQGHFDTMNDL----AYSPDGSRIVTASSDGKIKIWDIVSGFCL 392

Query: 94  ATLTDANGAPALSLDSRHGMLAFGTELVGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDV 153
           AT  +   A      ++ G + F   L   D  V  + L  + R  R F  +       +
Sbjct: 393 ATFEEHVSAVTAVQFAKKGQIMFSACL---DGTVKAWDLIRY-RNFRTFTATERIQFNCL 448

Query: 154 KFHPTDSNLLLSGSTDGY-VNVYDLKQSEEDEALH------QVINFAS----IHSCGWLS 202
              P+   ++ +GS D + ++V+ ++  +  + L         ++F++    + S  W  
Sbjct: 449 AVDPS-GEIVCAGSLDDFNIHVWSVQTGQLLDTLSGHEGPVSCLSFSNENSVLASASWDK 507

Query: 203 PKRIWSL 209
             RIWS+
Sbjct: 508 TIRIWSI 514

>Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}
           YPL247C (REAL)
          Length = 522

 Score = 34.3 bits (77), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 62/152 (40%), Gaps = 29/152 (19%)

Query: 51  VAAHESSINGLQVLDSAHDRGTVFATAADDG-VKLFDIRTRGCVATLTDANGAPALSLDS 109
           + AH+S +  ++ L  +     +FA+   DG V++FD+R+      + +   +PA    S
Sbjct: 283 LIAHDSEVFDVRFLTKSTQ---LFASCGGDGSVRVFDLRSLAHSTIIYEPPSSPA----S 335

Query: 110 RHGMLAFGTELVGVDAVVSLFALGEWGRPLRAF---------------------VDSHHD 148
                A    L G DA++ L         L  F                     ++ H  
Sbjct: 336 GPNAGATTPSLKGSDALLRLEPSPYDPNVLATFAADSNKIIILDMRNPESPILNLEGHTC 395

Query: 149 DVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQS 180
            V ++K+HPT  N+LLS S D     +DL  S
Sbjct: 396 SVNEIKWHPTKRNVLLSCSDDCQALYWDLNNS 427

>TBLA0F00520 Chr6 complement(134791..136782) [1992 bp, 663 aa] {ON}
           Anc_6.363 YCR084C
          Length = 663

 Score = 34.3 bits (77), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 67/149 (44%), Gaps = 16/149 (10%)

Query: 37  VHLVDWATGKSVLDVAAHESSINGLQVLDSAHDRGTVFATAADDGVKLFDIRTRGCVATL 96
           + + D    K V+ +  HE  I  L    S      + + + D  V+++D+ T  C+ TL
Sbjct: 390 IRIWDITLKKIVMILNGHEQDIYSLDYFPSGD---KIVSGSGDRTVRIWDLNTGQCLLTL 446

Query: 97  TDANGAPALSLDSRHGMLAFGTELVGVDAVVSLFALGEWGRPLRAFVDS------HHDDV 150
           +  +G   +++      +A G+    +D  V ++   E G  L   +DS      H D V
Sbjct: 447 SIEDGVTTVAVSPDGKFIAAGS----LDRAVRVWD-AETGF-LVERLDSNELGTGHEDSV 500

Query: 151 TDVKFHPTDSNLLLSGSTDGYVNVYDLKQ 179
             V F     N++ SGS D  V +++LKQ
Sbjct: 501 YSVVFTKDGKNVV-SGSLDKTVKLWNLKQ 528

>Kpol_1048.59 s1048 complement(166721..169273) [2553 bp, 850 aa]
           {ON} complement(166721..169273) [2553 nt, 851 aa]
          Length = 850

 Score = 34.3 bits (77), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 56/116 (48%), Gaps = 8/116 (6%)

Query: 66  SAHDRGT-VFATAADDGVKLFDIRTRGCVATLTDANGA-PALSLDSRHGMLAFGTELVGV 123
           S H  G  +F  ++D  V+++DI T   V      N    +LS+      ++ G++    
Sbjct: 666 SFHSNGRYIFTGSSDKTVRMWDINTGDSVRLFMGHNSTVTSLSVSPDGKWISTGSD---- 721

Query: 124 DAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQ 179
           D +++++ +G  GR L+         +  + ++P +  LL+SG  D  V V+DL +
Sbjct: 722 DGIITIWDIGS-GRKLKNMRGHGKSSIHSLSYNP-EGTLLVSGGADQSVRVWDLNK 775

>ZYRO0F09372g Chr6 (761606..762952) [1347 bp, 448 aa] {ON} highly
           similar to uniprot|Q12024 Saccharomyces cerevisiae
           YOR272W YTM1 microtubule-associated protein
          Length = 448

 Score = 34.3 bits (77), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 55/118 (46%), Gaps = 4/118 (3%)

Query: 62  QVLDSAHDRGTVFATAADDGVKLFDIRTRGCVATLTDANGAPALS-LDSRHGMLAFGTEL 120
           Q L  A D    ++ + D  VK +D+ T  CV T T +    +L+ L S H +LA G+  
Sbjct: 280 QALFDARDNTVGYSVSQDHTVKTWDLVTSRCVDTKTTSYSLLSLAQLPSLH-LLACGSSA 338

Query: 121 VGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLK 178
             +   +  F      +  +  +  H + V  +   P +  +L+SGS DG   V+D++
Sbjct: 339 RHI--TLHDFRANSSSKITQQQLLGHKNFVVSLDTCPENEYMLVSGSHDGTAKVWDIR 394

>SAKL0G16962g Chr7 (1463359..1463363,1463442..1465290) [1854 bp, 617
           aa] {ON} similar to uniprot|Q06440 Saccharomyces
           cerevisiae YLR429W CRN1 Coronin cortical actin
           cytoskeletal component that associates with the
           Arp2p/Arp3p complex to regulate its activity
          Length = 617

 Score = 34.3 bits (77), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 28/46 (60%), Gaps = 1/46 (2%)

Query: 137 RPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEE 182
           +PL+ F+  H   V  V FHPT +N+L S S D  V ++D++  +E
Sbjct: 131 KPLK-FLTGHSRKVGHVLFHPTANNVLASSSLDYTVKLWDIESGKE 175

>Kpol_1024.42 s1024 complement(112044..114575) [2532 bp, 843 aa]
           {ON} complement(112044..114575) [2532 nt, 844 aa]
          Length = 843

 Score = 34.3 bits (77), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 61/119 (51%), Gaps = 13/119 (10%)

Query: 73  VFATAADDGVKLFDIRTRGCVATLTDANGAPALSL----DSRHGMLAFGTELVGVDAVVS 128
           VF  ++D   +++D+ T G    L   + AP +SL    D R   LA G+E    D +++
Sbjct: 662 VFTGSSDKTCRMWDVST-GETVRLFLGHTAPVVSLGVSPDGR--WLASGSE----DGLIN 714

Query: 129 LFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEEDEALH 187
           ++ +G  G+ L+       + V  + F   +  +++SG TD  V V+D+ +S  + +++
Sbjct: 715 VWDIGS-GKRLKQMRGHGRNAVNSIVF-SQEGTVIISGGTDNSVRVWDMYKSNNESSIN 771

>ZYRO0G03146g Chr7 complement(238354..239886) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|Q04305 Saccharomyces
           cerevisiae YMR093W UTP15 Nucleolar protein component of
           the small subunit (SSU) processome containing the U3
           snoRNA that is involved in processing of pre-18S rRNA
          Length = 510

 Score = 33.9 bits (76), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 45/111 (40%), Gaps = 4/111 (3%)

Query: 74  FATAADDGVKLFDIRTRGCVATLTDANGAPALSLDSRHGMLAFGTELVGVDAVVSLFALG 133
           FA  +   V+LF  RTR  + T +        +     G L    +  G+ +V   +   
Sbjct: 55  FAVTSSTRVQLFSSRTRQVIKTFSRFKDVVYSASFRNDGKLLCAGDATGLVSVYDSYN-- 112

Query: 134 EWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEEDE 184
              R L   +++        KFH  DS  L++ S D    V+D+ QS E +
Sbjct: 113 --PRALLVSINASTHPTHVTKFHSHDSKSLVTASDDRITRVWDISQSYEPQ 161

>NCAS0F03340 Chr6 complement(675569..676915) [1347 bp, 448 aa] {ON}
           Anc_5.429 YDR364C
          Length = 448

 Score = 33.9 bits (76), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 22/41 (53%)

Query: 137 RPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDL 177
           + ++  +D H +  T + F P   NLLLSG  D  V V+D 
Sbjct: 145 KKIKYAMDGHTNGTTSLTFLPNSGNLLLSGGNDNIVKVWDF 185

>NCAS0I02490 Chr9 complement(465916..467796) [1881 bp, 626 aa] {ON}
           Anc_3.95 YDR488C
          Length = 626

 Score = 33.9 bits (76), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 23/34 (67%)

Query: 143 VDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYD 176
           V+ H  DVT ++FHP + +LL SGS D   +++D
Sbjct: 487 VNFHSSDVTSLRFHPQNDDLLCSGSMDWNCHLWD 520

>Kwal_33.15136 s33 (974095..975516) [1422 bp, 473 aa] {ON} YLL011W
           (SOF1) - 56 kDa nucleolar snRNP protein that shows
           homology to beta subunits of G-proteins and the splicing
           factor Prp4 [contig 94] FULL
          Length = 473

 Score = 33.9 bits (76), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 38/163 (23%), Positives = 65/163 (39%), Gaps = 16/163 (9%)

Query: 30  AALSNGHVHLVDWATGKSVLDVAAHESSINGL----QVLDSAHDRGTVFATAADDGVKLF 85
            A ++G V   + +T + V    AH   I+GL    Q L    +   + +   D  VKL+
Sbjct: 85  TASADGVVKYWNMSTREEVCSFKAHYGLIHGLCVTPQHLSQNKNENYMLSCGDDRTVKLW 144

Query: 86  DIRT------RGCVATLTDANGAPALSLDSRHGMLAFGTELVGVDAVVSLFALGEW---- 135
            + T      RG    +   NG    +    H  L         + V     +  W    
Sbjct: 145 SVNTDDFSSERGDEEVIKSGNGLIK-TFHGEHAFLGIDHHRSNSNFVTGGAEINLWDSTR 203

Query: 136 GRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLK 178
            RP+   +    D+V+ VKF+  ++++  S  +D  V +YDL+
Sbjct: 204 SRPI-TNLSWGADNVSTVKFNQNETDIFASAGSDNSVVLYDLR 245

>Skud_10.102 Chr10 (173179..175305) [2127 bp, 708 aa] {ON} YJL112W
           (REAL)
          Length = 708

 Score = 33.9 bits (76), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 46/84 (54%), Gaps = 10/84 (11%)

Query: 96  LTDANGAPAL-SLDSRHGMLAFGTELVGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVK 154
           LT  +  P + +L S    LA GT+    D +V L+ L   G+ +R  ++ H D +T +K
Sbjct: 554 LTQRSERPTIGALQSFDAALATGTK----DGIVRLWDLRS-GKVIRT-LEGHTDAITSLK 607

Query: 155 FHPTDSNLLLSGSTDGYVNVYDLK 178
           F   DS  L++GS D  V V+DL+
Sbjct: 608 F---DSACLVTGSYDRTVRVWDLR 628

>Ecym_4280 Chr4 complement(600066..603464) [3399 bp, 1132 aa] {ON}
           similar to Ashbya gossypii AGR067W
          Length = 1132

 Score = 34.3 bits (77), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 22/36 (61%)

Query: 146 HHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSE 181
           H   +TD+ FHP+   LL + S D YV+ +D++  +
Sbjct: 113 HFRAITDINFHPSHPELLATCSIDTYVHAWDMRSPQ 148

>AGR067W Chr7 (842176..845553) [3378 bp, 1125 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR128W
          Length = 1125

 Score = 33.9 bits (76), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 22/36 (61%)

Query: 146 HHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSE 181
           H   +TD+ FHP    LL + S D YV+ +D++ S+
Sbjct: 113 HTRAITDINFHPIHPELLATCSIDTYVHAWDMRCSQ 148

>ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL138C
          Length = 1361

 Score = 34.3 bits (77), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 30/141 (21%), Positives = 58/141 (41%), Gaps = 8/141 (5%)

Query: 120 LVGVDAVVSLFALGEWG---RPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYD 176
           + G    VS++ +        PL   +  H   +  V F+   ++LL+SG  DG + V+D
Sbjct: 201 ICGTSTSVSIYDINRASAKDSPLITTLSEHSRSINSVDFNMGQTHLLISGGQDGCIKVWD 260

Query: 177 LKQSEEDEALHQVINFA----SIHSCGWLSPKRIWSLSHMETFAIHELNDKSEHANEPQP 232
           L+ S   +     +NF     S+    W+      SL    +      ++K    ++   
Sbjct: 261 LR-SHSYKVNRSDLNFNSGSDSVRDVKWMPTYDFASLGADTSLCSSGRSNKFASVHDSGL 319

Query: 233 QLFGDVREPWACDYVVDVYPG 253
            L  D+R+P   +  ++ + G
Sbjct: 320 LLTFDMRQPNQVERKINAHSG 340

>KNAG0A01250 Chr1 (23559..24917) [1359 bp, 452 aa] {ON} Anc_3.25
           YNL317W
          Length = 452

 Score = 33.9 bits (76), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 35/131 (26%), Positives = 60/131 (45%), Gaps = 22/131 (16%)

Query: 71  GTVFATAADDGVKLFDIRTRGCVATLTDANGAPALSLDSRHGMLAF------GTELVGV- 123
           G + + + D+ VKL+D RT  CV+T+          L  +H +L        G  L+G+ 
Sbjct: 221 GLIASASKDNLVKLWDPRTGNCVSTI----------LKFKHTVLKTRFQPGGGNLLLGIS 270

Query: 124 -DAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEE 182
            D    +F + +    L  F D    D   + +HP + +    G+ DG +  +D+ Q + 
Sbjct: 271 KDKSCRVFDIRQNMTELMVFRDD--VDYMTLLWHPINHSTFTVGNYDGSIKHFDVLQ-DI 327

Query: 183 DEALHQVINFA 193
            + +H VI FA
Sbjct: 328 TKPVH-VIPFA 337

>Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}
           YPL247C (REAL)
          Length = 526

 Score = 33.9 bits (76), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 30/57 (52%), Gaps = 6/57 (10%)

Query: 143 VDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEEDEALHQVINFASIHSCG 199
           ++ H   V ++K+HPT  N+LLS S D  V  +DL  S  +      IN  S+ S G
Sbjct: 392 LEGHSSSVNEIKWHPTKRNVLLSCSDDCQVLYWDLNNSFME------INGGSVKSPG 442

>KLTH0G12276g Chr7 complement(1042617..1045430) [2814 bp, 937 aa]
           {ON} highly similar to uniprot|Q12220 Saccharomyces
           cerevisiae YLR129W DIP2 Nucleolar protein specifically
           associated with the U3 snoRNA part of the large
           ribonucleoprotein complex known as the small subunit
           (SSU) processome required for 18S rRNA biogenesis part
           of the active pre-rRNA processing complex
          Length = 937

