Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ADL217W2.284ON75075037370.0
Ecym_33232.284ON74865915610.0
SAKL0E07722g2.284ON79167114520.0
KLTH0G10318g2.284ON79059914140.0
Kwal_27.115422.284ON79159613641e-177
KLLA0E08405g2.284ON77759713411e-174
Smik_9.842.284ON80856413131e-170
CAGL0G02607g2.284ON68831312771e-166
Suva_9.1042.284ON80557812881e-166
YIL095W (PRK1)2.284ON81056312761e-164
TDEL0G021502.284ON66147612581e-163
KAFR0J013702.284ON78058612651e-163
Skud_9.782.284ON80956012641e-162
NCAS0G038102.284ON66131112441e-161
TBLA0B059302.284ON71731512481e-161
NDAI0G006402.284ON62131312181e-158
TPHA0C033802.284ON69735212221e-157
KAFR0H033302.284ON36931911901e-157
NCAS0B062602.284ON72336112121e-156
Kpol_1003.352.284ON71331612061e-155
NDAI0B035602.284ON75632212091e-155
ZYRO0A01848g2.284ON70449412031e-154
YNL020C (ARK1)2.284ON63833611661e-150
Skud_14.3092.284ON63933911631e-149
Smik_14.3112.284ON63737111491e-147
TBLA0B069402.284ON144331711931e-146
Suva_14.3272.284ON63230611211e-143
KNAG0H020202.284ON59232411081e-142
KNAG0A054302.284ON78856911051e-139
Kpol_1039.332.284ON70131610891e-138
CAGL0J03432g2.284ON62230210821e-138
TPHA0D015402.284ON70737310891e-137
KNAG0H012203.273ON9133208038e-94
KAFR0A010403.273ON9123258002e-93
SAKL0D03234g3.273ON8583127921e-92
Kpol_1052.223.273ON11013117934e-91
Kpol_251.43.273ON8383157771e-90
TBLA0E025903.273ON10613137881e-90
KNAG0J008203.273ON10913167882e-90
NCAS0A105903.273ON10953147882e-90
Suva_4.2973.273ON11073137812e-89
ZYRO0E06864g3.273ON11153137803e-89
Skud_2.1793.273ON10903137793e-89
KLTH0C07260g3.273ON9013137704e-89
Ecym_26503.273ON8943137642e-88
Smik_2.1913.273ON11083137733e-88
YBR059C (AKL1)3.273ON11083137733e-88
CAGL0H10208g3.273ON10273117686e-88
TDEL0D035203.273ON10493117679e-88
NDAI0A057003.273ON11573257692e-87
KLLA0F18612g3.273ON8143127514e-87
Kwal_27.109453.273ON9353117541e-86
KAFR0C004303.273ON9493197499e-86
CAGL0K11990g3.273ON9913577492e-85
TBLA0I019303.273ON13613147556e-85
TPHA0M011203.273ON7883177347e-85
AGR027C3.273ON9613187402e-84
TPHA0A040303.273ON10543127432e-84
Kwal_56.242746.262ON3463392494e-22
Suva_16.706.262ON3643372415e-21
KAFR0A050906.31ON6682432477e-21
SAKL0A03344g6.262ON3643582381e-20
Skud_16.426.262ON3643312344e-20
TDEL0A067506.262ON3723482344e-20
KLTH0H03080g6.262ON3463362326e-20
ZYRO0D05500g7.86ON12622332362e-19
YPL236C (ENV7)6.262ON3643312273e-19
NDAI0H024707.86ON14112872326e-19
ZYRO0E07876g6.262ON3693342247e-19
NDAI0C026806.31ON7502922281e-18
TPHA0F024306.31ON7982882262e-18
Kpol_1037.206.31ON7042732253e-18
Smik_6.4416.262ON3643312193e-18
KAFR0B028008.279ON10952132254e-18
CAGL0J11638g6.31ON7462742235e-18
TBLA0A047207.86ON12622362246e-18
Kpol_1072.198.668ON8962032237e-18
KLLA0F07623g7.86ON12292852237e-18
KNAG0D048107.86ON14402372237e-18
KAFR0D012207.86ON10552812211e-17
Kwal_26.71547.86ON12132342211e-17
Kpol_1023.266.31ON7392702182e-17
KNAG0E008506.31ON7112732182e-17
Smik_13.1596.31ON7052862173e-17
TDEL0H036407.86ON12372382183e-17
NCAS0D021006.31ON7262922173e-17
TDEL0G043806.31ON7222732164e-17
ZYRO0D06776g8.279ON12042142165e-17
SAKL0H06754g8.668ON8842002165e-17
Skud_16.3403.338ON3882212105e-17
Suva_13.1636.31ON7052862138e-17
Kpol_1040.207.86ON12972392149e-17
Skud_13.1546.31ON7052852139e-17
YMR001C (CDC5)6.31ON7052862121e-16
ACL006W6.31ON7082792121e-16
CAGL0I07513g3.92ON10762852121e-16
TPHA0J004206.31ON7072792111e-16
NCAS0G012106.262ON3673522062e-16
NCAS0F015807.86ON13822872122e-16
KLTH0F16676g5.406ON8782352112e-16
Suva_16.3823.338ON3982172062e-16
TBLA0E022907.86ON13002372112e-16
Skud_1.447.86ON13562342102e-16
Ecym_30356.31ON7402792092e-16
KNAG0F001701.24ON5432022083e-16
Kwal_26.87518.668ON8482012093e-16
Smik_16.2963.338ON3882252043e-16
YAL017W (PSK1)7.86ON13562342103e-16
KAFR0G026906.31ON7132742083e-16
CAGL0M02299g8.668ON8931982084e-16
KLLA0C06138g6.31ON7082912074e-16
Skud_4.3838.279ON10652142084e-16
CAGL0M11396g8.279ON11922142084e-16
ZYRO0C07480g6.31ON7742772075e-16
YPR054W (SMK1)3.338ON3882252025e-16
Kwal_55.215455.406ON8652002066e-16
TDEL0F040608.279ON11262142076e-16
NCAS0B050908.279ON12102142067e-16
KLTH0D02486g7.86ON12232832067e-16
KAFR0K007007.86ON13812922067e-16
Suva_16.1608.668ON9182022068e-16
CAGL0F00913g7.86ON12061832068e-16
KLTH0G13288g8.279ON11422142068e-16
Kwal_56.237178.279ON8582142058e-16
Smik_4.3678.279ON10662142059e-16
SAKL0H16632g8.279ON10622162059e-16
Ecym_42918.279ON11452112051e-15
CAGL0L03520g1.271ON14472882051e-15
TBLA0B004906.31ON7872922041e-15
Smik_1.507.86ON13572342051e-15
Suva_2.2838.279ON10892142041e-15
YJL095W (BCK1)1.271ON14782872041e-15
Skud_10.1191.271ON14812872041e-15
KNAG0F029006.31ON6492612022e-15
AGR058W8.279ON10712112032e-15
Suva_15.2975.406ON10742342032e-15
KNAG0B017801.271ON15802442032e-15
Ecym_26407.86ON13252392032e-15
Smik_4.7673.92ON7583572022e-15
SAKL0B09856g7.86ON12742372022e-15
Suva_7.838.140ON5693012002e-15
KNAG0G021108.279ON11922142022e-15
Smik_10.1471.271ON14782862022e-15
TPHA0H026307.86ON13672372023e-15
ACR281C7.86ON12592392013e-15
CAGL0L11550g5.406ON10722102013e-15
TDEL0D053203.92ON10572862003e-15
YDR122W (KIN1)8.279ON10642142004e-15
Kpol_1031.105.406ON11272022004e-15
KAFR0C014403.92ON10952472004e-15
Suva_6.1691.271ON14842822004e-15
CAGL0H06259g7.86ON13362392004e-15
KLLA0E21693g5.406ON10162291995e-15
Smik_1.793.177ON9742471995e-15
NDAI0B020708.279ON12582131996e-15
AFR335C3.92ON10331931986e-15
ZYRO0B01166g2.496ON9632761986e-15
SAKL0E01584g6.31ON6952791976e-15
Kpol_1055.242.496ON9372521986e-15
CAGL0G04609g3.92ON9652851986e-15
SAKL0G01848g5.406ON8852271978e-15
Skud_8.1635.406ON10762341979e-15
Suva_1.507.86ON13602341979e-15
NDAI0A038702.496ON8952191979e-15
CAGL0K02167g8.140ON11622771971e-14
KLLA0F11319g8.668ON8431931961e-14
Smik_8.1805.406ON10732341961e-14
NDAI0K021002.496ON9092551961e-14
TBLA0B082503.92ON13472161961e-14
Kpol_1065.36.222ON3762771911e-14
NDAI0G034508.141ON9483211961e-14
ZYRO0F07194g8.668ON9381961951e-14
NCAS0A094701.271ON15152281952e-14
KNAG0D008306.262ON3873641902e-14
TDEL0C067801.24ON4682901922e-14
NCAS0I004707.86ON10822341942e-14
YAR019C (CDC15)3.177ON9742471942e-14
CAGL0D01694g3.338ON4321731912e-14
Kpol_1044.37.86ON9321791942e-14
Suva_3.1901.52ON10242371942e-14
KNAG0B043205.406ON10272421942e-14
TPHA0L005007.86ON9592881933e-14
KLTH0D11044g8.668ON8491981923e-14
Kwal_56.224766.31ON6972801923e-14
NDAI0A085607.86ON13172851933e-14
NCAS0C049403.92ON11162791933e-14
NCAS0H019405.406ON10152341933e-14
Sklu_YGOB_Anc_2.4962.496ON6192711913e-14
KLLA0F14190g1.271ON13382611923e-14
KAFR0D049505.406ON10082371923e-14
KLTH0C10912g6.31ON6972801913e-14
YHR102W (KIC1)5.406ON10802341924e-14
Skud_16.1328.668ON9242021924e-14
NCAS0B044906.222ON3492031864e-14
Skud_3.391.52ON10172361914e-14
TBLA0C046008.279ON13152121924e-14
NDAI0G054701.271ON15552281924e-14
Kpol_463.81.271ON14472831915e-14
TPHA0J008208.279ON12182091915e-14
ZYRO0F18062g1.24ON4712821885e-14
KLLA0F19536g8.279ON11042141915e-14
Skud_5.2498.140ON11473161915e-14
Skud_1.723.177ON9742451905e-14
ZYRO0C15862g3.338ON4371691875e-14
TBLA0C029401.271ON16432891916e-14
Kwal_26.73551.271ON14462861906e-14
TDEL0A027202.496ON9151931906e-14
CAGL0K05709g1.52ON11032361906e-14
TPHA0G032902.496ON9732281897e-14
TPHA0E038501.24ON4821961877e-14
NDAI0F045201.24ON4891941877e-14
NCAS0C016708.668ON8962021897e-14
NDAI0G042903.92ON11132861897e-14
KAFR0A014201.271ON13982281907e-14
Skud_8.392.496ON9231931898e-14
KAFR0D033902.496ON7982261888e-14
KNAG0D002106.371ON8332001889e-14
Smik_8.422.496ON9391761889e-14
Kpol_376.53.338ON4771661869e-14
TDEL0A061408.668ON8611981889e-14
TDEL0D014001.271ON14292431899e-14
Kwal_27.125593.338ON4142221851e-13
KLTH0C09548g3.92ON9932811881e-13
KNAG0B053502.496ON8362511881e-13
CAGL0K02673g2.496ON9151971881e-13
Suva_2.6663.92ON7642871871e-13
TBLA0A035705.406ON9752031871e-13
Smik_7.928.141ON8972951871e-13
Skud_7.918.141ON8972951871e-13
TBLA0D022308.141ON11543041871e-13
NCAS0C041008.141ON9053281871e-13
TBLA0I002802.496ON13161981881e-13
YGL180W (ATG1)8.141ON8972951871e-13
ADL315C3.338ON4341651841e-13
YLR096W (KIN2)8.279ON11472141871e-13
CAGL0M10153g2.496ON8672381871e-13
Smik_15.1227.86ON11011951871e-13
KNAG0L005207.86ON3682231821e-13
SAKL0B07304g3.338ON4882201842e-13
Suva_5.2508.140ON11392771872e-13
Skud_4.7643.92ON7562851862e-13
SAKL0H07084g8.654ON9192601862e-13
TPHA0I009201.271ON14342851862e-13
TPHA0H016305.406ON10362741862e-13
Kwal_56.226933.92ON9841911862e-13
YHL007C (STE20)2.496ON9391931852e-13
YER129W (SAK1)8.140ON11422771862e-13
ZYRO0A06446g5.406ON9432791852e-13
ZYRO0G15290g1.271ON14872281862e-13
KNAG0F002901.52ON11252361852e-13
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADL217W
         (750 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic ho...  1444   0.0  
Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar t...   605   0.0  
SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {...   563   0.0  
KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} simila...   549   0.0  
Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {...   530   e-177
KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {...   521   e-174
Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W (...   510   e-170
CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {...   496   e-166
Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W ...   500   e-166
YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protei...   496   e-164
TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.2...   489   e-163
KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {...   491   e-163
Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W (...   491   e-162
NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {O...   483   e-161
TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON} Anc_2...   485   e-161
NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284    473   e-158
TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.2...   475   e-157
KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {O...   462   e-157
NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa] ...   471   e-156
Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON} (89266....   469   e-155
NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {O...   470   e-155
ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} simila...   468   e-154
YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON} ...   453   e-150
Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {...   452   e-149
Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {...   447   e-147
TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON} Anc_...   464   e-146
Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {...   436   e-143
KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {O...   431   e-142
KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {O...   430   e-139
Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa] ...   424   e-138
CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} simil...   421   e-138
TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {O...   424   e-137
KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.2...   313   8e-94
KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {O...   312   2e-93
SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some s...   309   1e-92
Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON} (72364...   310   4e-91
Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)...   303   1e-90
TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {...   308   1e-90
KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa] ...   308   2e-90
NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]...   308   2e-90
Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {O...   305   2e-89
ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa] ...   305   3e-89
Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {O...   304   3e-89
KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} simila...   301   4e-89
Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {O...   298   2e-88
Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {O...   302   3e-88
YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON} ...   302   3e-88
CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa] ...   300   6e-88
TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3....   300   9e-88
NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON} Anc_...   300   2e-87
KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some...   293   4e-87
Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059...   295   1e-86
KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}...   293   9e-86
CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa...   293   2e-85
TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {...   295   6e-85
TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {...   287   7e-85
AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON} S...   289   2e-84
TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3....   290   2e-84
Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236...   100   4e-22
Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {O...    97   5e-21
KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON}            100   7e-21
SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {...    96   1e-20
Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}...    95   4e-20
TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON} Anc_6...    95   4e-20
KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {...    94   6e-20
ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakl...    96   2e-19
YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON} ...    92   3e-19
NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {...    94   6e-19
ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} simila...    91   7e-19
NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {O...    92   1e-18
TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {O...    92   2e-18
Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON} (41658....    91   3e-18
Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C ...    89   3e-18
KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8....    91   4e-18
CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa...    91   5e-18
TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_...    91   6e-18
Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON} (44906....    91   7e-18
KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} simil...    91   7e-18
KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7....    91   7e-18
KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7....    90   1e-17
Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045...    90   1e-17
Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON} (51805....    89   2e-17
KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {O...    89   2e-17
Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {...    88   3e-17
TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {...    89   3e-17
NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31      88   3e-17
TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.3...    88   4e-17
ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa] ...    88   5e-17
SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} simila...    88   5e-17
Skud_16.340 Chr16 (631100..632266) [1167 bp, 388 aa] {ON} YPR054...    86   5e-17
Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {...    87   8e-17
Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON} (57057...    87   9e-17
Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {...    87   9e-17
YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON} ...    86   1e-16
ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic ho...    86   1e-16
CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} simil...    86   1e-16
TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON...    86   1e-16
NCAS0G01210 Chr7 complement(215860..216963) [1104 bp, 367 aa] {O...    84   2e-16
NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {...    86   2e-16
KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]...    86   2e-16
Suva_16.382 Chr16 (673009..674205) [1197 bp, 398 aa] {ON} YPR054...    84   2e-16
TBLA0E02290 Chr5 complement(563483..567385) [3903 bp, 1300 aa] {...    86   2e-16
Skud_1.44 Chr1 (95573..99643) [4071 bp, 1356 aa] {ON} YAL017W (R...    86   2e-16
Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON} s...    85   2e-16
KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24 ...    85   3e-16
Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {O...    85   3e-16
Smik_16.296 Chr16 (542962..544128) [1167 bp, 388 aa] {ON} YPR054...    83   3e-16
YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One o...    86   3e-16
KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {O...    85   3e-16
CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} simil...    85   4e-16
KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} simila...    84   4e-16
Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W...    85   4e-16
CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON} si...    85   4e-16
ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly...    84   5e-16
YPR054W Chr16 (666280..667446) [1167 bp, 388 aa] {ON}  SMK1Middl...    82   5e-16
Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {...    84   6e-16
TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8....    84   6e-16
NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON}              84   7e-16
KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} simil...    84   7e-16
KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] ...    84   7e-16
Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150...    84   8e-16
CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} simila...    84   8e-16
KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa...    84   8e-16
Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {...    84   8e-16
Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W...    84   9e-16
SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa...    84   9e-16
Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON...    84   1e-15
CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa]...    84   1e-15
TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}...    83   1e-15
Smik_1.50 Chr1 (103132..107205) [4074 bp, 1357 aa] {ON} YAL017W ...    84   1e-15
Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W...    83   1e-15
YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}  BCK1Mito...    83   1e-15
Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL09...    83   1e-15
KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON}               82   2e-15
AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic h...    83   2e-15
Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074...    83   2e-15
KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1....    83   2e-15
Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {...    83   2e-15
Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {...    82   2e-15
SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] ...    82   2e-15
Suva_7.83 Chr7 complement(159329..161038) [1710 bp, 569 aa] {ON}...    82   2e-15
KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8....    82   2e-15
Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL09...    82   2e-15
TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {...    82   3e-15
ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON} ...    82   3e-15
CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON} si...    82   3e-15
TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {...    82   3e-15
YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}  KIN1Serin...    82   4e-15
Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON} (25064...    82   4e-15
KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {...    82   4e-15
Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {O...    82   4e-15
CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} simil...    82   4e-15
KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa...    81   5e-15
Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}...    81   5e-15
NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON}              81   6e-15
AFR335C Chr6 complement(1046756..1049857) [3102 bp, 1033 aa] {ON...    81   6e-15
ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {O...    81   6e-15
SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {...    80   6e-15
Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {O...    81   6e-15
CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {...    81   6e-15
SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly...    80   8e-15
Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W...    80   9e-15
Suva_1.50 Chr1 (96474..100556) [4083 bp, 1360 aa] {ON} YAL017W (...    80   9e-15
NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496     80   9e-15
CAGL0K02167g Chr11 complement(192297..195785) [3489 bp, 1162 aa]...    80   1e-14
KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} simi...    80   1e-14
Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W...    80   1e-14
NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {...    80   1e-14
TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]...    80   1e-14
Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON} ...    78   1e-14
NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141     80   1e-14
ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {...    80   1e-14
NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa]...    80   2e-14
KNAG0D00830 Chr4 complement(130823..131986) [1164 bp, 387 aa] {O...    78   2e-14
TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa] ...    79   2e-14
NCAS0I00470 Chr9 (74336..77584) [3249 bp, 1082 aa] {ON} Anc_7.86       79   2e-14
YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}  ...    79   2e-14
CAGL0D01694g Chr4 complement(176981..178279) [1299 bp, 432 aa] {...    78   2e-14
Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}...    79   2e-14
Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 a...    79   2e-14
KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {...    79   2e-14
TPHA0L00500 Chr12 (83710..86589) [2880 bp, 959 aa] {ON} Anc_7.86...    79   3e-14
KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {...    79   3e-14
Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {...    79   3e-14
NDAI0A08560 Chr1 complement(1969778..1973731) [3954 bp, 1317 aa]...    79   3e-14
NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON} Anc_...    79   3e-14
NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5....    79   3e-14
Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}...    78   3e-14
KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON} uni...    79   3e-14
KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5....    79   3e-14
KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly...    78   3e-14
YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Prote...    79   4e-14
Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150...    79   4e-14
NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141     76   4e-14
Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W (R...    78   4e-14
TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON} Anc_...    79   4e-14
NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_...    79   4e-14
Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}...    78   5e-14
TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON} Anc_8...    78   5e-14
ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]...    77   5e-14
KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON} sim...    78   5e-14
Skud_5.249 Chr5 complement(400867..404310) [3444 bp, 1147 aa] {O...    78   5e-14
Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C (...    78   5e-14
ZYRO0C15862g Chr3 (1239992..1241305) [1314 bp, 437 aa] {ON} simi...    77   5e-14
TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {...    78   6e-14
Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095...    78   6e-14
TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {O...    78   6e-14
CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]...    78   6e-14
TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.4...    77   7e-14
TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {O...    77   7e-14
NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa] ...    77   7e-14
NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {O...    77   7e-14
NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]...    77   7e-14
KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1....    78   7e-14
Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON} Y...    77   8e-14
KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.4...    77   8e-14
KNAG0D00210 Chr4 complement(22721..25222) [2502 bp, 833 aa] {ON}...    77   9e-14
Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON} Y...    77   9e-14
Kpol_376.5 s376 (6334..7767) [1434 bp, 477 aa] {ON} (6334..7767)...    76   9e-14
TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa] ...    77   9e-14
TDEL0D01400 Chr4 (269367..273656) [4290 bp, 1429 aa] {ON} Anc_1....    77   9e-14
Kwal_27.12559 s27 (1273349..1274593) [1245 bp, 414 aa] {ON} YPR0...    76   1e-13
KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} simila...    77   1e-13
KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa] ...    77   1e-13
CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa] ...    77   1e-13
Suva_2.666 Chr2 complement(1183839..1186133) [2295 bp, 764 aa] {...    77   1e-13
TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.4...    77   1e-13
Smik_7.92 Chr7 (155049..157742) [2694 bp, 897 aa] {ON} YGL180W (...    77   1e-13
Skud_7.91 Chr7 (165681..168374) [2694 bp, 897 aa] {ON} YGL180W (...    77   1e-13
TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8....    77   1e-13
NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141     77   1e-13
TBLA0I00280 Chr9 (42870..46820) [3951 bp, 1316 aa] {ON} Anc_2.49...    77   1e-13
YGL180W Chr7 (160065..162758) [2694 bp, 897 aa] {ON}  ATG1Protei...    77   1e-13
ADL315C Chr4 complement(146096..147400) [1305 bp, 434 aa] {ON} S...    75   1e-13
YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}  KIN2Seri...    77   1e-13
CAGL0M10153g Chr13 complement(1010688..1013291) [2604 bp, 867 aa...    77   1e-13
Smik_15.122 Chr15 (209665..212970) [3306 bp, 1101 aa] {ON} YOL04...    77   1e-13
KNAG0L00520 Chr12 (79786..80892) [1107 bp, 368 aa] {ON} Anc_7.86...    75   1e-13
SAKL0B07304g Chr2 (625541..627007) [1467 bp, 488 aa] {ON} simila...    75   2e-13
Suva_5.250 Chr5 (392904..396323) [3420 bp, 1139 aa] {ON} YER129W...    77   2e-13
Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {...    76   2e-13
SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {...    76   2e-13
TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1....    76   2e-13
TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5....    76   2e-13
Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {...    76   2e-13
YHL007C Chr8 complement(95118..97937) [2820 bp, 939 aa] {ON}  ST...    76   2e-13
YER129W Chr5 (417281..420709) [3429 bp, 1142 aa] {ON}  SAK1Upstr...    76   2e-13
ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {...    76   2e-13
ZYRO0G15290g Chr7 complement(1237119..1241582) [4464 bp, 1487 aa...    76   2e-13
KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52...    76   2e-13
ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON} S...    76   2e-13
KNAG0G01240 Chr7 (277868..280597) [2730 bp, 909 aa] {ON} Anc_8.1...    76   2e-13
NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {O...    74   2e-13
KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} simi...    76   2e-13
Suva_7.82 Chr7 (156049..158751) [2703 bp, 900 aa] {ON} YGL180W (...    76   2e-13
Ecym_3488 Chr3 complement(915087..916400) [1314 bp, 437 aa] {ON}...    75   2e-13
KLLA0B13607g Chr2 (1191592..1194561) [2970 bp, 989 aa] {ON} simi...    76   2e-13
Ecym_2434 Chr2 complement(843308..846676) [3369 bp, 1122 aa] {ON...    76   2e-13
Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {O...    75   3e-13
Skud_15.112 Chr15 (202308..205613) [3306 bp, 1101 aa] {ON} YOL04...    76   3e-13
YOL045W Chr15 (243497..246802) [3306 bp, 1101 aa] {ON}  PSK2One ...    76   3e-13
Suva_8.47 Chr8 complement(91615..94557) [2943 bp, 980 aa] {ON} Y...    75   3e-13
Suva_15.65 Chr15 (102271..105513) [3243 bp, 1080 aa] {ON} YOL100...    75   3e-13
Kpol_1054.2 s1054 complement(4365..7655) [3291 bp, 1096 aa] {ON}...    75   3e-13
SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} simil...    75   3e-13
CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]...    75   3e-13
Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR09...    75   3e-13
SAKL0A04246g Chr1 complement(396019..397221) [1203 bp, 400 aa] {...    74   3e-13
KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} simil...    75   3e-13
TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.6...    75   4e-13
SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar ...    75   4e-13
YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein ki...    75   4e-13
Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON...    75   4e-13
Smik_7.93 Chr7 complement(158441..160132) [1692 bp, 563 aa] {ON}...    75   4e-13
TPHA0P01050 Chr16 complement(212259..215624) [3366 bp, 1121 aa] ...    75   4e-13
ABR014W Chr2 (417708..420623) [2916 bp, 971 aa] {ON} Syntenic ho...    75   4e-13
Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W (R...    75   4e-13
TDEL0E02180 Chr5 complement(408232..411195) [2964 bp, 987 aa] {O...    75   4e-13
NCAS0A05050 Chr1 complement(1002107..1004788) [2682 bp, 893 aa] ...    75   5e-13
YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}...    75   5e-13
NCAS0C04120 Chr3 complement(840008..842755) [2748 bp, 915 aa] {O...    75   5e-13
KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa] ...    75   5e-13
ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON} S...    75   5e-13
KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.2...    74   5e-13
KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} simil...    75   6e-13
TDEL0C04800 Chr3 (866157..867467) [1311 bp, 436 aa] {ON} Anc_3.3...    74   6e-13
NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON} Anc_...    75   6e-13
KNAG0H00790 Chr8 complement(124926..126131) [1206 bp, 401 aa] {O...    73   6e-13
Smik_3.189 Chr3 (273885..276044) [2160 bp, 719 aa] {ON} YCR091W ...    74   7e-13
Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209...    73   7e-13
YOL100W Chr15 (129237..132482) [3246 bp, 1081 aa] {ON}  PKH2Seri...    74   7e-13
KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} simila...    74   8e-13
TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON} Anc_...    74   8e-13
KNAG0D02140 Chr4 complement(362745..365357) [2613 bp, 870 aa] {O...    74   8e-13
KLTH0E15004g Chr5 (1328930..1330165) [1236 bp, 411 aa] {ON} simi...    73   9e-13
TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.6...    74   9e-13
TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {O...    74   9e-13
Suva_15.124 Chr15 (215781..219101) [3321 bp, 1106 aa] {ON} YOL04...    74   9e-13
NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {...    74   1e-12
Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} simila...    74   1e-12
ZYRO0G19052g Chr7 (1576638..1580033) [3396 bp, 1131 aa] {ON} sim...    74   1e-12
Skud_7.92 Chr7 complement(169006..170697) [1692 bp, 563 aa] {ON}...    73   1e-12
Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C ...    73   1e-12
NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa] ...    74   1e-12
Skud_3.165 Chr3 (258916..261066) [2151 bp, 716 aa] {ON} YCR091W ...    73   1e-12
TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {...    74   1e-12
Suva_10.180 Chr10 (337364..340843) [3480 bp, 1159 aa] {ON} YLR09...    74   1e-12
Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR09...    74   1e-12
SAKL0D05522g Chr4 (437018..441442) [4425 bp, 1474 aa] {ON} simil...    74   1e-12
CAGL0E05720g Chr5 (569265..570341) [1077 bp, 358 aa] {ON} simila...    72   1e-12
Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON} (82874...    74   1e-12
Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL10...    74   1e-12
NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {...    73   1e-12
TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2....    74   1e-12
KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {O...    73   1e-12
KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {...    73   1e-12
AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON} S...    72   2e-12
Smik_5.275 Chr5 (426176..429601) [3426 bp, 1141 aa] {ON} YER129W...    73   2e-12
CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} simila...    73   2e-12
YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein...    73   2e-12
AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON...    73   2e-12
Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {...    72   2e-12
Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa] ...    73   2e-12
Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa] ...    72   3e-12
Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON} (48405....    72   3e-12
KLLA0B11946g Chr2 complement(1048033..1049352) [1320 bp, 439 aa]...    71   3e-12
NCAS0A11020 Chr1 (2193556..2194869) [1314 bp, 437 aa] {ON} Anc_3...    71   3e-12
KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} simil...    72   3e-12
YCR091W Chr3 (274404..276566) [2163 bp, 720 aa] {ON}  KIN82Putat...    72   3e-12
KLLA0B02332g Chr2 complement(206863..207948) [1086 bp, 361 aa] {...    70   3e-12
TBLA0A06670 Chr1 complement(1630701..1632023) [1323 bp, 440 aa] ...    71   3e-12
Suva_1.86 Chr1 complement(150761..153685) [2925 bp, 974 aa] {ON}...    72   3e-12
TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2....    72   3e-12
Skud_15.54 Chr15 (88576..91824) [3249 bp, 1082 aa] {ON} YOL100W ...    72   4e-12
NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {O...    72   4e-12
NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24        71   4e-12
ZYRO0C06776g Chr3 complement(508813..511485) [2673 bp, 890 aa] {...    72   4e-12
YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON} ...    72   4e-12
KAFR0A03710 Chr1 (758918..760399) [1482 bp, 493 aa] {ON} Anc_8.6...    71   5e-12
CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa] ...    71   5e-12
Kwal_33.13681 s33 complement(350547..352694) [2148 bp, 715 aa] {...    71   5e-12
Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}...    70   5e-12
NCAS0A05570 Chr1 (1093653..1096409) [2757 bp, 918 aa] {ON} Anc_6...    71   5e-12
SAKL0C04576g Chr3 complement(444365..446611) [2247 bp, 748 aa] {...    71   5e-12
KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar ...    71   6e-12
ZYRO0B06512g Chr2 complement(521075..524410) [3336 bp, 1111 aa] ...    71   6e-12
ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic h...    71   6e-12
Ecym_6040 Chr6 complement(77854..80544) [2691 bp, 896 aa] {ON} s...    71   6e-12
KAFR0B02140 Chr2 (417972..420662) [2691 bp, 896 aa] {ON} Anc_8.1...    71   7e-12
TDEL0A07860 Chr1 (1365985..1368498) [2514 bp, 837 aa] {ON} Anc_6...    71   7e-12
KAFR0H01040 Chr8 complement(189604..190860) [1257 bp, 418 aa] {O...    70   7e-12
TBLA0D02240 Chr4 complement(561856..566547) [4692 bp, 1563 aa] {...    71   7e-12
AFR092W Chr6 (595092..599363) [4272 bp, 1423 aa] {ON} Syntenic h...    71   7e-12
TPHA0H01500 Chr8 complement(336652..339639) [2988 bp, 995 aa] {O...    71   7e-12
YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON...    71   7e-12
CAGL0C03509g Chr3 complement(350846..353533) [2688 bp, 895 aa] {...    71   7e-12
KLLA0C00979g Chr3 (73295..74746) [1452 bp, 483 aa] {ON} similar ...    70   8e-12
Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {...    71   8e-12
TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.6...    70   8e-12
Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa] ...    71   9e-12
TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1...    70   9e-12
Suva_4.221 Chr4 complement(391492..393789) [2298 bp, 765 aa] {ON...    70   9e-12
Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C ...    70   9e-12
TPHA0M01500 Chr13 (317999..319291) [1293 bp, 430 aa] {ON} Anc_3....    70   9e-12
Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}...    71   9e-12
ZYRO0D17468g Chr4 (1439376..1441958) [2583 bp, 860 aa] {ON} weak...    70   9e-12
NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52     70   1e-11
KNAG0A06750 Chr1 (1053919..1056294) [2376 bp, 791 aa] {ON} Anc_2...    70   1e-11
Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar ...    70   1e-11
Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to ...    69   1e-11
KAFR0E01580 Chr5 (318991..320280) [1290 bp, 429 aa] {ON} Anc_5.2...    69   1e-11
KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {O...    70   1e-11
TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]...    70   1e-11
NCAS0D04710 Chr4 complement(901442..903856) [2415 bp, 804 aa] {O...    70   1e-11
NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {O...    70   1e-11
ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} simila...    69   1e-11
NDAI0F01340 Chr6 complement(327928..329148) [1221 bp, 406 aa] {O...    69   1e-11
Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar t...    70   1e-11
TPHA0H00420 Chr8 complement(82575..85691) [3117 bp, 1038 aa] {ON...    70   1e-11
SAKL0C09174g Chr3 complement(833618..836833) [3216 bp, 1071 aa] ...    70   2e-11
KLLA0E03587g Chr5 complement(323764..325707) [1944 bp, 647 aa] {...    70   2e-11
Ecym_5251 Chr5 (522785..525466) [2682 bp, 893 aa] {ON} similar t...    70   2e-11
Kwal_47.17252 s47 (318148..320766) [2619 bp, 872 aa] {ON} YGL180...    70   2e-11
Ecym_8337 Chr8 (679844..681460) [1617 bp, 538 aa] {ON} similar t...    69   2e-11
TDEL0F00930 Chr6 complement(160181..163573) [3393 bp, 1130 aa] {...    70   2e-11
TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON}               69   2e-11
Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C...    70   2e-11