 Score = 33.9 bits (76), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 28/134 (20%), Positives = 59/134 (44%), Gaps = 11/134 (8%)

Query: 49  LDVAAHESSINGLQVLDSAHDRGTVFATAADDGVKLFDIRTRGCVATLTDANGAPALSLD 108
           +D+  H + +  + +     D   + ATA++  +K+++I+T+ C+ T  +   A A    
Sbjct: 379 IDIKGHRTDVRAIDI----SDDNKLLATASNGSLKIWNIKTKSCIRTF-ECGYALACKFL 433

Query: 109 SRHGMLAFGTELVGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGST 168
               ++  GT+       ++LF L      L + +++ H           D   L++GS 
Sbjct: 434 PGGALVVIGTK----TGDLNLFDLA--SSTLLSSIEAAHSGAIWSLDLTADGKRLVTGSA 487

Query: 169 DGYVNVYDLKQSEE 182
           D  V  +D +  +E
Sbjct: 488 DKSVRFWDFQVEQE 501

>KAFR0A06480 Chr1 complement(1312834..1314540) [1707 bp, 568 aa]
           {ON} Anc_4.122 YGL003C
          Length = 568

 Score = 33.9 bits (76), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 64/137 (46%), Gaps = 12/137 (8%)

Query: 71  GTVFATAADDG-VKLFDIRTRGCVAT-LTDANGAPALSLDSRHGMLAFGTELVGVDAVVS 128
           G+  A    +G V++FD+  + C+ T L  ++    LS +S   +L  G+    +     
Sbjct: 315 GSHLAVGQSNGIVEIFDVNKKKCIRTMLGHSDRVACLSWNSY--ILTSGSRDHNI----- 367

Query: 129 LFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEEDEALHQ 188
           L        P    ++SH  +V  +K++  D N L+SG  D  VNVYD   ++    + +
Sbjct: 368 LHRDVRSPDPFFEKIESHSQEVCGLKWN-VDENKLVSGGNDNIVNVYDRTSTKPFMTMTE 426

Query: 189 VINFASIHSCGWLSPKR 205
             + A++ +  W S KR
Sbjct: 427 --HKAAVKALDWSSHKR 441

>Suva_8.321 Chr8 (572329..573711) [1383 bp, 460 aa] {ON} YOR272W
           (REAL)
          Length = 460

 Score = 33.9 bits (76), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 29/137 (21%), Positives = 63/137 (45%), Gaps = 9/137 (6%)

Query: 62  QVLDSAHDRGTVFATAADDGVKLFDIRTRGCVATLTDANGAPALSLDSRHGMLAFGTELV 121
           QV+  + D    ++ + D  +K +D+ T  C+ T   +    +++      +LA G+   
Sbjct: 292 QVIFDSTDNTVGYSVSQDHTIKTWDLVTARCIDTRATSYSLLSIAQLPSLNLLACGSSAR 351

Query: 122 GVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQ-- 179
            +   +    LG   +  +  +  H + V+ +   P +  +L SGS DG V V+D++   
Sbjct: 352 HI--TLHDPRLGASSKVTQQQLIGHKNFVSSLDTCPENEYILCSGSHDGTVKVWDIRSTA 409

Query: 180 -----SEEDEALHQVIN 191
                + ED+++ + +N
Sbjct: 410 PMYTITREDKSVQKGVN 426

>CAGL0G04345g Chr7 (408842..410977) [2136 bp, 711 aa] {ON} similar
           to uniprot|P47025 Saccharomyces cerevisiae YJL112w MDV1
          Length = 711

 Score = 33.9 bits (76), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 20/92 (21%), Positives = 43/92 (46%), Gaps = 5/92 (5%)

Query: 24  YQAGVLAALSNGHVHLVDWATGKSVLDVAAHESSINGLQVLDSAHDRGTVFATAADDGVK 83
           + A +     +G + L D  TG+ V  +  H  +I  L+      D  T+ + + D  ++
Sbjct: 573 FDAALATGTKDGLIRLWDMRTGEVVRVLEGHMDAITSLKF-----DATTIISGSLDGTIR 627

Query: 84  LFDIRTRGCVATLTDANGAPALSLDSRHGMLA 115
           L+D+R+      ++      +L  D++H ++A
Sbjct: 628 LWDLRSNNLTDIISYEKPISSLDFDAKHIVVA 659

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 57/119 (47%), Gaps = 17/119 (14%)

Query: 106 SLDSRHGMLAFGTELVGVDAVVSLFAL--GEWGRPLRAFVDSHHDDVTDVKFHPTDSNLL 163
           S+ S    LA GT+    D ++ L+ +  GE  R L    + H D +T +KF   D+  +
Sbjct: 569 SIQSFDAALATGTK----DGLIRLWDMRTGEVVRVL----EGHMDAITSLKF---DATTI 617

Query: 164 LSGSTDGYVNVYDLKQSEEDEALHQVINFASIHSCGWLSPKRIWSLSHMETFAIHELND 222
           +SGS DG + ++DL+ +     L  +I++    S      K I   S+     I++ ND
Sbjct: 618 ISGSLDGTIRLWDLRSNN----LTDIISYEKPISSLDFDAKHIVVASNEHNTHIYDRND 672

>NCAS0F00190 Chr6 complement(29012..30247) [1236 bp, 411 aa] {ON}
           Anc_6.9 YEL056W
          Length = 411

 Score = 33.5 bits (75), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 50/107 (46%), Gaps = 6/107 (5%)

Query: 73  VFATAADDG-VKLFDIRTRGCVATLTDANGAPALSLD-SRHGMLAFGTELVGVDAVVSLF 130
           VF + ++D  ++L D R +    +    + AP  +L  S+H    F     G D+ V LF
Sbjct: 233 VFGSVSEDSTLQLHDQREKDTFTSQFKVD-APFNTLAFSKHSQYLFAA--AGTDSHVYLF 289

Query: 131 ALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDL 177
              +  RPL +    H   VT+++F P    +L++   D    ++D+
Sbjct: 290 DRRDISRPLHSMA-GHDGAVTNMEFSPDQDGILMTSGEDRRAIIWDI 335

>Ecym_4249 Chr4 complement(516064..517188) [1125 bp, 374 aa] {ON}
           similar to Ashbya gossypii AGL190W
          Length = 374

 Score = 33.5 bits (75), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 37/163 (22%), Positives = 69/163 (42%), Gaps = 19/163 (11%)

Query: 23  LYQAGVLAALSNGHVHLVDWATGK-SVLDVAAHESSINGLQVLDSAHDRGTVFATAADDG 81
           L++  VLAA  +G + L D    K  V     HE  +       +  D+ T  +++ D  
Sbjct: 72  LHENQVLAAQGDGSLRLFDINLQKYPVAIFQEHEREVFSCNW--NLIDKQTFLSSSWDGT 129

Query: 82  VKLFDIRTRGCVATLTDANGAPALSLDSRHGMLAFGTELVGVDAVVSLFALGEWGRPLRA 141
           VK++    +  + TL        + +DS          ++  D  VS        +    
Sbjct: 130 VKIWSPARKQSLRTLLPTPTNNTVLVDS---------TVLKQDVPVS-------NQAQHK 173

Query: 142 FVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEEDE 184
           +  ++ D +    + P DSNL++S S + YV+++D++Q    E
Sbjct: 174 YSSNNKDCIYQALYSPHDSNLVMSCSGNSYVSIFDIRQPVNTE 216

>CAGL0A00561g Chr1 complement(63710..64948) [1239 bp, 412 aa] {ON}
           similar to uniprot|P53196 Saccharomyces cerevisiae
           YGL004c
          Length = 412

 Score = 33.5 bits (75), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 29/45 (64%), Gaps = 2/45 (4%)

Query: 134 EWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLK 178
           EW   L + V +H  DVT VK  P+++ +LLSGSTD  + V+ L+
Sbjct: 129 EWMSKL-SLVGAHVSDVTTVKIFPSNA-VLLSGSTDMQLKVWSLE 171

>KNAG0A01230 Chr1 complement(17341..21306) [3966 bp, 1321 aa] {ON}
           Anc_3.22 YOL138C
          Length = 1321

 Score = 33.9 bits (76), Expect = 0.88,   Method: Composition-based stats.
 Identities = 23/83 (27%), Positives = 37/83 (44%), Gaps = 8/83 (9%)

Query: 127 VSLFALGEWGRPLRAFVDS---HHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEED 183
           VSLF +    +   A V S   H   V    F+   +NLL+SG  DG V ++D++ +   
Sbjct: 216 VSLFDINRANQTDSALVSSLAEHTRSVNSFDFNMMQTNLLISGGQDGCVKIWDIRTNNPT 275

Query: 184 EALHQV-----INFASIHSCGWL 201
           + ++         F SI    W+
Sbjct: 276 KIVNTCDVRINTTFGSIRDIKWM 298

>Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)
          Length = 427

 Score = 33.5 bits (75), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 46/191 (24%), Positives = 81/191 (42%), Gaps = 31/191 (16%)

Query: 5   LQQKVSFGADN-WCLRLRPLYQAGVLAALSNGHVHLVDWATGKSVLDVAA-------HES 56
           LQ  + F  DN + L    L +  +L+   +  V L  W  G +   ++        H  
Sbjct: 178 LQSTLKFHKDNGYALSFNALVEGQLLSGSDDHTVAL--WEVGSNSTSISPVRTWNDLHSD 235

Query: 57  SINGLQVLDSAHD-RGTVFATAADDGV-KLFDIRTRGCVATLTDANGAP------ALSLD 108
            +N ++     H+    +F T ++D + K+ D+R         DA   P      A S  
Sbjct: 236 IVNDIK----WHNFNEKLFGTVSEDSLLKINDVRAHNIT---IDAVKCPQPFNTLAFSHH 288

Query: 109 SRHGMLAFGTELVGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGST 168
           S + + A      G+D+ V L+ L     PL   +  H D VT+++F      +++S  +
Sbjct: 289 SSNLLAA-----AGMDSHVYLYDLRNMREPLH-HMSGHEDAVTNIEFSTHVDGVVVSSGS 342

Query: 169 DGYVNVYDLKQ 179
           D  + ++DLKQ
Sbjct: 343 DNRLIMWDLKQ 353

 Score = 32.0 bits (71), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 50/109 (45%), Gaps = 9/109 (8%)

Query: 75  ATAADDGVKLFDIRTRGCVATLT-DANGAPALSLDSR-HGMLAFGTELVGVDAVVSLFAL 132
           AT    G      R+ G  +TL    +   ALS ++   G L  G++    D  V+L+ +
Sbjct: 161 ATLNGQGTVFLYSRSGGLQSTLKFHKDNGYALSFNALVEGQLLSGSD----DHTVALWEV 216

Query: 133 GEWG---RPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLK 178
           G       P+R + D H D V D+K+H  +  L  + S D  + + D++
Sbjct: 217 GSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVR 265

>SAKL0H05456g Chr8 complement(490546..491886) [1341 bp, 446 aa] {ON}
           highly similar to uniprot|Q12024 Saccharomyces
           cerevisiae YOR272W YTM1 microtubule-associated protein
          Length = 446

 Score = 33.5 bits (75), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 27/119 (22%), Positives = 56/119 (47%), Gaps = 2/119 (1%)

Query: 62  QVLDSAHDRGTVFATAADDGVKLFDIRTRGCVATLTDANGAPALSLDSRHGMLAFGTELV 121
           QV+  ++D    ++ + D  ++ +D+ T  CV T T +    +L+   +  +LA G+   
Sbjct: 278 QVIFDSNDSTVGYSVSQDHTIRTWDLVTARCVDTKTTSYSLLSLAQLPKLNLLACGSSAR 337

Query: 122 GVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQS 180
            +   +    +G   +  +  +  H + V  +   P +  +L S S DG V V+D++ S
Sbjct: 338 HI--TLHDPRVGSSSKITQQQLIGHKNFVVSLDTCPENEYMLCSASHDGTVKVWDIRSS 394

>KAFR0H01750 Chr8 complement(322707..325058) [2352 bp, 783 aa] {ON}
           Anc_8.435 YLR222C
          Length = 783

 Score = 33.9 bits (76), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 35/131 (26%), Positives = 63/131 (48%), Gaps = 13/131 (9%)

Query: 53  AHESSINGLQVLDSAHDRGTVFATAA-DDGVKLFDIRTRGCVATLTD-ANGAPALSLDSR 110
           AHE  IN L +  S +D  ++FATA+ D   K++D+ T   VATL++   G   +S    
Sbjct: 461 AHEKDINALSI--SPND--SIFATASYDKTCKIWDLETGESVATLSNHKRGLWDVSFCQF 516

Query: 111 HGMLAFGTELVGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDG 170
             ++A  +     D  + +++L  +   +   ++ H + V    F     N L+S   DG
Sbjct: 517 DKIIATCSG----DKTIKIWSLDTFS--VIKTLEGHTNAVQKCSF-INKQNQLVSTGADG 569

Query: 171 YVNVYDLKQSE 181
            + ++D+   E
Sbjct: 570 LIKIWDISNGE 580

>ZYRO0G10406g Chr7 complement(839502..840677) [1176 bp, 391 aa] {ON}
           similar to uniprot|P53196 Saccharomyces cerevisiae
           YGL004C RPN14 Putative non-ATPase subunit of the 19S
           regulatory particle of the 26S proteasome localized to
           the cytoplasm
          Length = 391

 Score = 33.5 bits (75), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 37/70 (52%), Gaps = 11/70 (15%)

Query: 118 TELVGVDAVVSLFALGEWGRPLRAF----------VDSHHDDVTDVKFHPTDSNLLLSGS 167
           T +  VD   + FALG+    +R F           ++H D++T +KF P+   +LLSGS
Sbjct: 85  TCIDAVDQPTTQFALGDSDGNIRVFDSSPSLQHHIREAHLDEITCLKFFPS-GQVLLSGS 143

Query: 168 TDGYVNVYDL 177
           TD  + ++ L
Sbjct: 144 TDMRLKIWSL 153

>TDEL0C00940 Chr3 (150797..152719) [1923 bp, 640 aa] {ON} Anc_8.67
           YFL009W
          Length = 640

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 30/126 (23%), Positives = 55/126 (43%), Gaps = 14/126 (11%)

Query: 68  HDRGTVFATAADDGVKLFDIRT--RGCVATLTDANGAPALSLDSRHGMLAFGTELVGVDA 125
           H R    + + D  ++++D++        T+   + AP   +      L   T+LVG+  
Sbjct: 462 HKRFRCISASMDTTIRVWDLQNIWNNGTCTVVTTSQAPCTKISGSMSTLQGHTQLVGLLR 521

Query: 126 VVSLF--------ALGEWGRP--LRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVY 175
           +   F        +L  W      R F   HH++++ +       NLL+SGS +G  NVY
Sbjct: 522 LSDRFLVSAAADGSLRGWDSNDYSRKFA-YHHNNLSAITTFYMSDNLLVSGS-EGQFNVY 579

Query: 176 DLKQSE 181
           +L+  +
Sbjct: 580 NLRSGK 585

>KLTH0H03608g Chr8 (327747..327764,327941..330550) [2628 bp, 875 aa]
           {ON} similar to uniprot|P41811 Saccharomyces cerevisiae
           YGL137W SEC27 Involved in beta'-subunit of yeast
           coatomer
          Length = 875

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 29/57 (50%), Gaps = 2/57 (3%)

Query: 42  WATGKSVLDVAAHESSINGLQVLD--SAHDRGTVFATAADDGVKLFDIRTRGCVATL 96
           W+ G+   +   H     G+  +D     D+  +  ++ D  VK++D +T+ CVATL
Sbjct: 168 WSLGQPTANFTLHAHETRGVNYVDYYPLQDKPYLITSSDDRTVKIWDYQTKSCVATL 224

>NCAS0C04430 Chr3 complement(905927..909862) [3936 bp, 1311 aa] {ON}
           Anc_3.22 YOL138C
          Length = 1311

 Score = 33.5 bits (75), Expect = 1.0,   Method: Composition-based stats.
 Identities = 15/43 (34%), Positives = 23/43 (53%)

Query: 138 PLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQS 180
           PL   +  H   V    F+   SNL++SG  DG V ++DL+ +
Sbjct: 212 PLLTSLSEHTRSVNSFDFNMVQSNLIISGGQDGCVKIWDLRSN 254

>SAKL0G12892g Chr7 complement(1102157..1103587) [1431 bp, 476 aa]
           {ON} highly similar to uniprot|P33750 Saccharomyces
           cerevisiae YLL011W
          Length = 476

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 41/180 (22%), Positives = 78/180 (43%), Gaps = 17/180 (9%)

Query: 30  AALSNGHVHLVDWATGKSVLDVAAHESSINGL----QVLDSAHDRGTVFATAADDGVKLF 85
            A  +G V   + +T + +    AH   + GL    Q L    +   + +   D  +KL+
Sbjct: 85  TASGDGVVKYWNMSTREELCSFKAHYGLVTGLCVTPQHLSKNKNENYMLSCGDDKMIKLW 144

Query: 86  DIRTRGCVATLT--DANGAPALSLDSRHGMLAF--------GTELVGVDAVVSLFALGEW 135
            + +    +T    + N    L L + HG  AF         +  V   A + L+  G  
Sbjct: 145 SVNSDDFSSTRDNDELNTGDGL-LKTFHGEYAFQSIDHHRTKSTFVTGGAQIELWDTGR- 202

Query: 136 GRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEEDEALHQVINFASI 195
            +P+ + +    D+VT VKF+  ++++L S  +D  V +YDL+ +   + + Q +   +I
Sbjct: 203 SKPV-SNLSWGADNVTSVKFNQNETDILASTGSDNSVVLYDLRTNSPTQKIVQTMRTNAI 261

>CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly
           similar to uniprot|P33750 Saccharomyces cerevisiae
           YLL011w SOF1
          Length = 477

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 30/53 (56%), Gaps = 3/53 (5%)

Query: 148 DDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEEDEALHQVINFASIHSCGW 200
           D++  VKF+  D+N+L S  +D  + +YDL+    + A  +++    ++S  W
Sbjct: 217 DNINTVKFNQNDANVLGSAGSDNSIVLYDLRT---NSATQKIVQTMRVNSMCW 266

>TDEL0A05720 Chr1 complement(1008646..1011258) [2613 bp, 870 aa]
           {ON} Anc_8.626 YPL126W
          Length = 870

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 33/58 (56%), Gaps = 4/58 (6%)

Query: 45  GKSVLDVAAHESSIN-GLQVLDSAHDRGTVFATAADDGVKLFDIRTRGCVATLTDANG 101
           GK VL  +A++SS N G+  L   HD    +    ++ +K++ I+TR CV TL  AN 
Sbjct: 18  GKPVLPRSANKSSCNKGIACL--THDELN-YIVPFNNQIKVYSIKTRQCVKTLKFANN 72

>KAFR0H02260 Chr8 complement(430272..433088) [2817 bp, 938 aa] {ON}
           Anc_8.324 YLR129W
          Length = 938

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 55/118 (46%), Gaps = 19/118 (16%)

Query: 68  HDRGTVFATAADDGV-KLFDIRTRGCVATLTDANGA-PALSLDSRHGMLAFGT---ELVG 122
           H+   + A    DGV K++D+ ++  + T      A   L+ DS    L  G+   +++ 
Sbjct: 83  HEDTNLLAAGYSDGVIKVWDLISKTILLTFNGHKSAITILTFDSTGTRLISGSNDSDIIV 142

Query: 123 VDAV--VSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLK 178
            D V  V L+ L            SH D++T + +   D N L+S S DG + V+DLK
Sbjct: 143 WDLVSEVGLYKLR-----------SHKDNITGI-WCSDDENWLISTSKDGLIKVWDLK 188

>TBLA0G01490 Chr7 (389958..392156) [2199 bp, 732 aa] {ON} Anc_4.122
           YGL003C
          Length = 732

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 40/156 (25%), Positives = 70/156 (44%), Gaps = 28/156 (17%)

Query: 39  LVDW--------ATGKSVLDVAAHESSINGLQVLDSAH--------DRGTVFATAADDGV 82
           L+DW        A G+S+     + S I  + + D+ +        + G+  A    +G+
Sbjct: 434 LIDWSSTDMLAVALGQSIFLTDNNTSEI--IHLCDTKNEFTSLSWINTGSHIAIGQSNGI 491

Query: 83  -KLFDIRTRGCVATLTDANGAPA-LSLDSRHGMLAFGTELVGVDAVVSLFALGEWGRPLR 140
            +++D+  R C+ TL+      A LS +S   +L  G+     D  + L        P  
Sbjct: 492 IEIYDVTKRKCIRTLSGHTDRTACLSWNSH--ILTSGSR----DRTI-LHRDVRMKDPFF 544

Query: 141 AFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYD 176
             + SH  +V  +K++ +D N L+SG  D  VN+YD
Sbjct: 545 ERIKSHTQEVCGLKWNESD-NKLVSGGNDNTVNIYD 579

>ADL184W Chr4 (375530..376879) [1350 bp, 449 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL317W (PFS2)
          Length = 449

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 39/156 (25%), Positives = 67/156 (42%), Gaps = 21/156 (13%)

Query: 38  HLVDW-ATGKSVLDVAAHESSINGLQVLDSAHDRGT----------VFATAADDGV-KLF 85
           H  DW  +G +   +   + + N ++VLD AH               F T +DD V K++
Sbjct: 131 HAGDWLISGDADGTIKIWQPNFNMVKVLDRAHTECMRDISFSYSDQKFVTCSDDNVLKIW 190

Query: 86  DIRTRGCVATLTDANGAPALSLD--SRHGMLAFGTELVGVDAVVSLFALGEWGRPLRAFV 143
           +  + G    +   +     S D   + G++  G++    D ++ L+     GR +   +
Sbjct: 191 NF-SNGQQERVLSGHHWDVKSCDWHPKMGLIVSGSK----DNLIKLWD-PRTGRNVSTIL 244

Query: 144 DSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQ 179
              H  V   KF PT  NLL   S D  + +YD++Q
Sbjct: 245 GLKHT-VIKTKFQPTQGNLLAVVSKDKSIKIYDMRQ 279

>CAGL0K03377g Chr11 complement(307358..310294) [2937 bp, 978 aa]
           {ON} similar to uniprot|Q03177 Saccharomyces cerevisiae
           YMR102c
          Length = 978

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 2/41 (4%)

Query: 137 RPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDL 177
           R L++F   H D VT VKFHPTD    +SG  D    ++ +
Sbjct: 444 RSLKSF--QHPDFVTCVKFHPTDDRFFISGCLDQKCRLWSI 482

>KNAG0H01290 Chr8 (227947..229341) [1395 bp, 464 aa] {ON} Anc_3.259
           YDR030C
          Length = 464

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 62/141 (43%), Gaps = 23/141 (16%)

Query: 52  AAHESSINGLQVLDSAHDRGTVFATAADDGVKLFDIRTRGCVATLTDANGAPALSLDSRH 111
           +AH+  +  ++   S  D G  F+   D  VK++D  T  CV  L  A G     LD  +
Sbjct: 152 SAHQFRVTSVKWYGS--DNGMFFSGGNDRTVKIWDTNTFECVQDL--ALGYVVNQLDCTN 207

Query: 112 GML-----------AFGTELVGVDAVVSLFALG-EWGRPLRAFVDSHHDDVTDVKFHPTD 159
             L               +L  ++  V++F  G + G P++      H+ +T  K  P  
Sbjct: 208 NSLNSVLVASDDYYPRMIDLRNMNMGVTIFGKGSQRGVPMK------HEILT-CKMDPAR 260

Query: 160 SNLLLSGSTDGYVNVYDLKQS 180
             ++ SG + G V V+DL+Q+
Sbjct: 261 EYIVASGDSSGSVKVWDLRQT 281

>NCAS0B02200 Chr2 complement(359080..361548) [2469 bp, 822 aa] {ON}
           Anc_8.544
          Length = 822

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 58/120 (48%), Gaps = 14/120 (11%)

Query: 66  SAHDRGT-VFATAADDGVKLFDIRTRGCVATLTDANGAP----ALSLDSRHGMLAFGTEL 120
           S H  G  VF  ++D   +++DI T G    L   + AP    A+S D R   LA G+E 
Sbjct: 640 SFHPNGCYVFTGSSDKTCRMWDIST-GDSVRLFLGHTAPVLCTAVSPDGR--WLATGSE- 695

Query: 121 VGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQS 180
              D +++L+ +G   R     +  H  +      +  + N+L+SG  D  V V+DLK+S
Sbjct: 696 ---DGIINLWDIGTAKR--LKVMRGHGKNAIHSLSYCKEGNVLVSGGADHSVRVWDLKKS 750

>SAKL0F15972g Chr6 (1291625..1293037) [1413 bp, 470 aa] {ON} similar
           to uniprot|P20053 Saccharomyces cerevisiae YPR178W PRP4
           Splicing factor component of the U4/U6-U5 snRNP complex
          Length = 470

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 33/141 (23%), Positives = 60/141 (42%), Gaps = 10/141 (7%)

Query: 41  DWATGKSVLDVAAHESSINGLQVLDSAHDRGTVFATAADDGVKLFDIRTRGCVATLTDAN 100
           D  +GKS++ +  H   I GL    + +D  T    +AD  ++L+D+R  G +  L   N
Sbjct: 339 DLRSGKSIMALEGHIKPIYGLDWSPNGYDIAT---GSADGTIRLWDVRKVGILGALPAHN 395

Query: 101 G-APALSLDSRHGMLAFGTELVGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTD 159
                +  D  +G     +     D  +++++   W +   + +  H D +  V    TD
Sbjct: 396 SIVSEVKFDKANGHYLVSS---SYDKTLNIYSGDNWTKL--SVIQGHTDKILSVDI-STD 449

Query: 160 SNLLLSGSTDGYVNVYDLKQS 180
            + L S   D  +  + LK S
Sbjct: 450 GSHLFSSGWDRSLKQWSLKIS 470

>Smik_2.315 Chr2 (568572..569519) [948 bp, 315 aa] {ON} YBR175W
           (REAL)
          Length = 315

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 39/141 (27%), Positives = 64/141 (45%), Gaps = 23/141 (16%)

Query: 48  VLDVAAHESSINGLQVLDSAHDR----------GTVFATAADD-GVKLFDIRTRGCVATL 96
           V D+  H  S    Q L ++H R          G   ATA+DD  V++  + + G + T 
Sbjct: 38  VYDIKKHAIS----QTLVTSHARPFSELCWSPDGHCLATASDDFSVEIIHL-SYGLLHTF 92

Query: 97  TDANGAPALSLD-SRHGMLAFGTELVGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKF 155
              + AP +SL  +R G L F + +   D  + ++        L   + +H + V  V  
Sbjct: 93  V-GHTAPVISLTFNRKGNLLFTSSM---DESIKIW--DTLNGSLMKTISAHSEAVVSVDV 146

Query: 156 HPTDSNLLLSGSTDGYVNVYD 176
              DS++L SGS DG + ++D
Sbjct: 147 PLNDSSILSSGSYDGLIRIFD 167

>TBLA0B03570 Chr2 complement(828308..829684) [1377 bp, 458 aa] {ON}
           Anc_8.721 YOR272W
          Length = 458

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 28/137 (20%), Positives = 64/137 (46%), Gaps = 9/137 (6%)

Query: 62  QVLDSAHDRGTVFATAADDGVKLFDIRTRGCVATLTDANGAPALSLDSRHGMLAFGTELV 121
           QV+  + D+   ++ + D  +K +D+ T  CV T + +    +++   +  +LA G+   
Sbjct: 290 QVIFDSQDQTVGYSVSQDHAIKTWDLITSRCVDTKSTSYSLLSIAQLPKLNLLACGSSAR 349

Query: 122 GVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQ-- 179
            +   +    +    +  +  +  H + V  +   P +  +L SGS DG V V+D++   
Sbjct: 350 HI--TLHDPRVNSSSKITQQQLIGHKNFVVSLDTCPENDYMLCSGSHDGTVKVWDVRSTT 407

Query: 180 -----SEEDEALHQVIN 191
                + ED+++ + +N
Sbjct: 408 PMYTITREDKSVQKGVN 424

>TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.401
           YMR131C
          Length = 516

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 41/202 (20%), Positives = 83/202 (41%), Gaps = 16/202 (7%)

Query: 134 EWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEEDEALHQVINFA 193
           +W      F   ++  + D+++  T+S +  +   DGY+ ++D +  +    +  V++  
Sbjct: 314 KWVTDKTPFTVGNNKSIEDIQWSRTESTVFATAGCDGYIRIWDTRSKKHKPVISTVVSNT 373

Query: 194 SIHSCGWLSPKRIWSLSHME---TFAIHELNDKSEHANEPQPQLFGDVREPWACDYVVDV 250
            ++   W + K  + L+  +   T+ I +L   S ++ +  P    D  +        + 
Sbjct: 374 DVNVISW-NEKMGYLLASGDDKGTWGIWDLRQFSPNSEKALPVAQYDFHKGAITSISFNP 432

Query: 251 YPGFIAAGSTRENAGELRLLPLR--DECVDAANAIVL------PQ---AHGDEVVRDVLV 299
               I A ++ +N   L  L +   DE +    A +       PQ    H  + V+DV  
Sbjct: 433 LDESIVAVASEDNTVTLWDLSVEADDEEIKQQKAEIKELEQIPPQLLFVHWQKEVKDVKW 492

Query: 300 PASSPELLYSAGEDGNMAIWKS 321
               P  L S G DG + +WK+
Sbjct: 493 HKQIPGCLVSTGTDG-LNVWKT 513

>Ecym_4255 Chr4 (529455..532268) [2814 bp, 937 aa] {ON} similar to
           Ashbya gossypii AGL196C
          Length = 937