KLTH0A07458g Chr1 (620459..623080) [2622 bp, 873 aa] {ON} simila...    70   2e-11
TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {...    69   2e-11
KAFR0C04780 Chr3 (948771..951131) [2361 bp, 786 aa] {ON} Anc_6.3...    69   2e-11
Smik_15.57 Chr15 (92331..95576) [3246 bp, 1081 aa] {ON} YOL100W ...    69   2e-11
NDAI0A01970 Chr1 (440268..442184) [1917 bp, 638 aa] {ON} Anc_7.335     69   2e-11
KLLA0A07403g Chr1 (661261..663900) [2640 bp, 879 aa] {ON} simila...    69   2e-11
YPL209C Chr16 complement(156490..157593) [1104 bp, 367 aa] {ON} ...    68   3e-11
Skud_16.140 Chr16 complement(255090..257687) [2598 bp, 865 aa] {...    69   3e-11
KLLA0E17073g Chr5 complement(1515721..1518279) [2559 bp, 852 aa]...    69   3e-11
Ecym_2194 Chr2 complement(381633..382733) [1101 bp, 366 aa] {ON}...    68   3e-11
Kpol_1004.19 s1004 (36090..36101,36217..37689) [1485 bp, 494 aa]...    68   3e-11
TPHA0P01270 Chr16 complement(254480..257137) [2658 bp, 885 aa] {...    69   3e-11
KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {O...    69   3e-11
Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON...    69   3e-11
Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {O...    69   3e-11
KNAG0K02370 Chr11 complement(475088..477739) [2652 bp, 883 aa] {...    69   3e-11
KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {...    69   4e-11
Suva_14.402 Chr14 (690198..692915) [2718 bp, 905 aa] {ON} YNR047...    69   4e-11
YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}  KIN4Serin...    69   4e-11
NDAI0I00250 Chr9 (42174..44867) [2694 bp, 897 aa] {ON} Anc_3.177...    69   4e-11
Suva_16.169 Chr16 complement(292738..295314) [2577 bp, 858 aa] {...    69   4e-11
CAGL0H00979g Chr8 complement(94328..95527) [1200 bp, 399 aa] {ON...    67   4e-11
ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} simil...    69   4e-11
NCAS0B01470 Chr2 (241003..243186) [2184 bp, 727 aa] {ON} Anc_8.654     68   4e-11
Skud_14.379 Chr14 (677081..679774) [2694 bp, 897 aa] {ON} YNR047...    69   4e-11
YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}...    68   4e-11
KNAG0C02440 Chr3 complement(475652..476857) [1206 bp, 401 aa] {O...    67   4e-11
NCAS0A02180 Chr1 (410419..411489) [1071 bp, 356 aa] {ON} Anc_4.192     67   5e-11
TBLA0B08520 Chr2 complement(2038517..2041321) [2805 bp, 934 aa] ...    68   5e-11
Suva_8.284 Chr8 (514891..517317) [2427 bp, 808 aa] {ON} YOR233W ...    68   5e-11
Kwal_23.6458 s23 (1592349..1594955) [2607 bp, 868 aa] {ON} YNR04...    68   5e-11
ACL054W Chr3 (269703..272621) [2919 bp, 972 aa] {ON} Syntenic ho...    68   5e-11
KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly...    68   5e-11
TBLA0F00240 Chr6 complement(45510..49256) [3747 bp, 1248 aa] {ON...    68   5e-11
NCAS0I03020 Chr9 (555481..557853) [2373 bp, 790 aa] {ON} Anc_1.149     68   5e-11
YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}  HSL1Nim1...    68   6e-11
Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233...    68   6e-11
CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} simil...    67   7e-11
Suva_3.110 Chr3 complement(160016..164146) [4131 bp, 1376 aa] {O...    68   8e-11
YGL179C Chr7 complement(163409..165091) [1683 bp, 560 aa] {ON}  ...    67   8e-11
Ecym_8400 Chr8 complement(825315..828515) [3201 bp, 1066 aa] {ON...    68   8e-11
Kpol_1028.16 s1028 complement(45186..47825) [2640 bp, 879 aa] {O...    67   8e-11
KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.6...    67   9e-11
Kwal_26.8703 s26 (905007..906341) [1335 bp, 444 aa] {ON} YOR231W...    67   9e-11
Kwal_27.10004 s27 complement(156153..158360) [2208 bp, 735 aa] {...    67   9e-11
YNR047W Chr14 (708523..711204) [2682 bp, 893 aa] {ON}  FPK1Ser/T...    67   9e-11
Smik_14.377 Chr14 (666338..669025) [2688 bp, 895 aa] {ON} YNR047...    67   9e-11
KLTH0F09988g Chr6 complement(868693..869931) [1239 bp, 412 aa] {...    66   1e-10
NDAI0A05280 Chr1 complement(1191032..1192342) [1311 bp, 436 aa] ...    66   1e-10
KNAG0D01090 Chr4 complement(183319..184437) [1119 bp, 372 aa] {O...    66   1e-10
Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL10...    67   1e-10
AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}...    66   1e-10
TDEL0A04580 Chr1 (816247..818331) [2085 bp, 694 aa] {ON} Anc_5.5...    67   1e-10
Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON} (11581.....    67   1e-10
KLTH0E06754g Chr5 (619163..621784) [2622 bp, 873 aa] {ON} simila...    67   1e-10
KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa...    67   1e-10
TBLA0B02310 Chr2 (539362..541821) [2460 bp, 819 aa] {ON} Anc_3.9...    67   1e-10
KLTH0E06776g Chr5 complement(622147..625575) [3429 bp, 1142 aa] ...    67   1e-10
CAGL0L06006g Chr12 complement(672704..675532) [2829 bp, 942 aa] ...    67   1e-10
KLTH0H03982g Chr8 complement(363432..364628) [1197 bp, 398 aa] {...    66   1e-10
SAKL0D12628g Chr4 (1048973..1051429) [2457 bp, 818 aa] {ON} weak...    67   1e-10
ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} simila...    67   1e-10
KLLA0B07579g Chr2 (659591..661759) [2169 bp, 722 aa] {ON} simila...    67   2e-10
Suva_15.411 Chr15 (716095..718542) [2448 bp, 815 aa] {ON} YHR205...    67   2e-10
TPHA0M02080 Chr13 (426966..429635) [2670 bp, 889 aa] {ON} Anc_6....    67   2e-10
YDR466W Chr4 (1395121..1397817) [2697 bp, 898 aa] {ON}  PKH3Prot...    67   2e-10
KAFR0C03020 Chr3 complement(601565..603121) [1557 bp, 518 aa] {O...    66   2e-10
TBLA0J01200 Chr10 (271800..275420) [3621 bp, 1206 aa] {ON} Anc_1...    67   2e-10
Smik_15.39 Chr15 (72332..74314) [1983 bp, 660 aa] {ON} YOL113W (...    66   2e-10
AEL205W Chr5 (246871..249252) [2382 bp, 793 aa] {ON} Syntenic ho...    66   2e-10
Smik_14.34 Chr14 (53272..55788) [2517 bp, 838 aa] {ON} YNL298W (...    66   2e-10
Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL10...    67   2e-10
KNAG0A03060 Chr1 complement(375640..377142) [1503 bp, 500 aa] {O...    66   2e-10
KAFR0B06980 Chr2 (1452754..1455081) [2328 bp, 775 aa] {ON} Anc_4...    66   2e-10
TPHA0B01150 Chr2 complement(259998..262070) [2073 bp, 690 aa] {O...    66   2e-10
TBLA0A10690 Chr1 (2642723..2645632) [2910 bp, 969 aa] {ON} Anc_4...    66   2e-10
TPHA0B03850 Chr2 (909219..910841) [1623 bp, 540 aa] {ON} Anc_1.4...    66   2e-10
Ecym_3525 Chr3 (993328..995784) [2457 bp, 818 aa] {ON} similar t...    66   2e-10
TBLA0F00820 Chr6 (209607..211844) [2238 bp, 745 aa] {ON} Anc_3.1...    66   2e-10
NDAI0K02390 Chr11 (537260..539920) [2661 bp, 886 aa] {ON} Anc_6....    66   2e-10
NCAS0I02840 Chr9 (528136..529344) [1209 bp, 402 aa] {ON} Anc_1.2...    65   2e-10
AER223C Chr5 complement(1044971..1047679) [2709 bp, 902 aa] {ON}...    66   2e-10
KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {O...    66   2e-10
Kpol_1032.10 s1032 (24479..26854) [2376 bp, 791 aa] {ON} (24479....    66   2e-10
NCAS0A09960 Chr1 complement(1993554..1995926) [2373 bp, 790 aa] ...    66   2e-10
YPL140C Chr16 complement(287514..289034) [1521 bp, 506 aa] {ON} ...    65   2e-10
Kwal_23.5290 s23 complement(1095011..1097470) [2460 bp, 819 aa] ...    66   2e-10
Skud_15.39 Chr15 (69445..71412) [1968 bp, 655 aa] {ON} YOL113W (...    66   2e-10
YKL166C Chr11 complement(134509..135705) [1197 bp, 398 aa] {ON} ...    65   2e-10
ACR117W Chr3 (557738..559312) [1575 bp, 524 aa] {ON} Syntenic ho...    65   2e-10
Skud_11.58 Chr11 complement(120855..122042) [1188 bp, 395 aa] {O...    65   3e-10
YHR205W Chr8 (509363..511837) [2475 bp, 824 aa] {ON}  SCH9AGC fa...    66   3e-10
Smik_6.338 Chr6 (535192..536727) [1536 bp, 511 aa] {ON} YPL140C ...    65   3e-10
Smik_8.295 Chr8 (484074..486548) [2475 bp, 824 aa] {ON} YHR205W ...    66   3e-10
Ecym_6344 Chr6 complement(664647..668840) [4194 bp, 1397 aa] {ON...    66   3e-10
Smik_4.207 Chr4 complement(381159..383456) [2298 bp, 765 aa] {ON...    66   3e-10
NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON} Anc_...    66   3e-10
ZYRO0C12078g Chr3 (946320..948647) [2328 bp, 775 aa] {ON} simila...    66   3e-10
TDEL0F02980 Chr6 (539327..541549) [2223 bp, 740 aa] {ON} Anc_1.1...    65   3e-10
TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {O...    66   3e-10
ZYRO0G19074g Chr7 complement(1580648..1583413) [2766 bp, 921 aa]...    66   3e-10
KLLA0C18568g Chr3 (1639958..1642282) [2325 bp, 774 aa] {ON} simi...    65   3e-10
KNAG0M00190 Chr13 complement(25224..27602) [2379 bp, 792 aa] {ON...    65   3e-10
NCAS0H01780 Chr8 complement(341549..344773) [3225 bp, 1074 aa] {...    65   3e-10
CAGL0F09075g Chr6 (894761..897001) [2241 bp, 746 aa] {ON} simila...    65   3e-10
SAKL0C12386g Chr3 complement(1108341..1110923) [2583 bp, 860 aa]...    65   3e-10
TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {O...    64   3e-10
Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar t...    65   3e-10
Suva_16.170 Chr16 complement(296877..298406) [1530 bp, 509 aa] {...    65   4e-10
AEL149C Chr5 complement(348350..350533) [2184 bp, 727 aa] {ON} S...    65   4e-10
KLLA0C04191g Chr3 (384198..386591) [2394 bp, 797 aa] {ON} weakly...    65   4e-10
NDAI0C01850 Chr3 (407978..411712) [3735 bp, 1244 aa] {ON}              65   4e-10
TDEL0E05310 Chr5 (972769..973893) [1125 bp, 374 aa] {ON} Anc_6.2...    64   4e-10
SAKL0A00484g Chr1 complement(57938..60544) [2607 bp, 868 aa] {ON...    65   4e-10
YCR073C Chr3 complement(242588..246583) [3996 bp, 1331 aa] {ON} ...    65   4e-10
Skud_4.223 Chr4 complement(395836..398145) [2310 bp, 769 aa] {ON...    65   4e-10
Suva_11.56 Chr11 complement(119479..120675) [1197 bp, 398 aa] {O...    64   4e-10
Suva_2.642 Chr2 (1147428..1148865,1149541..1150805) [2703 bp, 90...    65   4e-10
TDEL0B04700 Chr2 (834336..836996) [2661 bp, 886 aa] {ON} Anc_8.1...    65   4e-10