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 56/121 (46%), Gaps = 13/121 (10%)

Query: 64  LDSAHDRGTVFATAADDGVKLFDIRTRGCVATLTDANGAPA-LSLDSRHGMLAFGTELVG 122
           L+  H+   + A  AD  +K++D++T+  +        A   L  D     L  G+    
Sbjct: 82  LEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTAAITFLKFDPSGTRLISGSR--- 138

Query: 123 VDAVVSLFAL-GEWGR-PLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQS 180
            D+ + ++ L GE G   LR    SH D +T + F   D   L+S S DG + V+D+K  
Sbjct: 139 -DSNIIIWDLVGEVGLCKLR----SHKDSITGIWFENDD--WLISTSKDGLIKVWDIKSQ 191

Query: 181 E 181
           +
Sbjct: 192 Q 192

>Ecym_7038 Chr7 (80529..82931) [2403 bp, 800 aa] {ON} similar to
           Ashbya gossypii AEL246C
          Length = 800

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 60/123 (48%), Gaps = 12/123 (9%)

Query: 68  HDRGT-VFATAADDGVKLFDIRTRGCVATL---TDANGAPALSLDSRHGMLAFGTELVGV 123
           H  GT V   ++D   +++DI+T   V      T +  + A+S D R   L  G+E    
Sbjct: 620 HPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGR--WLTTGSE---- 673

Query: 124 DAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEED 183
           D V+ ++ +G  G+ ++         V  + F+  + N+L+SG  D  V V+DLK+   +
Sbjct: 674 DGVIIVWDIGT-GKRIKQMRGHGKSAVNSLSFN-KEGNILVSGGADQSVRVWDLKKFTNE 731

Query: 184 EAL 186
            AL
Sbjct: 732 PAL 734

>AGL190W Chr7 (341382..342494) [1113 bp, 370 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR142C (PEX7)
          Length = 370

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 22/32 (68%)

Query: 148 DDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQ 179
           D +   +F P D NL++S S + YV+++DL+Q
Sbjct: 177 DCIYQAQFSPHDPNLVMSCSGNSYVSLFDLRQ 208

>Ecym_6211 Chr6 complement(393887..395530) [1644 bp, 547 aa] {ON}
           similar to Ashbya gossypii AFR195W
          Length = 547

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 21/31 (67%)

Query: 150 VTDVKFHPTDSNLLLSGSTDGYVNVYDLKQS 180
           +T  +FHPT  NLL+  S+ G + + D++Q+
Sbjct: 326 ITSAEFHPTHCNLLMYSSSKGTIKLADMRQN 356

>Kpol_1036.65 s1036 complement(180839..181954) [1116 bp, 371 aa]
           {ON} complement(180839..181954) [1116 nt, 372 aa]
          Length = 371

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 12/51 (23%), Positives = 27/51 (52%)

Query: 140 RAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEEDEALHQVI 190
           R  + ++ + +   +F P D NL++  S + YV ++DL+Q   +    + +
Sbjct: 166 RGTISANKNCIYQAQFSPHDENLVMCCSGNSYVTLFDLRQPNSNNKQQRFL 216

>AFR195W Chr6 (792029..793393) [1365 bp, 454 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL190C (CDC55)
          Length = 454

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 21/31 (67%)

Query: 150 VTDVKFHPTDSNLLLSGSTDGYVNVYDLKQS 180
           +T  +FHPT  NLL+  S+ G + + D++Q+
Sbjct: 233 ITSAEFHPTHCNLLMYSSSKGTIKLADMRQN 263

>NDAI0J00330 Chr10 (54580..55998) [1419 bp, 472 aa] {ON} Anc_7.534
          Length = 472

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 52/113 (46%), Gaps = 8/113 (7%)

Query: 72  TVFATAADDGVKLFDIRTRGCVATLTDANGAPALSLD--SRHGMLAFGTELVGVDAVVSL 129
           +V  T A D VK+ + ++   +A+L   +      LD  + + ++  G E    DA+V L
Sbjct: 201 SVCGTWAGD-VKILEPKSLKTIASLPSVHDGKIGGLDWNTSYDLIVSGAE----DALVKL 255

Query: 130 FALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEE 182
               E      A +  H   V +VKFHP++   + S S D    ++D++   E
Sbjct: 256 HTYKEGRLETAAVLQGHEGRVVNVKFHPSN-KFIASASFDQTWRLWDVETGAE 307

>KAFR0F01060 Chr6 complement(201465..203126) [1662 bp, 553 aa] {ON}
           Anc_6.276 YPL247C
          Length = 553

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 34/142 (23%), Positives = 60/142 (42%), Gaps = 15/142 (10%)

Query: 51  VAAHESSINGLQVLDSAHDRGTVFATAADDG-VKLFDIRTRGCVATLTDANGAPALSLD- 108
           + AH+S +  ++ L  +     +FA+   DG V++FD+R+      + +    P  + D 
Sbjct: 320 LIAHDSEVYDVRFLTKSTQ---LFASCGGDGSVRVFDLRSLAHSTIIYEPPTNPVSNADL 376

Query: 109 SRHGMLAFGTELVGVDAVVSLFALGEWGRPL----------RAFVDSHHDDVTDVKFHPT 158
           S+        E    DA V    + E  + L             ++ H   +  +K+HPT
Sbjct: 377 SQQQNALLRLEPSPTDANVIATFVSESNKILILDMRNSESPVLVLEGHKSAINQIKWHPT 436

Query: 159 DSNLLLSGSTDGYVNVYDLKQS 180
              +LLS S D  V  +DL  +
Sbjct: 437 KRYILLSCSDDCQVLYWDLNST 458

>Ecym_6228 Chr6 (425765..427102) [1338 bp, 445 aa] {ON} similar to
           Ashbya gossypii AER337W
          Length = 445

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 29/137 (21%), Positives = 64/137 (46%), Gaps = 9/137 (6%)

Query: 62  QVLDSAHDRGTVFATAADDGVKLFDIRTRGCVATLTDANGAPALSLDSRHGMLAFGTELV 121
           Q +  ++D    ++ + D  +K +D+ T  CV T T +    ++       +LA G+   
Sbjct: 277 QAIFDSNDSTVGYSVSQDHMIKTWDLVTSRCVDTKTTSYSLLSIVEMPARRLLACGSSAR 336

Query: 122 GVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQ-- 179
            +  ++    +    + ++  +  H++ V  +   P +  +L SGS DG V V+D++   
Sbjct: 337 HI--ILHDPRMDSSSKIIQKQLIGHNNFVVSLDTCPENEYMLCSGSHDGTVRVWDVRSDA 394

Query: 180 -----SEEDEALHQVIN 191
                + ED+++ + IN
Sbjct: 395 PLYTITREDKSVQKGIN 411

>KAFR0A00690 Chr1 complement(124349..125875) [1527 bp, 508 aa] {ON}
           Anc_2.469 YMR093W
          Length = 508

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 28/113 (24%), Positives = 46/113 (40%), Gaps = 4/113 (3%)

Query: 74  FATAADDGVKLFDIRTRGCVATLTDANGAPALSLDSRHGMLAFGTELVGVDAVVSLFALG 133
           FA  +   V++F  +TR  V T +        +     G L    +  G+ +V    A  
Sbjct: 55  FAVTSSTRVQIFSSKTRQVVKTFSRFKDVVYSASFRNDGKLLVAGDATGLVSVYD--AYN 112

Query: 134 EWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEEDEAL 186
                L     +H   VT  KFHP D+  L++ S D    ++D+  + E + L
Sbjct: 113 PRSILLSINASTHPTHVT--KFHPQDNKTLVTTSDDRVTRIWDISHAYEAQEL 163

>ACR194C Chr3 complement(690186..691727) [1542 bp, 513 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL156W
          Length = 513

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 25/39 (64%)

Query: 149 DVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEEDEALH 187
           +V+ ++  PTDS+ +L+ S DG +   D++  + DE LH
Sbjct: 241 NVSKIEVFPTDSSKILAASYDGALRSIDMQSLKSDELLH 279

>KLTH0A00880g Chr1 complement(90125..91540) [1416 bp, 471 aa] {ON}
           similar to uniprot|P20053 Saccharomyces cerevisiae
           YPR178W PRP4 Splicing factor component of the U4/U6-U5
           snRNP complex
          Length = 471

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 34/152 (22%), Positives = 71/152 (46%), Gaps = 20/152 (13%)

Query: 71  GTVFATAADDGV-KLFDIRTRGCVATLTDANGAP--ALSLDSRHGMLAFGTELVGVDAVV 127
           G++  +A  D + +++D+R+ G    + + +  P   +S       +A G+     D  V
Sbjct: 322 GSLLCSAGLDSIGRIWDMRS-GQSLMILEGHAKPIYGVSWSPNGHHVATGS----ADGTV 376

Query: 128 SLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVY---------DLK 178
            ++ + + G P      +H++ V+DVKF       L+S S D  V+V+          LK
Sbjct: 377 KVWDIRKVGNPFSIL--AHNNIVSDVKFDKVSGRTLVSSSYDKTVSVFASDSWLRLASLK 434

Query: 179 -QSEEDEALHQVINFASIHSCGWLSPKRIWSL 209
             +++  ++    +F+ ++S GW    ++W L
Sbjct: 435 GHTDKVMSIDISHDFSHLYSSGWDRSVKLWKL 466

>KLTH0D15840g Chr4 (1305121..1305125,1305195..1307283) [2094 bp, 697
           aa] {ON} similar to uniprot|Q06440 Saccharomyces
           cerevisiae YLR429W CRN1 Coronin cortical actin
           cytoskeletal component that associates with the
           Arp2p/Arp3p complex to regulate its activity
          Length = 697

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 24/43 (55%)

Query: 140 RAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEE 182
           + F+  H   V  V FHPT  N+L S S D  V ++D++  +E
Sbjct: 133 KKFLTGHGRKVGHVLFHPTARNVLASSSLDHTVRIWDVESGKE 175

 Score = 32.0 bits (71), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 34/70 (48%), Gaps = 4/70 (5%)

Query: 122 GVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSE 181
           G  AV+ L  +G+    +  F   H   V D  F P + N++ SGS DG + ++++    
Sbjct: 57  GAFAVIPLNEVGKAPDQVPLFR-GHTAHVLDTDFDPFNDNIIASGSDDGKIGIWEIP--- 112

Query: 182 EDEALHQVIN 191
           ED + H   N
Sbjct: 113 EDYSFHHYTN 122

>NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {ON}
           Anc_6.276
          Length = 494

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 34/140 (24%), Positives = 61/140 (43%), Gaps = 16/140 (11%)

Query: 51  VAAHESSINGLQVLDSAHDRGTVFATAADDG-VKLFDIRTRGCVATL---------TDAN 100
           + AH+S +  ++ L  +     +FA+   DG V++FD+R+      +          D +
Sbjct: 272 LIAHDSEVYDVRFLTQS---TQLFASCGGDGSVRVFDLRSLAHSTIIYEPPVSDLNPDTS 328

Query: 101 GAPALSLD-SRHGMLAFGTELVGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTD 159
               L L+ S H      T     + ++ +  +     PL   ++ H   V  +K+HP  
Sbjct: 329 QFALLRLEPSPHDPNVMATFAADSNKIL-ILDMRNPESPL-MILEGHSASVNQIKWHPIK 386

Query: 160 SNLLLSGSTDGYVNVYDLKQ 179
            N+LLSG  D  V  +DL +
Sbjct: 387 RNVLLSGGDDCQVLYWDLNK 406

>KLTH0E15576g Chr5 complement(1384027..1386198) [2172 bp, 723 aa]
           {ON} similar to uniprot|P47025 Saccharomyces cerevisiae
           YJL112W MDV1 WD repeat protein that regulates steps in
           the Dnm1p-dependent process of mitochondrial fission
          Length = 723

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 37/155 (23%), Positives = 62/155 (40%), Gaps = 17/155 (10%)

Query: 24  YQAGVLAALSNGHVHLVDWATGKSVLDVAAHESSINGLQVLDSAHDRGTVFATAADDGVK 83
           Y A +     +G V L D   G+ V  +  H  ++ GLQ      D   +   + D  ++
Sbjct: 581 YDAAMATGTKDGIVRLWDLRMGQVVRTLEGHTDAVTGLQF-----DAVNLVTGSLDRSIR 635

Query: 84  LFDIRTRGCVATLTDANGAPALSLDSRHGMLAFGTELVGV---DAVVSLFALGEWGRPLR 140
           ++D+RT     TL D     A + DS    L F  + + V   +++V ++   E      
Sbjct: 636 IWDLRT----GTLAD-----AFAYDSPVSSLQFDLDKIVVANNESMVRVYNRKEEAHWTC 686

Query: 141 AFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVY 175
              D+       V F    +  L+ G T G VN +
Sbjct: 687 GEADAEASGTDVVDFVRYKNGYLVEGRTTGDVNTW 721

>YGR145W Chr7 (781767..783890) [2124 bp, 707 aa] {ON}  ENP2Essential
           nucleolar protein, required for biogenesis of the small
           ribosomal subunit; contains WD repeats, interacts with
           Mpp10p and Bfr2p, and has homology to Spb1p
          Length = 707

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 43/88 (48%), Gaps = 9/88 (10%)

Query: 98  DANGAPALSLDSRHGMLAFGTELVGVDAVVSLFALGEWGRPLRAFVDSHHDD----VTDV 153
           D  G   +S++  +G+LA GTE      VV  +      R  + +++++ D+    VT  
Sbjct: 179 DTEGVNHVSINEVNGLLAAGTET----NVVEFWDPRSRSRVSKLYLENNIDNRPFQVTTT 234

Query: 154 KFHPTDSNLLLSGSTDGYVNVYDLKQSE 181
            F   D      G+++GY  +YDL+ SE
Sbjct: 235 SFR-NDGLTFACGTSNGYSYIYDLRTSE 261

>CAGL0M05291g Chr13 complement(566250..567509) [1260 bp, 419 aa]
           {ON} similar to uniprot|P13712 Saccharomyces cerevisiae
           YBR195c MSI1
          Length = 419

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 33/55 (60%), Gaps = 1/55 (1%)

Query: 146 HHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEEDEALHQVINFASIHSCGW 200
           H D +   KF+P +S L+ S  T G +N++D+++ ++ E +  + + +SI +  W
Sbjct: 291 HEDGINTCKFNPGNSLLVASADTCGRINLWDIRKLDQ-EPISTMQHGSSISTIEW 344

>TPHA0F00520 Chr6 (121962..124103) [2142 bp, 713 aa] {ON} Anc_4.77
           YGR145W
          Length = 713

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 52/118 (44%), Gaps = 17/118 (14%)

Query: 94  ATLTDANGAPALSLDSRHGMLAFGTELVGVDAVVSLFALGEWGRPLRAFVDSHHDD---- 149
           AT     G   +S++S +G++A G E    D+VV  +      R  + ++++  D+    
Sbjct: 185 ATAVGGGGVNHVSINSANGLVAVGLE----DSVVEFWDPRARSRVSKLYLENTIDNSDFT 240

Query: 150 VTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEEDEALHQVINFASIHSCGWLSPKRIW 207
           VT   F     N    G+++GY  +YDL+ SE         +    H  G+   K IW
Sbjct: 241 VTTTSFRNDGINFAC-GTSNGYSYLYDLRASEP--------SIVKDHGYGFEIKKLIW 289

>Suva_4.449 Chr4 complement(780822..782096) [1275 bp, 424 aa] {ON}
           YBR195C (REAL)
          Length = 424

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 33/138 (23%), Positives = 65/138 (47%), Gaps = 15/138 (10%)

Query: 73  VFATAADDGVKLFDIRTRG---------CVATLTDANGAPALSLDSRH-GMLAFGTELVG 122
           + ++ ++  V+++DI+             V+  +DA+G   ++    H  + A  TE   
Sbjct: 216 LLSSHSNGQVQIWDIKQYSHENPLIDSPLVSIESDASGVNDVTWMPTHDSLFAACTE--- 272

Query: 123 VDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEE 182
              VVSL  L      LR+   +H   V   KF+  +S +L S  ++G +N++D+++  E
Sbjct: 273 -GNVVSLLDLRTKKEKLRSNRQNHTGGVNSCKFNYRNSLVLASADSNGRLNLWDIRKMNE 331

Query: 183 DEALHQVINFASIHSCGW 200
              +  + + ASI +  W
Sbjct: 332 -SPITTMEHGASISTLEW 348

>Kwal_47.17465 s47 (415977..418379) [2403 bp, 800 aa] {ON} YBL008W
           (HIR1) - putative repressor protein homologous to yeast
           Tup1p and mammalian retinal transducin; contains nuclear
           targeting signal [contig 207] FULL
          Length = 800

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 54/115 (46%), Gaps = 9/115 (7%)

Query: 122 GVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSE 181
           G D  + +++ G+  RP+    D     +TD+ ++P + +LL   S DG +  +   + E
Sbjct: 295 GQDKTLVVWSTGK-ARPIFVAYDIASKSITDMVWNP-NGDLLFLTSLDGSIITFHFGEKE 352

Query: 182 EDEALHQVINFASIHSCG-----WLSPKRIWSLSHMETFAIHELNDKSEHANEPQ 231
             EA+    N   +H  G     +  P+ +  L  +E  A H+L D+S    +PQ
Sbjct: 353 LGEAIPLERNVEQLHRYGVDKDSFDFPESVKQL-QLEDEA-HKLQDESRKVTKPQ 405

>Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR195C
           (MSI1) - p50 subunit of the yeast Chromatin Assembly
           Factor-I (CAF-I) negative regulator of ras-mediated cAMP
           induction; homologous to beta subunit of GTP-binding
           proteins [contig 24] FULL
          Length = 418

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 43/87 (49%), Gaps = 6/87 (6%)

Query: 99  ANGAPALSLDSRHGMLAFGTELVGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPT 158
           +NG  A   +    +L    +  G    ++L+ + ++  P+R+    HH  V+ ++++P 
Sbjct: 290 SNGVNACQFNYYKDLLLCSADSAGR---INLWDIRDFSSPIRSL--DHHGSVSALQWNPH 344

Query: 159 DSNLLLS-GSTDGYVNVYDLKQSEEDE 184
              +L + G  DG V ++DL Q  + E
Sbjct: 345 HPTILATAGQDDGLVKIWDLSQPVDQE 371

>KAFR0E03180 Chr5 (637055..639499) [2445 bp, 814 aa] {ON} Anc_8.544
           YBR198C
          Length = 814

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 58/120 (48%), Gaps = 14/120 (11%)

Query: 66  SAHDRGT-VFATAADDGVKLFDIRTRGCVATLTDANGAPALSL----DSRHGMLAFGTEL 120
           S H  G  VF  +AD   +++DI T G    L   + AP L+     D R   L  G   
Sbjct: 632 SFHPNGCYVFTGSADKTCRMWDIST-GDSVRLFLGHTAPVLTTAVTPDGR--WLCTG--- 685

Query: 121 VGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQS 180
            G D V++++ +G  G+ L+       + +    F+  + N+L+SG  D  V V+DLK++
Sbjct: 686 -GEDGVINVWDIGT-GKRLKQMRGHGKNAIHSFSFN-KEGNILISGGADHSVRVWDLKKA 742

>TPHA0G02940 Chr7 (631081..633837) [2757 bp, 918 aa] {ON} Anc_2.450
           YMR102C
          Length = 918

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 39/74 (52%), Gaps = 8/74 (10%)

Query: 105 LSLD-SRHGMLAFGTELVGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLL 163
           L LD S++G L   +    +D  V L+ + E  + LR ++  H D VT +KF PTD   +
Sbjct: 294 LDLDWSKNGFLVSAS----MDKSVKLWNI-EKKQSLRTYL--HPDFVTSIKFLPTDDRFI 346

Query: 164 LSGSTDGYVNVYDL 177
           +SG  D    V+ +
Sbjct: 347 ISGCLDHKCRVWSI 360

>ZYRO0D08558g Chr4 (736975..739713) [2739 bp, 912 aa] {ON} highly
           similar to uniprot|P25636 Saccharomyces cerevisiae
           YCR057C PWP2 part of small (ribosomal) subunit (SSU)
           processosome (contains U3 snoRNA) Eight WD-repeats with
           homology with G protein beta subunits flanked by
           nonhomologous N-terminal and C-terminal extensions
           regulatory protein
          Length = 912

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 48/91 (52%), Gaps = 8/91 (8%)

Query: 2   SYILQQKVSFGADNWCLRLRPLYQAGVLAALSNGHVHLVDWATGKSVLDVAAHESSINGL 61
           SY+L+Q+  F + N  L   P   + V+ A  +G + + D  +G  ++ +  H SS+ G+
Sbjct: 328 SYVLKQQGHFDSMN-SLTYSP-DGSRVVTASDDGKIKVWDVVSGFCIVTLEGHTSSVTGI 385

Query: 62  QVLDSAHDRGTVFATAADDG-VKLFD-IRTR 90
           Q       RG V  T++ DG V+ +D IR R
Sbjct: 386 QF----AKRGQVLFTSSLDGTVRAWDLIRYR 412

>Kwal_56.24399 s56 (981153..982262) [1110 bp, 369 aa] {ON} [contig
           163] FULL
          Length = 369

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 37/62 (59%), Gaps = 6/62 (9%)

Query: 33  SNGHVHLVDWATGKSVLDVAAHESSINGLQVLDSAHDRGTVFATAADDG-VKLFDIRTRG 91
           S+  + LVD  TG+ + + A H   +N ++ L++  DR   FA+ +DDG +K++D  T+ 
Sbjct: 139 SDTRLALVDLHTGRKLRNFAGHTRVVNQVRALNT--DR---FASVSDDGALKIWDAHTKS 193

Query: 92  CV 93
            V
Sbjct: 194 PV 195

>TPHA0G01840 Chr7 complement(379782..381077) [1296 bp, 431 aa] {ON}
           Anc_8.631 YOR212W
          Length = 431

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 22/32 (68%), Gaps = 1/32 (3%)

Query: 147 HDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLK 178
           + DV  VKF+  D N ++SGS DG + +YDL+
Sbjct: 277 NSDVNTVKFY-NDGNAIVSGSDDGIIRLYDLR 307

>Suva_4.427 Chr4 (751909..752856) [948 bp, 315 aa] {ON} YBR175W
           (REAL)
          Length = 315

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 53/108 (49%), Gaps = 9/108 (8%)

Query: 71  GTVFATAADD-GVKLFDIRTRGCVATLTDANGAPALSLD-SRHGMLAFGTELVGVDAVVS 128
           G   ATA+DD  V++  + + G + T    + AP +SL  +R G L F + +   D  + 
Sbjct: 67  GQCIATASDDFSVEIVHL-SYGLLHTFV-GHTAPVISLAFNRKGNLLFTSSM---DESIK 121

Query: 129 LFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYD 176
           ++        L   + +H + V  V     DS++L SGS DG + ++D
Sbjct: 122 IW--DTLNGSLMKTISAHSEAVVSVDVPTNDSSILSSGSYDGLIRIFD 167

>YBR175W Chr2 (582408..583355) [948 bp, 315 aa] {ON}  SWD3Essential
           subunit of the COMPASS (Set1C) complex, which methylates
           histone H3 on lysine 4 and is required in
           transcriptional silencing near telomeres; WD40 beta
           propeller superfamily member and ortholog of mammalian
           WDR5
          Length = 315

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 53/108 (49%), Gaps = 9/108 (8%)

Query: 71  GTVFATAADD-GVKLFDIRTRGCVATLTDANGAPALSLD-SRHGMLAFGTELVGVDAVVS 128
           G   ATA+DD  V++  + + G + T    + AP +SL  +R G L F + +   D  + 
Sbjct: 67  GQCIATASDDFSVEIIHL-SYGLLHTFI-GHTAPVISLTFNRKGNLLFTSSM---DESIK 121

Query: 129 LFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYD 176
           ++        L   + +H + V  V     DS++L SGS DG + ++D
Sbjct: 122 IW--DTLNGSLMKTISAHSEAVVSVDVPMNDSSILSSGSYDGLIRIFD 167

>KAFR0A00700 Chr1 (126326..128149) [1824 bp, 607 aa] {ON} Anc_2.470
           YMR092C
          Length = 607

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 34/149 (22%), Positives = 70/149 (46%), Gaps = 15/149 (10%)

Query: 28  VLAALSNGHVHLVDWATGKSVLDVAAHESSINGLQVLDSAHDRGTVFATAADDGVKLFDI 87
           V++  S+  +   D  TG+ +  V   E  ING     S  D       +AD  ++++D+
Sbjct: 217 VVSVGSDRRIVCYDGKTGEFIKYVEDSEEKINGGIFAISWLDEAKFATASADACIRIWDV 276

Query: 88  RTRGCVATLTDANGAPALSLDSRH-GMLAF---GTELVGVDAVVSLFALGEWGRPLRAFV 143
           +   CV   +     P  SL+++  G++A    G   + +D  ++++ +G+    +R  +
Sbjct: 277 KGSKCVQKWS----LPEASLENQLVGIVATKNNGVISLSLDGSLNMYEIGK-NDCIRT-I 330

Query: 144 DSHHDDVTDVKFHPTDSNLLLSGSTDGYV 172
             H+  +T +  +P     L++GS DG +
Sbjct: 331 RGHNKGITALAVNP-----LITGSYDGRI 354

>Smik_12.279 Chr12 complement(526367..528820) [2454 bp, 817 aa] {ON}
           YLR222C (REAL)
          Length = 817

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 50/99 (50%), Gaps = 9/99 (9%)

Query: 82  VKLFDIRTRGCVATLTDANGAPALSLDSRHGMLAFGTELVGVDAVVSLFALGEWGRPLRA 141
           +K+F ++T   V ++  ++ +  L  DS   +LA G    G D  + +  + E G    +
Sbjct: 85  LKIFHLKTGKVVRSMKISSPSYILDADSTSTLLAVG----GTDGSIIVVDI-ENGYITHS 139

Query: 142 FVDSHHDDVTDVKFH-PTDSN--LLLSGSTDGYVNVYDL 177
           F   H   ++ +KF+   DS   LL SG T+G V V+DL
Sbjct: 140 F-KGHGGTISSLKFYGQLDSKIWLLASGDTNGMVKVWDL 177

>Ecym_7403 Chr7 (829923..831476) [1554 bp, 517 aa] {ON} similar to
           Ashbya gossypii ABL044C
          Length = 517

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 45/105 (42%), Gaps = 6/105 (5%)

Query: 74  FATAADDGVKLFDIRTRGCVATLTDANGAPALSLDSRHGMLAFGTELVGVDAVVSLFALG 133
           FA  +   V++F  RTR  + T +        +   + G L    +  G+   VS++   
Sbjct: 55  FAVTSSTRVQVFSSRTRQVIKTFSRFKDVVYSASFRQDGKLLVAGDATGL---VSIYDSY 111

Query: 134 EWGRPLRAF-VDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDL 177
                L  F   SH   VT  KFHP DS  L + + D  V ++D+
Sbjct: 112 NPRNQLVTFQASSHPTHVT--KFHPMDSKSLTTANDDRVVRLWDI 154

>KAFR0F03630 Chr6 complement(718854..720935) [2082 bp, 693 aa] {ON}
           Anc_4.77 YGR145W
          Length = 693

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 43/88 (48%), Gaps = 9/88 (10%)

Query: 98  DANGAPALSLDSRHGMLAFGTELVGVDAVVSLFALGEWGRPLRAFVDSHHD----DVTDV 153
           D  G   +S+++ +G+++   E    D+VV  +      R  + ++++H D     VT  
Sbjct: 179 DTEGVNHVSMNAVNGLVSVAVE----DSVVEFWDPRARSRVAKLYLENHFDSNPFQVTTT 234

Query: 154 KFHPTDSNLLLSGSTDGYVNVYDLKQSE 181
            F     N    G+++GY  +YDL+ SE
Sbjct: 235 SFRSDGLNFAC-GTSNGYSYLYDLRTSE 261

>NDAI0G02580 Chr7 complement(590030..592906) [2877 bp, 958 aa] {ON}
           Anc_8.324 YLR129W
          Length = 958

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 56/113 (49%), Gaps = 14/113 (12%)

Query: 76  TAADDGVKLFDIRTRGCVATLTDANGAPALSLDSRHGMLAFGTEL----------VGV-D 124
           T+A + + ++DI+T    + L D+   P  S+D++    A  T L          VG  D
Sbjct: 41  TSALENINIWDIKTGELSSHLIDSLIPPPGSIDAKSTKPAETTYLQHHKDTNLLAVGYND 100

Query: 125 AVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDL 177
            V+ ++ L  + + +   ++ H   +T +KF  T +  L+SGS D  + V+DL
Sbjct: 101 GVIKVWDL--YSKTVLCNLNGHSSAITVLKFDSTGTR-LISGSRDSNIIVWDL 150

>YBR198C Chr2 complement(616127..618523) [2397 bp, 798 aa] {ON}
           TAF5Subunit (90 kDa) of TFIID and SAGA complexes,
           involved in RNA polymerase II transcription initiation
           and in chromatin modification
          Length = 798

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 61/120 (50%), Gaps = 14/120 (11%)

Query: 66  SAHDRGT-VFATAADDGVKLFDIRTRGCVATLTDANGAPALSL----DSRHGMLAFGTEL 120
           S H  G  VF  ++D   +++D+ T G    L   + AP +S+    D R   L+ G+E 
Sbjct: 616 SFHPNGCYVFTGSSDKTCRMWDVST-GDSVRLFLGHTAPVISIAVCPDGR--WLSTGSE- 671