TDEL0C02110 Chr3 (364853..366340) [1488 bp, 495 aa] {ON} Anc_7.3...    65   4e-10
Skud_16.141 Chr16 complement(259166..260707) [1542 bp, 513 aa] {...    65   4e-10
ADR313W Chr4 (1255930..1257666) [1737 bp, 578 aa] {ON} Syntenic ...    65   4e-10
Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {...    65   4e-10
Skud_8.272 Chr8 (478199..480706) [2508 bp, 835 aa] {ON} YHR205W ...    65   4e-10
KLLA0C16577g Chr3 complement(1451181..1452695) [1515 bp, 504 aa]...    65   5e-10
NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON}               65   5e-10
KNAG0I02670 Chr9 complement(524008..526734) [2727 bp, 908 aa] {O...    65   5e-10
KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON} Anc_...    65   5e-10
Skud_4.742 Chr4 (1315170..1317881) [2712 bp, 903 aa] {ON} YDR466...    65   5e-10
YNL298W Chr14 (68915..71443) [2529 bp, 842 aa] {ON}  CLA4Cdc42p-...    65   5e-10
NCAS0C01590 Chr3 (293327..295921) [2595 bp, 864 aa] {ON} Anc_8.654     65   5e-10
TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {...    65   6e-10
Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON} (95107...    65   6e-10
Smik_6.414 Chr6 (666806..667909) [1104 bp, 367 aa] {ON} YPL209C ...    64   6e-10
TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON} Anc_8...    65   6e-10
NCAS0B08280 Chr2 (1579804..1581033) [1230 bp, 409 aa] {ON} Anc_1...    64   6e-10
KLLA0E15313g Chr5 (1362851..1365025) [2175 bp, 724 aa] {ON} simi...    65   6e-10
TPHA0C04570 Chr3 (985491..987071) [1581 bp, 526 aa] {ON} Anc_2.3...    64   6e-10
KLLA0C17160g Chr3 (1498959..1501454) [2496 bp, 831 aa] {ON} simi...    65   6e-10
Skud_16.70 Chr16 complement(129918..131021) [1104 bp, 367 aa] {O...    64   6e-10
NDAI0D03420 Chr4 (806856..809261) [2406 bp, 801 aa] {ON} Anc_4.384     65   6e-10
TBLA0A02030 Chr1 complement(491365..492576) [1212 bp, 403 aa] {O...    64   6e-10
TDEL0B06320 Chr2 (1118534..1119868) [1335 bp, 444 aa] {ON} Anc_1...    64   6e-10
Kpol_1072.31 s1072 complement(67104..68684) [1581 bp, 526 aa] {O...    64   7e-10
KAFR0A08360 Chr1 complement(1677561..1680050) [2490 bp, 829 aa] ...    65   7e-10
Suva_14.42 Chr14 (65645..68239) [2595 bp, 864 aa] {ON} YNL298W (...    65   7e-10
ADR167W Chr4 (994581..997202) [2622 bp, 873 aa] {ON} Syntenic ho...    65   7e-10
NDAI0G03470 Chr7 complement(829975..832455) [2481 bp, 826 aa] {O...    64   7e-10
NCAS0A06440 Chr1 (1270771..1273020) [2250 bp, 749 aa] {ON} Anc_4...    64   7e-10
SAKL0H24706g Chr8 (2145552..2149100) [3549 bp, 1182 aa] {ON} sim...    65   7e-10
KLTH0E03652g Chr5 (330227..332671) [2445 bp, 814 aa] {ON} simila...    64   7e-10
TBLA0B01630 Chr2 (360963..364850) [3888 bp, 1295 aa] {ON} Anc_3....    65   8e-10
Skud_16.76 Chr16 (139571..140719) [1149 bp, 382 aa] {ON} YPL203W...    63   8e-10
TBLA0C05830 Chr3 complement(1408930..1410210) [1281 bp, 426 aa] ...    64   8e-10
CAGL0H01639g Chr8 (158967..160532) [1566 bp, 521 aa] {ON} simila...    64   8e-10
TBLA0A02240 Chr1 (539297..540538) [1242 bp, 413 aa] {ON} Anc_6.2...    64   8e-10
KLTH0F03916g Chr6 complement(348177..350282) [2106 bp, 701 aa] {...    64   8e-10
Skud_4.97 Chr4 (168099..169670) [1572 bp, 523 aa] {ON} YDL159W (...    64   8e-10
TBLA0H01820 Chr8 (429920..433417) [3498 bp, 1165 aa] {ON} Anc_5....    64   9e-10
Smik_11.62 Chr11 complement(120153..121346) [1194 bp, 397 aa] {O...    63   9e-10
ZYRO0G00506g Chr7 complement(38488..40854) [2367 bp, 788 aa] {ON...    64   9e-10
NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2....    64   9e-10
ZYRO0A05214g Chr1 complement(418443..421268) [2826 bp, 941 aa] {...    64   9e-10
KLTH0A01320g Chr1 (118671..121115) [2445 bp, 814 aa] {ON} simila...    64   9e-10
YOL113W Chr15 (104326..106293) [1968 bp, 655 aa] {ON}  SKM1Membe...    64   1e-09
KNAG0D04040 Chr4 (730581..731897) [1317 bp, 438 aa] {ON} Anc_4.1...    63   1e-09
SAKL0H07128g Chr8 complement(623681..625141) [1461 bp, 486 aa] {...    64   1e-09
YPL203W Chr16 (166256..167398) [1143 bp, 380 aa] {ON}  TPK2cAMP-...    63   1e-09
Suva_15.46 Chr15 (81948..83909) [1962 bp, 653 aa] {ON} YOL113W (...    64   1e-09
NCAS0A05370 Chr1 complement(1061671..1066197) [4527 bp, 1508 aa]...    64   1e-09
KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakl...    64   1e-09
NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa] ...    64   1e-09
TPHA0C00160 Chr3 complement(17339..19603) [2265 bp, 754 aa] {ON}...    64   1e-09
NCAS0D04600 Chr4 (875553..880604) [5052 bp, 1683 aa] {ON} Anc_6....    64   1e-09
Smik_6.408 Chr6 complement(657018..658163) [1146 bp, 381 aa] {ON...    63   1e-09
YDL159W Chr4 (172481..174028) [1548 bp, 515 aa] {ON}  STE7Signal...    64   1e-09
KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2....    64   1e-09
Ecym_8399 Chr8 (821221..824766) [3546 bp, 1181 aa] {ON} similar ...    64   1e-09
Smik_4.79 Chr4 (149246..150796) [1551 bp, 516 aa] {ON} YDL159W (...    64   1e-09
Skud_7.350 Chr7 (580913..582022) [1110 bp, 369 aa] {ON} YGR052W ...    63   1e-09
KAFR0H02540 Chr8 complement(483399..485852) [2454 bp, 817 aa] {O...    64   1e-09
KAFR0J02620 Chr10 complement(502187..504265) [2079 bp, 692 aa] {...    64   1e-09
Skud_14.40 Chr14 (62496..65006) [2511 bp, 836 aa] {ON} YNL298W (...    64   1e-09
Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {...    63   1e-09
KNAG0K01740 Chr11 (364195..366492) [2298 bp, 765 aa] {ON} Anc_3....    64   1e-09
ZYRO0G16632g Chr7 (1360854..1365827) [4974 bp, 1657 aa] {ON} hig...    64   1e-09
Kpol_495.14 s495 (33810..35684) [1875 bp, 624 aa] {ON} (33810..3...    63   1e-09
TPHA0G01730 Chr7 complement(355001..356779) [1779 bp, 592 aa] {O...    63   1e-09
Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {...    63   1e-09
Kpol_1066.45 s1066 complement(76786..79428) [2643 bp, 880 aa] {O...    64   1e-09
KLLA0D07304g Chr4 (623352..624749) [1398 bp, 465 aa] {ON} some s...    63   1e-09
NDAI0A06130 Chr1 complement(1391744..1394203) [2460 bp, 819 aa] ...    64   1e-09
SAKL0F11110g Chr6 (868447..869832) [1386 bp, 461 aa] {ON} simila...    63   1e-09
NDAI0E01310 Chr5 complement(260484..262094) [1611 bp, 536 aa] {O...    63   1e-09
ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa...    64   2e-09
KNAG0C04310 Chr3 complement(842994..846503) [3510 bp, 1169 aa] {...    64   2e-09
KAFR0F01800 Chr6 complement(350480..351754) [1275 bp, 424 aa] {O...    62   2e-09
KNAG0K00680 Chr11 (120919..124206) [3288 bp, 1095 aa] {ON} Anc_3...    64   2e-09
TBLA0I00910 Chr9 complement(170526..173945) [3420 bp, 1139 aa] {...    64   2e-09
Kwal_33.14081 s33 complement(519343..521085) [1743 bp, 580 aa] {...    63   2e-09
TBLA0B03990 Chr2 complement(910314..912455) [2142 bp, 713 aa] {O...    63   2e-09
TBLA0C01750 Chr3 (412762..415707) [2946 bp, 981 aa] {ON} Anc_8.6...    63   2e-09
Kpol_541.49 s541 complement(156530..159514) [2985 bp, 994 aa] {O...    63   2e-09
TDEL0E00690 Chr5 (144269..146770) [2502 bp, 833 aa] {ON} Anc_3.6...    63   2e-09
KLTH0H11858g Chr8 (1013677..1015374) [1698 bp, 565 aa] {ON} some...    63   2e-09
CAGL0I03498g Chr9 (297344..298699) [1356 bp, 451 aa] {ON} simila...    62   2e-09
ZYRO0F11418g Chr6 complement(936573..938117) [1545 bp, 514 aa] {...    63   2e-09
KLTH0H08316g Chr8 (730027..731094) [1068 bp, 355 aa] {ON} simila...    62   2e-09
Smik_3.173 Chr3 complement(242285..246307) [4023 bp, 1340 aa] {O...    64   2e-09
CAGL0J03828g Chr10 (365325..366728) [1404 bp, 467 aa] {ON} simil...    62   2e-09
KAFR0I02010 Chr9 complement(411589..412887) [1299 bp, 432 aa] {O...    62   2e-09
CAGL0H07535g Chr8 (736241..737137) [897 bp, 298 aa] {ON} highly ...    62   2e-09
KLTH0D10670g Chr4 (877472..878806) [1335 bp, 444 aa] {ON} some s...    62   2e-09
SAKL0B04488g Chr2 (395136..396242) [1107 bp, 368 aa] {ON} highly...    62   2e-09
TDEL0D00330 Chr4 complement(55638..57872) [2235 bp, 744 aa] {ON}...    63   2e-09
ZYRO0C02288g Chr3 complement(181604..184327) [2724 bp, 907 aa] {...    63   2e-09
TPHA0O01120 Chr15 complement(217462..218751) [1290 bp, 429 aa] {...    62   2e-09
KLLA0D09328g Chr4 complement(788565..791705) [3141 bp, 1046 aa] ...    63   2e-09
TDEL0A05980 Chr1 (1049221..1050771) [1551 bp, 516 aa] {ON} Anc_8...    62   2e-09
KLLA0C10802g Chr3 complement(926916..931934) [5019 bp, 1672 aa] ...    63   2e-09
ZYRO0F06798g Chr6 (558198..559676) [1479 bp, 492 aa] {ON} simila...    62   2e-09
SAKL0C05368g Chr3 complement(510576..511832) [1257 bp, 418 aa] {...    62   2e-09
KLLA0C03828g Chr3 (349187..351568) [2382 bp, 793 aa] {ON} simila...    63   2e-09
NCAS0A12350 Chr1 complement(2446237..2447236,2447319..2448559) [...    63   2e-09
SAKL0H24750g Chr8 complement(2152673..2155420) [2748 bp, 915 aa]...    63   2e-09
TBLA0C05800 Chr3 complement(1402262..1405207) [2946 bp, 981 aa] ...    63   2e-09
ACL053C Chr3 complement(273163..276708) [3546 bp, 1181 aa] {ON} ...    63   2e-09
Suva_4.87 Chr4 (160236..161810) [1575 bp, 524 aa] {ON} YDL159W (...    62   2e-09
ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly...    62   2e-09
Suva_16.104 Chr16 (176201..177352) [1152 bp, 383 aa] {ON} YPL203...    62   3e-09
Kpol_541.48 s541 (152877..153692,153695..156046) [3168 bp, 1055 ...    63   3e-09
AFR377C Chr6 complement(1116589..1118769) [2181 bp, 726 aa] {ON}...    62   3e-09
KAFR0K00280 Chr11 complement(64906..65988) [1083 bp, 360 aa] {ON...    61   3e-09
KLTH0C02662g Chr3 complement(240347..242674) [2328 bp, 775 aa] {...    62   3e-09
Smik_15.417 Chr15 (725513..727933) [2421 bp, 806 aa] {ON} YOR233...    62   3e-09
CAGL0F03311g Chr6 complement(327599..330736) [3138 bp, 1045 aa] ...    62   3e-09
YDL028C Chr4 complement(400997..403291) [2295 bp, 764 aa] {ON}  ...    62   3e-09
ZYRO0F13310g Chr6 (1092612..1096322) [3711 bp, 1236 aa] {ON} som...    62   3e-09
Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}...    62   3e-09
Suva_15.275 Chr15 complement(470782..473862) [3081 bp, 1026 aa] ...    62   3e-09
YHR082C Chr8 complement(268459..271548) [3090 bp, 1029 aa] {ON} ...    62   4e-09
KLLA0B03586g Chr2 complement(326871..329075) [2205 bp, 734 aa] {...    62   4e-09
Smik_8.160 Chr8 complement(245207..248323) [3117 bp, 1038 aa] {O...    62   4e-09
Smik_6.136 Chr6 (219577..220686) [1110 bp, 369 aa] {ON} YGR052W ...    61   4e-09
ADL389W Chr4 (27641..29776) [2136 bp, 711 aa] {ON} Syntenic homo...    62   4e-09
Ecym_4647 Chr4 (1261859..1263511) [1653 bp, 550 aa] {ON} similar...    62   4e-09
SAKL0G08250g Chr7 (703212..705707) [2496 bp, 831 aa] {ON} simila...    62   4e-09
KNAG0A05670 Chr1 complement(847460..849016) [1557 bp, 518 aa] {O...    62   4e-09
YGR052W Chr7 (593596..594705) [1110 bp, 369 aa] {ON}  FMP48Putat...    61   4e-09
NCAS0B04580 Chr2 (831695..835255) [3561 bp, 1186 aa] {ON} Anc_8....    62   4e-09
KNAG0B04460 Chr2 (856495..859461) [2967 bp, 988 aa] {ON} Anc_5.3...    62   4e-09
Kpol_1000.14 s1000 complement(36018..38015) [1998 bp, 665 aa] {O...    62   4e-09
Suva_6.245 Chr6 (438131..439315) [1185 bp, 394 aa] {ON} YJL164C ...    61   4e-09
Kpol_183.1 s183 (158..2257) [2100 bp, 699 aa] {ON} (158..2257) [...    62   4e-09
AEL284C Chr5 complement(106480..107919) [1440 bp, 479 aa] {ON} S...    61   4e-09
TBLA0E02790 Chr5 complement(693136..695562) [2427 bp, 808 aa] {O...    62   4e-09
KAFR0F03970 Chr6 (777047..778201) [1155 bp, 384 aa] {ON} Anc_4.1...    61   5e-09
CAGL0C05005g Chr3 complement(467626..470856) [3231 bp, 1076 aa] ...    62   5e-09
NCAS0I02080 Chr9 (390551..392875) [2325 bp, 774 aa] {ON} Anc_3.162     62   5e-09
Kwal_23.3590 s23 complement(353755..355254) [1500 bp, 499 aa] {O...    61   5e-09
NCAS0A06680 Chr1 (1320265..1321704) [1440 bp, 479 aa] {ON} Anc_5...    61   5e-09
TDEL0E01820 Chr5 complement(348423..349403) [981 bp, 326 aa] {ON...    60   5e-09
SAKL0E05984g Chr5 complement(485895..487391,487462..487482) [151...    61   5e-09
Skud_8.143 Chr8 complement(242422..245535) [3114 bp, 1037 aa] {O...    62   5e-09
CAGL0L05632g Chr12 (612478..614511) [2034 bp, 677 aa] {ON} simil...    62   5e-09
SAKL0B12364g Chr2 (1060853..1063021) [2169 bp, 722 aa] {ON} high...    62   5e-09
Kwal_27.10581 s27 complement(403249..406713) [3465 bp, 1154 aa] ...    62   5e-09
Kwal_47.17263 s47 complement(321115..324498) [3384 bp, 1127 aa] ...    62   5e-09
AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic ho...    61   6e-09
NCAS0A14050 Chr1 complement(2763082..2764551) [1470 bp, 489 aa] ...    61   6e-09
NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {O...    61   6e-09
Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101...    62   6e-09
TDEL0A07560 Chr1 complement(1316498..1321225) [4728 bp, 1575 aa]...    62   6e-09
Kpol_520.17 s520 complement(37953..41447) [3495 bp, 1164 aa] {ON...    62   6e-09
YOR231W Chr15 (772601..774127) [1527 bp, 508 aa] {ON}  MKK1Mitog...    61   6e-09
Kwal_47.16761 s47 (100315..102549) [2235 bp, 744 aa] {ON} YHR205...    61   6e-09
KAFR0B00920 Chr2 (170792..172300) [1509 bp, 502 aa] {ON} Anc_7.3...    61   6e-09
KNAG0D00390 Chr4 (53459..58429) [4971 bp, 1656 aa] {ON} Anc_6.34...    62   7e-09
KLTH0H01584g Chr8 (143065..144453) [1389 bp, 462 aa] {ON} simila...    61   7e-09
Kpol_265.1 s265 (4826..7099) [2274 bp, 757 aa] {ON} (4826..7099)...    61   7e-09
NDAI0D04110 Chr4 (966439..967560) [1122 bp, 373 aa] {ON} Anc_4.192     60   7e-09
NDAI0B00210 Chr2 (27983..29185) [1203 bp, 400 aa] {ON} Anc_1.182       60   7e-09
Kwal_55.20189 s55 (288918..291356) [2439 bp, 812 aa] {ON} YHR082...    61   7e-09
NCAS0C01580 Chr3 (291554..292873) [1320 bp, 439 aa] {ON} Anc_8.652     60   7e-09
ACR196C Chr3 complement(692321..693913) [1593 bp, 530 aa] {ON} S...    61   7e-09
Kpol_1069.13 s1069 complement(27223..28506) [1284 bp, 427 aa] {O...    60   7e-09
KLTH0D17204g Chr4 complement(1426818..1429085) [2268 bp, 755 aa]...    61   8e-09
Kwal_33.13846 s33 complement(419630..420757) [1128 bp, 375 aa] {...    60   8e-09
YBR160W Chr2 (560078..560974) [897 bp, 298 aa] {ON}  CDC28Cataly...    59   8e-09
Kwal_56.24584 s56 complement(1063271..1064578) [1308 bp, 435 aa]...    60   8e-09
SAKL0G06402g Chr7 (535632..537986) [2355 bp, 784 aa] {ON} simila...    61   8e-09
AER264C Chr5 complement(1120017..1124468) [4452 bp, 1483 aa] {ON...    61   8e-09
Skud_15.397 Chr15 (711559..713082) [1524 bp, 507 aa] {ON} YOR231...    60   8e-09
CAGL0M03729g Chr13 complement(420316..422901) [2586 bp, 861 aa] ...    61   9e-09
TPHA0A02630 Chr1 complement(562516..565164) [2649 bp, 882 aa] {O...    61   9e-09
NDAI0A00960 Chr1 complement(197205..198431) [1227 bp, 408 aa] {O...    60   9e-09
ACR191C Chr3 complement(680398..683847) [3450 bp, 1149 aa] {ON} ...    61   1e-08
Kpol_365.3 s365 complement(2204..4177,4180..4206,4209..4874) [26...    61   1e-08
Smik_7.319 Chr7 complement(534132..535472) [1341 bp, 446 aa] {ON...    60   1e-08
SAKL0C06666g Chr3 complement(628448..630367) [1920 bp, 639 aa] {...    60   1e-08
Smik_15.415 Chr15 (722292..723815) [1524 bp, 507 aa] {ON} YOR231...    60   1e-08
Ecym_7473 Chr7 (963826..966045) [2220 bp, 739 aa] {ON} similar t...    60   1e-08
YJL164C Chr10 complement(109966..111159) [1194 bp, 397 aa] {ON} ...    60   1e-08
CAGL0M09361g Chr13 complement(928484..931918) [3435 bp, 1144 aa]...    61   1e-08
Kwal_23.6325 s23 complement(1533223..1537851) [4629 bp, 1542 aa]...    60   1e-08
TPHA0B00240 Chr2 complement(44468..46525) [2058 bp, 685 aa] {ON}...    60   1e-08
KLTH0C05478g Chr3 complement(471760..475254) [3495 bp, 1164 aa] ...    60   1e-08
KNAG0J02660 Chr10 (495011..497425) [2415 bp, 804 aa] {ON} Anc_1....    60   1e-08
Suva_16.97 Chr16 complement(165977..167083) [1107 bp, 368 aa] {O...    59   1e-08
ZYRO0G18502g Chr7 (1528075..1529265) [1191 bp, 396 aa] {ON} simi...    60   1e-08
Skud_10.50 Chr10 complement(84697..85890) [1194 bp, 397 aa] {ON}...    59   1e-08
ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic ho...    60   1e-08
SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa] ...    60   1e-08
Skud_2.406 Chr2 (718522..720105) [1584 bp, 527 aa] {ON} YBR274W ...    60   1e-08
Smik_4.745 Chr4 (1316457..1319201) [2745 bp, 914 aa] {ON} YDR466...    60   1e-08
TBLA0I02400 Chr9 complement(548975..554167) [5193 bp, 1730 aa] {...    60   1e-08
ZYRO0A07546g Chr1 complement(619278..620747,620833..620847) [148...    60   1e-08
Smik_10.66 Chr10 complement(108043..109236) [1194 bp, 397 aa] {O...    59   2e-08
Smik_3.94 Chr3 (128344..130155) [1812 bp, 603 aa] {ON} YCR008W (...    60   2e-08
Kpol_1018.54 s1018 (163688..166192) [2505 bp, 834 aa] {ON} (1636...    60   2e-08
KLLA0C08525g Chr3 (744554..749209) [4656 bp, 1551 aa] {ON} simil...    60   2e-08
KLTH0G06468g Chr7 complement(513119..518251) [5133 bp, 1710 aa] ...    60   2e-08
TBLA0F02350 Chr6 complement(578797..580467) [1671 bp, 556 aa] {O...    60   2e-08
SAKL0C07722g Chr3 (717419..720157) [2739 bp, 912 aa] {ON} simila...    60   2e-08
TDEL0C03710 Chr3 (653934..655169) [1236 bp, 411 aa] {ON} Anc_1.1...    59   2e-08
CAGL0M08404g Chr13 complement(836791..838179) [1389 bp, 462 aa] ...    59   2e-08
KNAG0C02250 Chr3 complement(444156..446639) [2484 bp, 827 aa] {O...    60   2e-08
SAKL0A01254g Chr1 (119884..124560) [4677 bp, 1558 aa] {ON} simil...    60   2e-08
TDEL0C03050 Chr3 (545862..549299) [3438 bp, 1145 aa] {ON} Anc_7....    60   2e-08
Skud_2.4 Chr2 complement(4805..8260) [3456 bp, 1151 aa] {ON} YBL...    60   2e-08
Ecym_8004 Chr8 complement(5273..7957) [2685 bp, 894 aa] {ON} sim...    60   2e-08
Skud_4.225 Chr4 complement(400160..401992) [1833 bp, 610 aa] {ON...    59   2e-08
CAGL0L07810g Chr12 complement(859653..861443) [1791 bp, 596 aa] ...    59   2e-08
TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON}               59   2e-08
SAKL0F13618g Chr6 (1085967..1089494) [3528 bp, 1175 aa] {ON} sim...    60   2e-08
KLTH0F05918g Chr6 complement(525566..527254) [1689 bp, 562 aa] {...    59   2e-08
NDAI0I00340 Chr9 (65047..70557) [5511 bp, 1836 aa] {ON} Anc_6.341      60   2e-08
TPHA0H02390 Chr8 (561244..563436) [2193 bp, 730 aa] {ON} Anc_6.3...    59   2e-08
YBL105C Chr2 complement(14241..17696) [3456 bp, 1151 aa] {ON}  P...    60   2e-08
NCAS0B01450 Chr2 (237824..239341) [1518 bp, 505 aa] {ON} Anc_8.652     59   2e-08
Suva_8.282 Chr8 (511665..513185) [1521 bp, 506 aa] {ON} YOR231W ...    59   2e-08
Skud_3.146 Chr3 complement(227229..231233) [4005 bp, 1334 aa] {O...    60   2e-08
AFL143C Chr6 complement(164241..165326) [1086 bp, 361 aa] {ON} S...    59   2e-08
Ecym_5588 Chr5 complement(1205102..1206943) [1842 bp, 613 aa] {O...    59   2e-08
KAFR0G00480 Chr7 complement(131066..132268) [1203 bp, 400 aa] {O...    59   2e-08
TPHA0F02870 Chr6 complement(636574..638259) [1686 bp, 561 aa] {O...    59   2e-08
TDEL0E03520 Chr5 (657779..659251) [1473 bp, 490 aa] {ON} Anc_5.2...    59   3e-08
Ecym_4652 Chr4 (1272725..1276156) [3432 bp, 1143 aa] {ON} simila...    59   3e-08
NDAI0B02900 Chr2 complement(737651..738709) [1059 bp, 352 aa] {O...    58   3e-08
Suva_4.535 Chr4 (921278..922861) [1584 bp, 527 aa] {ON} YBR274W ...    59   3e-08
TBLA0C03140 Chr3 (759258..760763) [1506 bp, 501 aa] {ON} Anc_5.2...    59   3e-08
NDAI0A07190 Chr1 (1636773..1638380) [1608 bp, 535 aa] {ON} Anc_3...    59   3e-08
KLTH0F04840g Chr6 complement(427194..428339) [1146 bp, 381 aa] {...    59   3e-08
KAFR0E01040 Chr5 complement(214744..216252) [1509 bp, 502 aa] {O...    59   3e-08