Query: 121 VGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQS 180
              D +++++ +G  G+ L+       + +  + +   + N+L+SG  D  V V+DLK++
Sbjct: 672 ---DGIINVWDIGT-GKRLKQMRGHGKNAIYSLSYS-KEGNVLISGGADHTVRVWDLKKA 726

>CAGL0M05335g Chr13 complement(569132..571552) [2421 bp, 806 aa]
           {ON} similar to uniprot|P38129 Saccharomyces cerevisiae
           YBR198c Transcription initiation factor TFIID 90
          Length = 806

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 57/117 (48%), Gaps = 13/117 (11%)

Query: 73  VFATAADDGVKLFDIRTRGCVATLTDANGAPALSL----DSRHGMLAFGTELVGVDAVVS 128
           VF  ++D   +++D+ T G    L   + AP LS     D R   LA G+E    D V+ 
Sbjct: 632 VFTGSSDKTCRMWDVST-GDSVRLFLGHTAPVLSTQVSPDGR--WLATGSE----DGVIC 684

Query: 129 LFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEEDEA 185
           L+ +G  G+ ++       + V  + F+  + N+L+SG  D  V V+D+K    ++ 
Sbjct: 685 LWDIGT-GKRIKQMRGHGKNAVHSLSFN-KEGNVLISGGADHSVRVWDVKHGTTEQG 739

>Kpol_1038.20 s1038 complement(43719..47660) [3942 bp, 1313 aa] {ON}
           complement(43719..47660) [3942 nt, 1314 aa]
          Length = 1313

 Score = 32.3 bits (72), Expect = 2.8,   Method: Composition-based stats.
 Identities = 14/43 (32%), Positives = 23/43 (53%)

Query: 138 PLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQS 180
           PL      H   V    F+ T ++LL+SG  DG + ++DL+ +
Sbjct: 222 PLVTSFSEHSRAVNSFDFNMTQTSLLISGGQDGQIKIWDLRSN 264

>Kpol_513.12 s513 complement(32164..36762) [4599 bp, 1532 aa] {ON}
            complement(32164..36762) [4599 nt, 1533 aa]
          Length = 1532

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 31/53 (58%), Gaps = 11/53 (20%)

Query: 124  DAVVSLFALGEWGRPLRAFVDSHHDDVTDVKF-HPTDSNLLLSGSTDGYVNVY 175
            D+V+S F+ G          +     VT +KF +  DS+LL++GS+DG VN+Y
Sbjct: 1215 DSVISRFSNG----------NPFGTKVTSLKFINEDDSSLLMTGSSDGIVNIY 1257

>KLLA0A09471g Chr1 complement(827264..831784) [4521 bp, 1506 aa] {ON}
            some similarities with uniprot|P38873 Saccharomyces
            cerevisiae YHR186C KOG1 Subunit of TORC1 a rapamycin-
            sensitive complex involved in growth control that
            contains Tor1p or Tor2p Lst8p and Tco89p contains four
            HEAT repeats and seven WD-40 repeats may act as a
            scaffold protein to couple TOR and its effectors
          Length = 1506

 Score = 32.3 bits (72), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 17/35 (48%), Positives = 24/35 (68%), Gaps = 1/35 (2%)

Query: 150  VTDVKF-HPTDSNLLLSGSTDGYVNVYDLKQSEED 183
            +TD+KF +  D+ LLL+GS+DG VN+Y      ED
Sbjct: 1212 ITDMKFLNDDDTPLLLAGSSDGIVNIYKDFHDTED 1246

>NCAS0A10500 Chr1 complement(2087347..2088783) [1437 bp, 478 aa]
           {ON} Anc_3.259 YDR030C
          Length = 478

 Score = 32.0 bits (71), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query: 144 DSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQ--SEEDEALHQVIN 191
           +SHH  +T +K++  D+ +  +GS D  + ++D  Q  S +D     +IN
Sbjct: 170 ESHHGGITTMKWYGEDNGMFFTGSNDKIIKIWDTNQFKSVQDLEFEYMIN 219

>KLTH0H12122g Chr8 (1034092..1035003) [912 bp, 303 aa] {ON} highly
           similar to uniprot|P41318 Saccharomyces cerevisiae
           YNL006W LST8 Protein required for the transport of amino
           acid permease Gap1p from the Golgi to the cell surface
           component of the TOR signaling pathway associates with
           both Tor1p and Tor2p contains a WD-repeat
          Length = 303

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 37/151 (24%), Positives = 58/151 (38%), Gaps = 22/151 (14%)

Query: 44  TGKSVLDVAAHESSINGLQVLDSAHDRGTVFATAADDGVKLFDIRTRGCVATLTDANGAP 103
           TG     +   +S +N L++           A A    V+L+DIRT          N  P
Sbjct: 21  TGVCSRTIQHSDSQVNRLEITSDKR----FLAAAGHLNVRLYDIRT---------TNPNP 67

Query: 104 ALSLDSRHG---MLAFGTELVGVDAVVSLFALGEWG--RPLRAFVDSHHDDVTDVKFHPT 158
             S +   G    +AF  E   + +      +  W    P       HH  V +V  HP 
Sbjct: 68  VTSFEGHRGNVTSIAFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHHAAVNEVVIHPN 127

Query: 159 DSNLLLSGSTDGYVNVYDLKQSEEDEALHQV 189
               L+S   DG + ++DL    E++ +HQ+
Sbjct: 128 QGE-LISCDQDGNIKIWDLG---ENQCVHQL 154

>Suva_15.389 Chr15 complement(680068..684735) [4668 bp, 1555 aa] {ON}
            YHR186C (REAL)
          Length = 1555

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 37/65 (56%), Gaps = 6/65 (9%)

Query: 116  FGTELVGVD--AVVSLFALGEWGRPLRAFVDS--HHDDVTDVKF-HPTDSNLLLSGSTDG 170
            F  +LV  D  + +++F   E G+ L  F +       VTD+KF +  DS LLL+GS+DG
Sbjct: 1218 FEDQLVTADDRSTITVFD-WEKGKTLSKFSNGTPFGTKVTDLKFINEDDSALLLAGSSDG 1276

Query: 171  YVNVY 175
             + +Y
Sbjct: 1277 VIKIY 1281

>Kwal_23.5035 s23 (975572..977806) [2235 bp, 744 aa] {ON} YFL009W
           (CDC4) - 1:1 [contig 7] FULL
          Length = 744

 Score = 32.0 bits (71), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 31/126 (24%), Positives = 52/126 (41%), Gaps = 14/126 (11%)

Query: 68  HDRGTVFATAADDGVK---LFDIRTRGCVATLTDANGAPALSLDSRHGMLAFGTELVGVD 124
           + R    +   D  VK   L D+   G   T+T +N  P   +      L   T LVG+ 
Sbjct: 565 YQRNRCISAGMDSTVKVWDLADVSKNGPCTTITSSNN-PCTKVTGSSITLQGHTALVGLL 623

Query: 125 AVVSLFALGEWGRPLRAFVDS---------HHDDVTDVKFHPTDSNLLLSGSTDGYVNVY 175
            +   F +      +    DS         HH D++ +     + N+L+SGS +G  N+Y
Sbjct: 624 GLSDKFLVSAGADGILRGWDSENYTRQFAYHHKDLSAITTFYVNDNILVSGS-EGNFNIY 682

Query: 176 DLKQSE 181
           +L+  +
Sbjct: 683 NLRSGK 688

>KNAG0F00620 Chr6 (105380..106768) [1389 bp, 462 aa] {ON} Anc_1.107
           YNL253W
          Length = 462

 Score = 32.0 bits (71), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 127 VSLFALGEWGR-PLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYD 176
           + LF +   G+  LR   + H + VT +KF P     L+SGS+DG   ++D
Sbjct: 232 IVLFQIDALGQVSLRLNTNGHRNSVTSLKFDPL-GRYLISGSSDGTFTIWD 281

>CAGL0C03608g Chr3 (360681..362612) [1932 bp, 643 aa] {ON} similar
           to uniprot|P16649 Saccharomyces cerevisiae YCR084c TUP1
           general transcription repressor
          Length = 643

 Score = 32.0 bits (71), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 52/124 (41%), Gaps = 22/124 (17%)

Query: 69  DRGTVFATAADDGVKLFDIRTRGCVATLTD--------ANGAPALSLDSRH-------GM 113
           + G   AT  +   K+F++ T   V  L D        AN A +  L  R          
Sbjct: 328 NNGEYLATGCNKTTKIFEVATGNLVTELVDDTKTGTEDANSASSADLYIRSVCFSPDGKF 387

Query: 114 LAFGTELVGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVN 173
           LA G E    D ++ ++ + +  R +   +  H  D+  + +  +  N L+SGS D  + 
Sbjct: 388 LATGAE----DKLIRIWDIAQ--RKIVMVLRGHEQDIYSLDYFQS-GNKLVSGSGDRTIR 440

Query: 174 VYDL 177
           ++DL
Sbjct: 441 IWDL 444

>Smik_10.126 Chr10 (196821..198959) [2139 bp, 712 aa] {ON} YJL112W
           (REAL)
          Length = 712

 Score = 32.0 bits (71), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 66/154 (42%), Gaps = 37/154 (24%)

Query: 48  VLDVAAHESSINGLQVLDSAHDRGTVFATAADDGVKLFDIRTRGCVAT------------ 95
           V    AH   +  L +     D   + + + D  ++ +D+R+  C+ T            
Sbjct: 493 VYTFEAHTDEVTALSL-----DPSFLVSGSQDRTIRQWDLRSGKCMQTIDLSFANVLTAA 547

Query: 96  ----------LTDANGAPAL-SLDSRHGMLAFGTELVGVDAVVSLFALGEWGRPLRAFVD 144
                     LT  +  P++ +L S    LA GT+    D +V L+ L   G+ +R  + 
Sbjct: 548 TNVDLSKSTLLTQRSERPSIGALQSFDAALATGTK----DGIVRLWDLRS-GKVIRT-LK 601

Query: 145 SHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLK 178
            H D +T +KF    S  L++GS D  V V+DL+
Sbjct: 602 GHTDAITSLKF---GSECLVTGSYDRTVRVWDLR 632

>TBLA0C01840 Chr3 (435021..436292) [1272 bp, 423 aa] {ON} Anc_8.672
           YPL151C
          Length = 423

 Score = 32.0 bits (71), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 38/153 (24%), Positives = 69/153 (45%), Gaps = 25/153 (16%)

Query: 31  ALSNGHVHLV-----------DWATGKSVLDVAAHESSINGLQVLDSAHDRGTVFATAAD 79
           A+SN H +L            D     ++ D   H S ++ + +    H    + ATA  
Sbjct: 161 AISNRHPYLFSASEDKLAKCWDLEKNTAIRDYHGHLSGVHTVDI----HPTLDLIATAGR 216

Query: 80  DGV-KLFDIRTRGCVATLTDANGAPALSLDSRHGMLAFGTELV--GVDAVVSLFALGEWG 136
           D V KL+DIR+R  V TL   + +P   ++  H  L    +++   VDA + L+ +   G
Sbjct: 217 DSVVKLWDIRSRVPVVTLI-GHKSP---INKVH-CLPVNPQVISSSVDATIRLWDIVA-G 270

Query: 137 RPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTD 169
           +  +     H   + D+ FHP++ ++  + + D
Sbjct: 271 KASKVLT-HHKRSIRDIAFHPSEFSMATACTDD 302

>NCAS0B02170 Chr2 complement(354274..355518) [1245 bp, 414 aa] {ON}
           Anc_8.548
          Length = 414

 Score = 31.6 bits (70), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 41/79 (51%), Gaps = 1/79 (1%)

Query: 122 GVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSE 181
           G   ++ LF        LR+    H+  +   KF+    +LL+SG ++G +N++DL++  
Sbjct: 263 GESNIIGLFDNRLGTEILRSNEKMHNGGINSCKFNSHCDSLLISGDSEGRINLWDLRKL- 321

Query: 182 EDEALHQVINFASIHSCGW 200
           + E +  + + +SI +  W
Sbjct: 322 DGEPIKTLHHGSSISTLEW 340

>Smik_6.248 Chr6 (401099..403222) [2124 bp, 707 aa] {ON} YGR145W
           (REAL)
          Length = 707

 Score = 32.0 bits (71), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 48/108 (44%), Gaps = 10/108 (9%)

Query: 98  DANGAPALSLDSRHGMLAFGTELVGVDAVVSLFALGEWGRPLRAFVDSHHDD----VTDV 153
           D  G   +S++  +G+LA GTE      VV  +      R  + +++++ D+    VT  
Sbjct: 179 DTEGVNHVSINDVNGLLAAGTET----NVVEFWDPRSRSRVSKLYLENNIDNRPFQVTAT 234

Query: 154 KFHPTDSNLLLSGSTDGYVNVYDLKQSEEDEALHQVINFASIHSCGWL 201
            F   D      G+++GY  +YDL+ SE      Q   F  I    WL
Sbjct: 235 SFR-NDGLTFACGTSNGYSYLYDLRTSEPSMIKDQGYGF-EIKKIIWL 280

>KNAG0I00920 Chr9 (173033..174178) [1146 bp, 381 aa] {ON} Anc_8.316
           YDR142C
          Length = 381

 Score = 31.6 bits (70), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 58/154 (37%), Gaps = 35/154 (22%)

Query: 47  SVLDVAAHESSING----LQVLDSAHDRGTVFATAADDGVKLFDIRT----RGCVATLTD 98
           +VLD      + NG     Q   S HD   +   + D  V LFD+R     +G       
Sbjct: 152 AVLDRPNGTGTTNGKDCVYQAKFSPHDDSLMVCCSGDSTVSLFDLRASQPGQGPTHQFMA 211

Query: 99  ANGAPALSLD---SRHGMLAFGTELVGVDAVVSLFAL-----------GEWGRPLRA--- 141
            +G+  LS+D    R  ++A G    GVD  + ++ L           G+W    R    
Sbjct: 212 HSGSETLSVDFNKYRTNVIATG----GVDNKIKIWDLRMLRTGPLSIRGKWPEGPRGAKQ 267

Query: 142 ------FVDSHHDDVTDVKFHPTDSNLLLSGSTD 169
                  V  H   V  V + P  SN LLS S D
Sbjct: 268 VQCTNEIVGGHELAVRKVNWSPHSSNYLLSTSYD 301

>NDAI0I02180 Chr9 complement(499955..501394) [1440 bp, 479 aa] {ON}
           Anc_5.201 YLL011W
          Length = 479

 Score = 31.6 bits (70), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 38/186 (20%), Positives = 73/186 (39%), Gaps = 40/186 (21%)

Query: 148 DDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEEDEALHQVINFASIHSCGWLSPKRIW 207
           D++T VKF+  ++++  S  +D  + +YDL+ +   + + Q +   +I  C        W
Sbjct: 214 DNITTVKFNQNETDIFASAGSDNSIVLYDLRTNSPTQKIVQTMRTNAI--C--------W 263

Query: 208 SLSHMETFAIHELNDKSEHANEPQPQLFGDVREPWACDYVVDVYPGFIAAGSTRENAGEL 267
           +      F I          NE     + D+R        ++V+   ++A        ++
Sbjct: 264 NPMEAFNFVI---------GNEDHNAYYYDMRN---MSRAINVFKDHVSA------VMDV 305

Query: 268 RLLPLRDECVDAA-----NAIVLPQAHGDEV-----VRDVLVPASSPELLY--SAGEDGN 315
              P  DE V  +           Q H  E+     ++ V     S +  Y  S  +DGN
Sbjct: 306 DFSPTGDEIVTGSYDKTIRIFKTNQGHSREIYHTKRMQHVFQVKFSMDSKYVISGSDDGN 365

Query: 316 MAIWKS 321
           + +W+S
Sbjct: 366 VRLWRS 371

>Skud_2.324 Chr2 complement(583774..586182) [2409 bp, 802 aa] {ON}
           YBR198C (REAL)
          Length = 802

 Score = 32.0 bits (71), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 61/120 (50%), Gaps = 14/120 (11%)

Query: 66  SAHDRGT-VFATAADDGVKLFDIRTRGCVATLTDANGAP----ALSLDSRHGMLAFGTEL 120
           S H  G  VF  ++D   +++D+ T G    L   + AP    A+S D R   L+ G+E 
Sbjct: 620 SFHPNGCYVFTGSSDKTCRMWDVST-GDSVRLFLGHTAPVICIAVSPDGR--WLSTGSE- 675

Query: 121 VGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQS 180
              D +++++ +G  G+ L+       + +  + +   + N+L+SG  D  V V+DLK++
Sbjct: 676 ---DGIINIWDIGT-GKRLKQMRGHGKNAIYSLSYS-KEGNVLISGGADHSVRVWDLKKA 730

>SAKL0H01628g Chr8 (168606..173270) [4665 bp, 1554 aa] {ON} similar to
            gnl|GLV|CAGL0M13409g Candida glabrata CAGL0M13409g and
            some similarites with YHR186C uniprot|P38873
            Saccharomyces cerevisiae YHR186C KOG1 Subunit of TORC1 a
            rapamycin-sensitive complex involved in growth control
            that contains Tor1p or Tor2p Lst8p and Tco89p contains
            four HEAT repeats and seven WD-40 repeats may act as a
            scaffold protein to couple TOR and its effectors
          Length = 1554

 Score = 32.0 bits (71), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 25/38 (65%), Gaps = 1/38 (2%)

Query: 150  VTDVKF-HPTDSNLLLSGSTDGYVNVYDLKQSEEDEAL 186
            +TD+KF +  D+ LLL+GS+DG V +Y    S ED  L
Sbjct: 1256 ITDLKFLNEDDAPLLLTGSSDGIVKIYKNFHSLEDFQL 1293

>Kwal_27.12053 s27 (1065073..1067340) [2268 bp, 755 aa] {ON} YBR198C
           (TAF5) - Probable transcription-associated factor
           protein, probable -transducin type [contig 24] FULL
          Length = 755

 Score = 32.0 bits (71), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 62/120 (51%), Gaps = 14/120 (11%)

Query: 66  SAHDRGT-VFATAADDGVKLFDIRTRGCVATLTDANGAP----ALSLDSRHGMLAFGTEL 120
           S H  GT VF  ++D   +++DI T G    L   + AP    A+S D R   L+ G+E 
Sbjct: 573 SFHPNGTYVFTGSSDKTCRMWDI-TSGDSVRLFLGHTAPVTSTAVSPDGR--WLSTGSE- 628

Query: 121 VGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQS 180
              D V++++ +G  G+ L+       + V  + +   + ++L+SG  D  V V+D+K+S
Sbjct: 629 ---DGVINVWDIGT-GKRLKQMRGHGKNAVYSLSYS-KEGHVLISGGADHSVRVWDVKKS 683

>NCAS0A07860 Chr1 (1563830..1565362) [1533 bp, 510 aa] {ON}
           Anc_2.469 YMR093W
          Length = 510

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 44/104 (42%), Gaps = 4/104 (3%)

Query: 74  FATAADDGVKLFDIRTRGCVATLTDANGAPALSLDSRHGMLAFGTELVGVDAVVSLFALG 133
           FA  +   V++F  RTR  + T +        +     G L    +  G+ +V   +   
Sbjct: 55  FAVTSSTRVQIFSSRTRQVIKTFSRFKDVVYSASFRSDGKLLVAGDATGLVSVYDSYNPR 114

Query: 134 EWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDL 177
                + A   +H   VT  KFHP D+  L++ S D  + ++D+
Sbjct: 115 TILLSINA--STHPTHVT--KFHPQDNKTLITASDDRVIRLWDI 154

 Score = 30.8 bits (68), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 47/97 (48%), Gaps = 12/97 (12%)

Query: 124 DAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEE- 182
           D V+ L+ +    +P      S  D V  V   P+  ++++SGS DG + +YD + S   
Sbjct: 146 DRVIRLWDISNAYQPQLELTGST-DYVRSVTCVPSAPHMIVSGSYDGIIRLYDTRASGSS 204

Query: 183 -------DEALHQVINFAS--IHSCGWLSPKRIWSLS 210
                  D+ +  +I+ ++  I SCG  S  ++W L+
Sbjct: 205 PIYSLLHDQPIEDIISISATQIVSCGG-SNFKVWDLT 240

>ZYRO0D07744g Chr4 (674077..678654) [4578 bp, 1525 aa] {ON} similar to
            gnl|GLV|CAGL0M13409g Candida glabrata CAGL0M13409g and
            some similarites with YHR186C uniprot|P38873
            Saccharomyces cerevisiae YHR186C KOG1 Subunit of TORC1 a
            rapamycin-sensitive complex involved in growth control
            that contains Tor1p or Tor2p Lst8p and Tco89p contains
            four HEAT repeats and seven WD-40 repeats may act as a
            scaffold protein to couple TOR and its effectors
          Length = 1525

 Score = 32.0 bits (71), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 25/38 (65%), Gaps = 1/38 (2%)

Query: 150  VTDVKF-HPTDSNLLLSGSTDGYVNVYDLKQSEEDEAL 186
            VTD+KF +  D+ LLL+GS+DG V +Y    S +D  L
Sbjct: 1228 VTDLKFLNEDDAALLLAGSSDGIVKIYKNIHSNDDLEL 1265

>KAFR0H02450 Chr8 complement(468767..470020) [1254 bp, 417 aa] {ON}
           Anc_8.672 YPL151C
          Length = 417

 Score = 31.6 bits (70), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 42/181 (23%), Positives = 76/181 (41%), Gaps = 29/181 (16%)

Query: 8   KVSFGADNW--CLRLRPLYQAGVLAALSNGHVHLVDWATGKSVLDVAAHESSINGLQVLD 65
           KV  G   W  C+ + P+         ++  + + D+A+GK  L ++ H   + G++ L 
Sbjct: 102 KVINGHLGWVRCIAMDPVDNEWFATGSNDSTIKVWDFASGKLKLTLSGH---VMGVRDLV 158

Query: 66  SAHDRGTVFATAADDGVKLFDIRTR-------GCVATLTDANGAPALSLDSRHGMLAFGT 118
            +     +F+ + D  VK +D+          G ++ +   +  P LSL +         
Sbjct: 159 VSKRHPYMFSASEDKLVKCWDLEKNAPIRDYFGHLSGVHTVDIHPTLSLIAS-------- 210

Query: 119 ELVGVDAVVSLFALGEWGRPLRAFVD--SHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYD 176
              G D+VV L+ +    R  +A +    H   +  VK  P D   ++S S D  V  +D
Sbjct: 211 --AGRDSVVKLWDI----RSKKAVITLVGHKSPINSVKCTPADPQ-IISCSNDTTVITWD 263

Query: 177 L 177
           L
Sbjct: 264 L 264

>NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9
          Length = 438

 Score = 31.6 bits (70), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 38/188 (20%), Positives = 83/188 (44%), Gaps = 8/188 (4%)

Query: 137 RPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEEDEALHQVINFASIH 196
           +PL+ +   H+D V D K++  +SN+  S S D  + ++D  Q E++  ++ +      +
Sbjct: 235 KPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHD--QREQNTIINSIKTTDPFN 292

Query: 197 SCGWLSPKRIWSLSHMETFAIHELNDKSEHANEPQPQLFGDVREPWACDYVVDVYPGFIA 256
           +    S    + ++   T ++  L D S + + P   + G        ++        I+
Sbjct: 293 TLA-FSKHSQYLMAAAGTDSLVYLYD-SRNLSVPLYSMNGHEDSITNLEFSPHTDGVLIS 350

Query: 257 AGSTRE----NAGELRLLPLRDECVDAANAIVLPQAHGDEVVRDVLVPASSPELLYSAGE 312
           +G+ R     +  ++    + D+  D A  +++  A     V D  +  + P L+ SA E
Sbjct: 351 SGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEE 410

Query: 313 DGNMAIWK 320
           +  + +WK
Sbjct: 411 ENIIQVWK 418

>Skud_13.261 Chr13 complement(445193..447697) [2505 bp, 834 aa] {ON}
           YMR102C (REAL)
          Length = 834

 Score = 31.6 bits (70), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 19/31 (61%), Gaps = 2/31 (6%)

Query: 139 LRAFVDSHHDDVTDVKFHPTDSNLLLSGSTD 169
           L+ FV  H D VT V+FHPTD    +SG  D
Sbjct: 311 LKTFV--HPDFVTCVEFHPTDDRFFISGCLD 339

>AER114W Chr5 (850726..850730,850789..852685) [1902 bp, 633 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR429W
           (CRN1); 1-intron
          Length = 633

 Score = 31.6 bits (70), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 29/56 (51%), Gaps = 1/56 (1%)

Query: 122 GVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDL 177
           G  AVV +  +G+    +  F   H   V D  F P D  +L+SGS DG + V+++
Sbjct: 57  GAFAVVPVEEVGKAPDQIPLF-RGHTAQVLDTDFDPFDERMLVSGSDDGRIGVWEI 111

>NDAI0C03540 Chr3 complement(810904..815580) [4677 bp, 1558 aa] {ON}
            Anc_5.49 YHR186C
          Length = 1558

 Score = 32.0 bits (71), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 23/35 (65%), Gaps = 2/35 (5%)

Query: 150  VTDVKF-HPTDSNLLLSGSTDGYVNVY-DLKQSEE 182
            +TDVKF +  D  LLL+GS+DG V +Y D    EE
Sbjct: 1260 ITDVKFLNEDDQTLLLTGSSDGIVKIYRDFHSIEE 1294

>Ecym_8090 Chr8 (194643..196793) [2151 bp, 716 aa] {ON} similar to
           Ashbya gossypii AEL314W
          Length = 716

 Score = 31.6 bits (70), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 38/65 (58%), Gaps = 9/65 (13%)

Query: 114 LAFGTELVGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVN 173
           LA GT+    D VV L+ L   GR +R  +D H D +T ++F   DS  L++GS D  + 
Sbjct: 581 LATGTK----DGVVRLWDL-RSGRVVRT-LDGHSDAITSLEF---DSLHLVTGSLDKSIR 631

Query: 174 VYDLK 178
           ++DL+
Sbjct: 632 IWDLR 636

>Suva_14.342 Chr14 (600032..600943) [912 bp, 303 aa] {ON} YNL006W
           (REAL)
          Length = 303

 Score = 31.2 bits (69), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 36/149 (24%), Positives = 65/149 (43%), Gaps = 18/149 (12%)

Query: 44  TGKSVLDVAAHESSINGLQVLDSAHDRGTVFATAADDGVKLFDIRTR--GCVATLTDANG 101
           TG     +   +S +N L++ +       + ATA    V+L+DIRT     VA+     G
Sbjct: 21  TGVCSRTIQHSDSQVNRLEITNDK----KLLATAGHQNVRLYDIRTTNPNPVASFEGHRG 76

Query: 102 -APALSLDSRHGMLAFGTELVGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDS 160
              ++S    +  +   +E    D  + ++ +     P R +   H+  V +V  HP   
Sbjct: 77  NVTSVSFQQDNRWMVTSSE----DGTIKVWDVRSPSIP-RNY--KHNAPVNEVVIHPNQG 129

Query: 161 NLLLSGSTDGYVNVYDLKQSEEDEALHQV 189
             L+S   DG + ++DL    E++  HQ+
Sbjct: 130 E-LISCDRDGNIRIWDLG---ENQCTHQL 154

>Suva_4.452 Chr4 complement(786121..788523) [2403 bp, 800 aa] {ON}
           YBR198C (REAL)
          Length = 800

 Score = 31.6 bits (70), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 61/120 (50%), Gaps = 14/120 (11%)

Query: 66  SAHDRGT-VFATAADDGVKLFDIRTRGCVATLTDANGAP----ALSLDSRHGMLAFGTEL 120
           S H  G  VF  ++D   +++D+ T G    L   + AP    A+S D R   L+ G+E 
Sbjct: 618 SFHPNGCYVFTGSSDKTCRMWDVST-GDSVRLFLGHTAPVICIAVSPDGR--WLSTGSE- 673

Query: 121 VGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQS 180
              D +++++ +G  G+ L+       + +  + +   + N+L+SG  D  V V+DLK++
Sbjct: 674 ---DGIINIWDIGT-GKRLKQMRGHGKNAIYSLSYS-KEGNVLISGGADHSVRVWDLKKA 728

>TBLA0C03990 Chr3 (960225..961538) [1314 bp, 437 aa] {ON} Anc_4.123
           YAR003W
          Length = 437

 Score = 31.6 bits (70), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 28/46 (60%), Gaps = 2/46 (4%)

Query: 156 HPTDSNLLLSGSTDGYVNVYDLKQSEEDEALHQ--VINFASIHSCG 199
           HP   N+L++G++ G++N Y L  S  +E +++  +I+   I +C 
Sbjct: 176 HPKYDNILVTGTSKGWINFYLLADSNSNENVNETKLIHSVKIGNCN 221

>Kwal_26.8975 s26 (1026741..1028078) [1338 bp, 445 aa] {ON} YOR272W
           (YTM1) - microtubule-associated protein [contig 68] FULL
          Length = 445

 Score = 31.6 bits (70), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 28/119 (23%), Positives = 56/119 (47%), Gaps = 2/119 (1%)

Query: 62  QVLDSAHDRGTVFATAADDGVKLFDIRTRGCVATLTDANGAPALSLDSRHGMLAFGTELV 121
           +VL    D+   ++ + D  +K +D+ T  CV T + +    +L+   +  +LA G+   
Sbjct: 278 EVLFDFADKTVGYSVSQDHTIKTWDLVTARCVDTKSTSYSLLSLAQLPQLNLLACGSSAR 337

Query: 122 GVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQS 180
            +   +    +G   +  +  ++ H + V  +   P    +L SGS DG V V+D++ S
Sbjct: 338 HI--TLHDPRVGSSTKITQQQLNGHKNFVVALDTCPEMEYMLCSGSHDGTVKVWDVRSS 394

>Skud_14.321 Chr14 (586864..587775) [912 bp, 303 aa] {ON} YNL006W
           (REAL)
          Length = 303

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 36/149 (24%), Positives = 65/149 (43%), Gaps = 18/149 (12%)

Query: 44  TGKSVLDVAAHESSINGLQVLDSAHDRGTVFATAADDGVKLFDIRTR--GCVATLTDANG 101
           TG     +   +S +N L++ +       + ATA    V+L+DIRT     VA+     G
Sbjct: 21  TGVCSRTIQHSDSQVNRLEITNDK----KLLATAGHQNVRLYDIRTTNPNPVASFEGHRG 76

Query: 102 -APALSLDSRHGMLAFGTELVGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDS 160
              ++S    +  +   +E    D  + ++ +     P R +   H+  V +V  HP   
Sbjct: 77  NVTSVSFQQDNRWMVTSSE----DGTIKVWDVRSPSIP-RNY--KHNAPVNEVVIHPNQG 129

Query: 161 NLLLSGSTDGYVNVYDLKQSEEDEALHQV 189
             L+S   DG + ++DL    E++  HQ+
Sbjct: 130 E-LISCDRDGNIRIWDLG---ENQCTHQL 154

>NDAI0K01410 Chr11 (321553..324486) [2934 bp, 977 aa] {ON} Anc_2.450
           YKL121W
          Length = 977

 Score = 31.6 bits (70), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 15/25 (60%)

Query: 145 SHHDDVTDVKFHPTDSNLLLSGSTD 169
           SH D VT VKFHP D    L+G  D
Sbjct: 398 SHPDFVTSVKFHPVDDRFFLTGCLD 422

>Smik_12.52 Chr12 (114649..116118) [1470 bp, 489 aa] {ON} YLL011W
           (REAL)
          Length = 489

 Score = 31.6 bits (70), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 13/48 (27%), Positives = 30/48 (62%)

Query: 148 DDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEEDEALHQVINFASI 195
           D++T VKF+ +++++L S  +D  + +YDL+ +   + + Q +   +I
Sbjct: 220 DNITSVKFNQSETDILASTGSDNSIVLYDLRTNSPTQKIVQTMRTNAI 267

>Smik_13.289 Chr13 complement(454351..456864) [2514 bp, 837 aa] {ON}
           YMR102C (REAL)
          Length = 837

 Score = 31.6 bits (70), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 19/31 (61%), Gaps = 2/31 (6%)

Query: 139 LRAFVDSHHDDVTDVKFHPTDSNLLLSGSTD 169
           L+ FV  H D VT V+FHPTD    +SG  D
Sbjct: 314 LKTFV--HPDFVTCVEFHPTDDRFFISGCLD 342

>YLR222C Chr12 complement(579318..581771) [2454 bp, 817 aa] {ON}
           UTP13Nucleolar protein, component of the small subunit
           (SSU) processome containing the U3 snoRNA that is
           involved in processing of pre-18S rRNA
          Length = 817

 Score = 31.6 bits (70), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 50/99 (50%), Gaps = 9/99 (9%)

Query: 82  VKLFDIRTRGCVATLTDANGAPALSLDSRHGMLAFGTELVGVDAVVSLFALGEWGRPLRA 141
           +K+F ++T   V ++  ++ +  L  DS   +LA G    G D  + +  + E G    +
Sbjct: 85  LKIFHLKTGKVVRSMKISSPSYILDADSTSTLLAVG----GTDGSIIVVDI-ENGYITHS 139

Query: 142 FVDSHHDDVTDVKFHPTDSN---LLLSGSTDGYVNVYDL 177
           F   H   ++ +KF+   ++   LL SG T+G V V+DL
Sbjct: 140 F-KGHGGTISSLKFYGQLNSKIWLLASGDTNGMVKVWDL 177

>TPHA0O00710 Chr15 (135136..136050) [915 bp, 304 aa] {ON} Anc_1.399
           YNL006W
          Length = 304

 Score = 31.2 bits (69), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 32/149 (21%), Positives = 64/149 (42%), Gaps = 18/149 (12%)

Query: 44  TGKSVLDVAAHESSINGLQVLDSAHDRGTVFATAADDGVKLFDIRTRGC--VATLT-DAN 100
           TG     +   +S +N L++ +       + A A  + +KL+D+ T     +A+     N
Sbjct: 21  TGVCSRTIQHPDSQVNKLEITNDKK----LLAAAGSNNIKLYDVNTSNSNPIASFDGHKN 76

Query: 101 GAPALSLDSRHGMLAFGTELVGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDS 160
              +++    +  +   +E    D  + L+ +     P R +   H+  V +V  HP   
Sbjct: 77  NVTSINFQVENKWMVTSSE----DNTIKLWDIRSPSSP-RTY--KHNCPVNEVIIHPNQG 129

Query: 161 NLLLSGSTDGYVNVYDLKQSEEDEALHQV 189
            L+ S   DG + ++DL    E++  HQ+
Sbjct: 130 ELI-SCDKDGNIRIWDLG---ENQCTHQL 154

>KNAG0D00740 Chr4 complement(115399..116913) [1515 bp, 504 aa] {ON}
           Anc_6.276 YPL247C
          Length = 504

 Score = 31.6 bits (70), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 60/143 (41%), Gaps = 21/143 (14%)

Query: 51  VAAHESSINGLQVL-DSAHDRGTVFATAADDG-VKLFDIRT-------------RGCVAT 95
           + AH+S +  ++ L  S H    +FA+   DG V++FD+R+              G V  
Sbjct: 286 LIAHDSEVYDVRFLSQSTH----LFASCGGDGSVRVFDLRSLAHSTIVYEPPAGEGTVND 341

Query: 96  LTDANGAPALSLDSRHGMLAFGTELVGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKF 155
           +T  N A  L L+           LV     + +  +     P    +  H   V  +K+
Sbjct: 342 VTAQNNA-LLRLEPSLMDPNIIATLVADSKDILILDMRNPESPALT-LKGHSSLVNQIKW 399

Query: 156 HPTDSNLLLSGSTDGYVNVYDLK 178
           HPT  N+LLS S D  V  +DL 
Sbjct: 400 HPTKRNVLLSCSDDCQVLYWDLN 422

>Suva_13.280 Chr13 complement(451520..454051) [2532 bp, 843 aa] {ON}
           YMR102C (REAL)
          Length = 843

 Score = 31.6 bits (70), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 2/39 (5%)

Query: 139 LRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDL 177
           L+ FV  H D VT V+FHPTD    +SG  D    ++ +
Sbjct: 315 LKTFV--HPDFVTCVEFHPTDDRFFISGCLDHKCRLWSI 351

>NCAS0B01910 Chr2 (312479..313456) [978 bp, 325 aa] {ON} Anc_8.585
          Length = 325

 Score = 31.2 bits (69), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 31/55 (56%), Gaps = 5/55 (9%)

Query: 45  GKSVLDVAAHESSINGLQVLDSAHDR-GTVFATAADDG-VKLFDIRTRGCVATLT 97
           G  +  ++AH  S+  L +     DR  +V A+ + DG ++LFD RT  C+ TLT
Sbjct: 130 GAILKTISAHSESVVSLSI---CPDRDSSVLASGSFDGLIRLFDTRTGHCLKTLT 181

 Score = 30.4 bits (67), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 50/108 (46%), Gaps = 8/108 (7%)

Query: 73  VFATAADDGVKLFDIRTRGCVATLTDANGAPALSLD-SRHGMLAFGTELVGVDAVVSLFA 131
             A+A+DD        T GC+  L   + AP +SL  +  G L F + +     +   F 
Sbjct: 71  CLASASDDFTIEITHLTHGCLHRLM-GHTAPVISLTYNDSGNLLFTSSMDESIKIWDTFH 129

Query: 132 LGEWGRPLRAFVDSHHDDVTDVKFHP-TDSNLLLSGSTDGYVNVYDLK 178
               G  L+  + +H + V  +   P  DS++L SGS DG + ++D +
Sbjct: 130 ----GAILKT-ISAHSESVVSLSICPDRDSSVLASGSFDGLIRLFDTR 172

>AEL246C Chr5 complement(172849..175296) [2448 bp, 815 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR198C
           (TAF5)
          Length = 815

 Score = 31.6 bits (70), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 60/123 (48%), Gaps = 12/123 (9%)

Query: 68  HDRGT-VFATAADDGVKLFDIRTRGCVATL---TDANGAPALSLDSRHGMLAFGTELVGV 123
           H  GT V   ++D   +++DI+T   V      T +  + A+S D R   L  G+E    
Sbjct: 635 HPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGR--WLTTGSE---- 688

Query: 124 DAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQSEED 183
           D V+ ++ +G  G+ ++         V  + F+  + N+L+SG  D  V V+DLK+   +
Sbjct: 689 DGVIIVWDIGT-GKRIKQMRGHGKSAVYSLSFN-KEGNILVSGGADQSVRVWDLKKFTNE 746

Query: 184 EAL 186
            +L
Sbjct: 747 PSL 749

>KNAG0H01690 Chr8 (301564..302475) [912 bp, 303 aa] {ON} Anc_1.399
           YNL006W
          Length = 303

 Score = 31.2 bits (69), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 36/149 (24%), Positives = 64/149 (42%), Gaps = 18/149 (12%)

Query: 44  TGKSVLDVAAHESSINGLQVLDSAHDRGTVFATAADDGVKLFDIRTR--GCVATLTDANG 101
           TG     +   +S +N L++ +       + A A    V+L+DIRT     VA+     G
Sbjct: 21  TGVCSRTIQHSDSQVNRLEITNDK----KLLAAAGHQNVRLYDIRTTNPNPVASFEGHKG 76

Query: 102 -APALSLDSRHGMLAFGTELVGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDS 160
              +LS    +  +   +E    D  + ++ +     P R +   H+  V +V  HP   
Sbjct: 77  NVTSLSFQQDNKWMVSSSE----DGTIKVWDVRSPSIP-RNY--KHNAPVNEVVIHPNQG 129

Query: 161 NLLLSGSTDGYVNVYDLKQSEEDEALHQV 189
             L+S   DG + ++DL    E++  HQ+
Sbjct: 130 E-LISCDRDGNIRIWDLG---ENQCTHQL 154

>Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON}
           YOL138C (REAL)
          Length = 1336

 Score = 31.6 bits (70), Expect = 4.5,   Method: Composition-based stats.
 Identities = 14/43 (32%), Positives = 23/43 (53%)

Query: 138 PLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQS 180
           PL   +  H   +    F+  +SNL++SG  D  V ++DL+ S
Sbjct: 252 PLVTSLCEHTRSINSFDFNMVESNLIISGGQDSCVKIWDLRSS 294

>Smik_14.322 Chr14 (578426..579337) [912 bp, 303 aa] {ON} YNL006W
           (REAL)
          Length = 303

 Score = 31.2 bits (69), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 36/149 (24%), Positives = 65/149 (43%), Gaps = 18/149 (12%)

Query: 44  TGKSVLDVAAHESSINGLQVLDSAHDRGTVFATAADDGVKLFDIRTR--GCVATLTDANG 101
           TG     +   +S +N L++ +       + ATA    V+L+DIRT     VA+     G
Sbjct: 21  TGVCSRTIQHSDSQVNRLEITNDK----KLLATAGHQNVRLYDIRTTNPNPVASFEGHRG 76

Query: 102 -APALSLDSRHGMLAFGTELVGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDS 160
              ++S    +  +   +E    D  + ++ +     P R +   H+  V +V  HP   
Sbjct: 77  NVTSVSFQQDNRWMVTSSE----DGTIKVWDVRSPSIP-RNY--KHNAPVNEVVIHPNQG 129

Query: 161 NLLLSGSTDGYVNVYDLKQSEEDEALHQV 189
             L+S   DG + ++DL    E++  HQ+
Sbjct: 130 E-LISCDRDGNIRIWDLG---ENQCTHQL 154

>YNL006W Chr14 (620067..620978) [912 bp, 303 aa] {ON}  LST8Protein
           required for the transport of amino acid permease Gap1p
           from the Golgi to the cell surface; component of the TOR
           signaling pathway; associates with both Tor1p and Tor2p;
           contains a WD-repeat
          Length = 303

 Score = 31.2 bits (69), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 36/149 (24%), Positives = 65/149 (43%), Gaps = 18/149 (12%)

Query: 44  TGKSVLDVAAHESSINGLQVLDSAHDRGTVFATAADDGVKLFDIRTR--GCVATLTDANG 101
           TG     +   +S +N L++ +       + ATA    V+L+DIRT     VA+     G
Sbjct: 21  TGVCSRTIQHSDSQVNRLEITNDK----KLLATAGHQNVRLYDIRTTNPNPVASFEGHRG 76

Query: 102 -APALSLDSRHGMLAFGTELVGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDS 160
              ++S    +  +   +E    D  + ++ +     P R +   H+  V +V  HP   
Sbjct: 77  NVTSVSFQQDNRWMVTSSE----DGTIKVWDVRSPSIP-RNY--KHNAPVNEVVIHPNQG 129

Query: 161 NLLLSGSTDGYVNVYDLKQSEEDEALHQV 189
             L+S   DG + ++DL    E++  HQ+
Sbjct: 130 E-LISCDRDGNIRIWDLG---ENQCTHQL 154

>NCAS0A05520 Chr1 complement(1085200..1087215) [2016 bp, 671 aa]
           {ON} Anc_6.363
          Length = 671

 Score = 31.6 bits (70), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 35/150 (23%), Positives = 64/150 (42%), Gaps = 14/150 (9%)

Query: 37  VHLVDWATGKSVLDVAAHESSINGLQVLDSAHDRGTVFATAADDGVKLFDIRTRGCVATL 96
           + + D    K V+ +  HE  +  L    +      + + + D  V+++D+RT  C  TL
Sbjct: 411 IRIWDIQERKIVMVLKGHEQDVYSLDYFPNGEK---LVSGSGDRTVRIWDLRTGQCSLTL 467

Query: 97  TDANGAPALSLDSRHG-MLAFGTELVGVDAVVSLF-----ALGEWGRPLRAFVDSHHDDV 150
           +   G   +++    G  +A G+    +D  V ++      L E           H D V
Sbjct: 468 SIEYGVTTVAVSPNDGKFIAAGS----LDRAVRVWDSTTGFLVERLDSENELGTGHRDSV 523

Query: 151 TDVKFHPTDSNLLLSGSTDGYVNVYDLKQS 180
             V F   D N ++SGS D  V +++++ S
Sbjct: 524 YSVVFT-RDGNEVVSGSLDKTVKLWNMRHS 552

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 42,533,727
Number of extensions: 1855101
Number of successful extensions: 8115
Number of sequences better than 10.0: 450
Number of HSP's gapped: 8177
Number of HSP's successfully gapped: 509
Length of query: 403
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 291
Effective length of database: 40,638,807
Effective search space: 11825892837
Effective search space used: 11825892837
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)