TBLA0C03180 Chr3 complement(770462..775468) [5007 bp, 1668 aa] {...    59   3e-08
KAFR0F01630 Chr6 complement(323802..326057) [2256 bp, 751 aa] {O...    59   3e-08
KNAG0M01450 Chr13 (254622..256061) [1440 bp, 479 aa] {ON}              59   3e-08
KAFR0F02220 Chr6 (432967..435210) [2244 bp, 747 aa] {ON} Anc_3.1...    59   3e-08
KAFR0K02450 Chr11 (504087..504131,504190..505680) [1536 bp, 511 ...    59   3e-08
KNAG0J01590 Chr10 (292565..294982) [2418 bp, 805 aa] {ON} Anc_8....    59   3e-08
Smik_2.13 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    59   3e-08
Smik_2.14 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    59   3e-08
KLLA0B11902g Chr2 (1041657..1043144) [1488 bp, 495 aa] {ON} unip...    59   3e-08
KAFR0C05860 Chr3 (1160586..1162520) [1935 bp, 644 aa] {ON} Anc_5...    59   3e-08
Skud_3.73 Chr3 (110742..112556) [1815 bp, 604 aa] {ON} YCR008W (...    59   3e-08
TDEL0D04600 Chr4 (843530..845917) [2388 bp, 795 aa] {ON} Anc_3.1...    59   3e-08
NCAS0A01100 Chr1 (218400..219464) [1065 bp, 354 aa] {ON}               58   3e-08
Kpol_448.13 s448 (25051..27063) [2013 bp, 670 aa] {ON} (25051..2...    59   3e-08
NDAI0D01620 Chr4 (386654..388132) [1479 bp, 492 aa] {ON} Anc_5.274     59   3e-08
YCR008W Chr3 (128470..130281) [1812 bp, 603 aa] {ON}  SAT4Ser/Th...    59   4e-08
KNAG0A06140 Chr1 (931737..933437) [1701 bp, 566 aa] {ON} Anc_2.4...    59   4e-08
SAKL0E04092g Chr5 complement(326532..327901,327970..327982) [138...    59   4e-08
TPHA0H00410 Chr8 (79426..82197) [2772 bp, 923 aa] {ON} Anc_8.141...    59   4e-08
KAFR0F01150 Chr6 complement(218711..219811) [1101 bp, 366 aa] {O...    58   4e-08
Suva_6.268 Chr6 (470348..472519) [2172 bp, 723 aa] {ON} YJL187C ...    59   4e-08
KLLA0B07205g Chr2 complement(624606..625973) [1368 bp, 455 aa] {...    58   4e-08
KLLA0D07348g Chr4 (626999..629728) [2730 bp, 909 aa] {ON} simila...    59   4e-08
TBLA0A01580 Chr1 complement(367370..369976) [2607 bp, 868 aa] {O...    59   4e-08
TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {O...    59   4e-08
ADR300C Chr4 complement(1222344..1225016) [2673 bp, 890 aa] {ON}...    59   4e-08
KNAG0G01250 Chr7 complement(280791..283364) [2574 bp, 857 aa] {O...    59   4e-08
TBLA0C00720 Chr3 (149299..151149) [1851 bp, 616 aa] {ON} Anc_1.4...    59   4e-08
TPHA0B01520 Chr2 complement(336164..339616) [3453 bp, 1150 aa] {...    59   5e-08
CAGL0J00539g Chr10 (47095..48561) [1467 bp, 488 aa] {ON} highly ...    58   5e-08
Skud_10.30 Chr10 complement(51698..54124) [2427 bp, 808 aa] {ON}...    59   5e-08
KNAG0K01240 Chr11 (243154..246096) [2943 bp, 980 aa] {ON} Anc_3....    59   5e-08
KNAG0D01140 Chr4 (192308..193495) [1188 bp, 395 aa] {ON}               58   5e-08
Kpol_1028.40 s1028 (95617..100392) [4776 bp, 1591 aa] {ON} (9561...    59   5e-08
YJL187C Chr10 complement(76803..79262) [2460 bp, 819 aa] {ON}  S...    59   5e-08
KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} simila...    58   5e-08
KLTH0H04180g Chr8 (381111..382172) [1062 bp, 353 aa] {ON} highly...    57   5e-08
Kpol_2002.75 s2002 complement(168123..169394) [1272 bp, 423 aa] ...    58   5e-08
Suva_4.411 Chr4 (729465..730361) [897 bp, 298 aa] {ON} YBR160W (...    57   5e-08
Kwal_14.1416 s14 (315842..316939) [1098 bp, 365 aa] {ON} YGR040W...    57   6e-08
Ecym_6136 Chr6 complement(248721..250187) [1467 bp, 488 aa] {ON}...    58   6e-08
KAFR0C02840 Chr3 (559821..560873) [1053 bp, 350 aa] {ON} Anc_8.1...    57   6e-08
SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} simila...    58   6e-08
TDEL0D02650 Chr4 complement(505536..506636) [1101 bp, 366 aa] {O...    57   6e-08
KNAG0C03830 Chr3 (751393..752877) [1485 bp, 494 aa] {ON} Anc_7.3...    58   6e-08
CAGL0K00693g Chr11 complement(75466..78096) [2631 bp, 876 aa] {O...    58   6e-08
KNAG0C01060 Chr3 complement(205965..207374) [1410 bp, 469 aa] {O...    58   6e-08
KAFR0F04340 Chr6 (848844..853628) [4785 bp, 1594 aa] {ON} Anc_6....    59   6e-08
Kpol_499.3 s499 complement(6075..7199) [1125 bp, 374 aa] {ON} co...    57   7e-08
Kpol_1037.52 s1037 complement(128841..130379) [1539 bp, 512 aa] ...    58   7e-08
KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {O...    58   7e-08
ZYRO0D03344g Chr4 complement(278347..280326) [1980 bp, 659 aa] {...    58   7e-08
KNAG0G02780 Chr7 complement(615058..617202) [2145 bp, 714 aa] {O...    58   7e-08
TPHA0M01840 Chr13 complement(380953..385818) [4866 bp, 1621 aa] ...    58   7e-08
TPHA0E02840 Chr5 (594381..595589) [1209 bp, 402 aa] {ON} Anc_6.2...    57   7e-08
Suva_2.11 Chr2 complement(17473..18858) [1386 bp, 461 aa] {ON} Y...    57   7e-08
CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa] ...    58   7e-08
TDEL0B04490 Chr2 (792559..793629) [1071 bp, 356 aa] {ON} Anc_8.1...    57   7e-08
AAL083W Chr1 (196774..201870) [5097 bp, 1698 aa] {ON} Syntenic h...    58   7e-08
KAFR0G01080 Chr7 complement(243965..247417) [3453 bp, 1150 aa] {...    58   7e-08
Kpol_1031.32 s1031 (76827..78821) [1995 bp, 664 aa] {ON} (76827....    58   7e-08
Suva_3.33 Chr3 (42176..44020) [1845 bp, 614 aa] {ON} YCR008W (REAL)    58   8e-08
Kpol_530.41 s530 (94710..96326) [1617 bp, 538 aa] {ON} (94710..9...    57   8e-08
Kpol_1037.6 s1037 (12601..15534) [2934 bp, 977 aa] {ON} (12601.....    58   8e-08
TPHA0J00630 Chr10 (139476..140600) [1125 bp, 374 aa] {ON} Anc_4....    57   8e-08
KLLA0C03938g Chr3 complement(358851..360632) [1782 bp, 593 aa] {...    58   8e-08
KLLA0C04213g Chr3 (386815..387999) [1185 bp, 394 aa] {ON} simila...    57   8e-08
AEL115C Chr5 complement(405062..406222) [1161 bp, 386 aa] {ON} S...    57   8e-08
CAGL0K06479g Chr11 (637125..640100) [2976 bp, 991 aa] {ON} some ...    58   8e-08
Skud_2.287 Chr2 (527443..528339) [897 bp, 298 aa] {ON} YBR160W (...    56   8e-08
ADR317C Chr4 complement(1263080..1265539) [2460 bp, 819 aa] {ON}...    58   8e-08
CAGL0C02893g Chr3 complement(286017..287966) [1950 bp, 649 aa] {...    58   8e-08
Smik_2.300 Chr2 (546211..547107) [897 bp, 298 aa] {ON} YBR160W (...    56   8e-08
NDAI0H03520 Chr8 (860096..861472) [1377 bp, 458 aa] {ON}               57   9e-08
TBLA0A08430 Chr1 complement(2075682..2076773) [1092 bp, 363 aa] ...    57   9e-08
TDEL0G02820 Chr7 complement(543911..545377,545450..545476) [1494...    57   9e-08
KNAG0C06060 Chr3 (1183766..1186654) [2889 bp, 962 aa] {ON} Anc_5...    58   9e-08
TPHA0H00760 Chr8 complement(152442..155384) [2943 bp, 980 aa] {O...    58   9e-08
Suva_7.334 Chr7 (568847..569956) [1110 bp, 369 aa] {ON} YGR052W ...    57   9e-08
Kpol_2001.46 s2001 (127016..129376) [2361 bp, 786 aa] {ON} (1270...    57   1e-07
Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477...    57   1e-07
NDAI0C04000 Chr3 (907842..912812) [4971 bp, 1656 aa] {ON} Anc_5....    58   1e-07
TDEL0H01070 Chr8 complement(192834..194624) [1791 bp, 596 aa] {O...    57   1e-07
Skud_6.89 Chr6 (166257..167594) [1338 bp, 446 aa] {ON} YFR014C (...    57   1e-07
Ecym_7414 Chr7 (848665..850440) [1776 bp, 591 aa] {ON} similar t...    57   1e-07
NDAI0E04610 Chr5 (1042690..1046154) [3465 bp, 1154 aa] {ON} Anc_...    57   1e-07
Skud_15.432 Chr15 complement(761490..763601) [2112 bp, 703 aa] {...    57   1e-07
Kwal_27.11919 s27 (1003201..1003827) [627 bp, 209 aa] {OFF} YBR1...    55   1e-07
Smik_10.45 Chr10 complement(74813..77278) [2466 bp, 821 aa] {ON}...    57   1e-07
TBLA0C01320 Chr3 complement(289223..290626) [1404 bp, 467 aa] {O...    57   1e-07
KLTH0D12166g Chr4 complement(987310..989061) [1752 bp, 583 aa] {...    57   1e-07
TDEL0E02510 Chr5 (486415..489156) [2742 bp, 913 aa] {ON} Anc_5.3...    57   1e-07
Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON} (1897...    57   1e-07
KNAG0G01430 Chr7 complement(322758..323822) [1065 bp, 354 aa] {O...    56   1e-07
KAFR0G01810 Chr7 (386620..389130) [2511 bp, 836 aa] {ON} Anc_1.2...    57   1e-07
KAFR0C04590 Chr3 complement(917915..922321) [4407 bp, 1468 aa] {...    57   1e-07
TPHA0E03300 Chr5 (703575..704912) [1338 bp, 445 aa] {ON} Anc_1.1...    57   1e-07
NDAI0G03030 Chr7 (704910..708269) [3360 bp, 1119 aa] {ON}              57   1e-07
TPHA0M00300 Chr13 (59377..61701) [2325 bp, 774 aa] {ON} Anc_3.16...    57   1e-07
YDL025C Chr4 complement(405344..407206) [1863 bp, 620 aa] {ON}  ...    57   1e-07
Ecym_5209 Chr5 complement(445530..448133) [2604 bp, 867 aa] {ON}...    57   1e-07
KLTH0A06776g Chr1 complement(562932..567503) [4572 bp, 1523 aa] ...    57   1e-07
Ecym_8129 Chr8 (269437..271626) [2190 bp, 729 aa] {ON} similar t...    57   1e-07
Ecym_5236 Chr5 (486270..488864) [2595 bp, 864 aa] {ON} similar t...    57   1e-07
NCAS0E03010 Chr5 (599358..602810) [3453 bp, 1150 aa] {ON} Anc_7....    57   1e-07
ZYRO0C13156g Chr3 complement(1041022..1042068) [1047 bp, 348 aa]...    56   1e-07
ZYRO0D08184g Chr4 (706856..711601) [4746 bp, 1581 aa] {ON} simil...    57   1e-07
KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {...    57   1e-07
KNAG0A06290 Chr1 (958438..960516) [2079 bp, 692 aa] {ON} Anc_2.4...    57   1e-07
CAGL0M10829g Chr13 complement(1076233..1081236) [5004 bp, 1667 a...    57   1e-07
Kwal_0.155 s0 (84856..86619) [1764 bp, 587 aa] {ON} YLR248W (RCK...    57   1e-07
TPHA0L01350 Chr12 (282034..283884) [1851 bp, 616 aa] {ON}              57   1e-07
ADR058C Chr4 complement(810939..811826) [888 bp, 295 aa] {ON} Sy...    55   1e-07
YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}  SNF1AMP-...    57   2e-07
Ecym_8095 Chr8 (205952..207106) [1155 bp, 384 aa] {ON} similar t...    56   2e-07
KAFR0C04280 Chr3 (848308..849912) [1605 bp, 534 aa] {ON} Anc_1.3...    57   2e-07
Ecym_2499 Chr2 complement(976395..981020) [4626 bp, 1541 aa] {ON...    57   2e-07
CAGL0G05720g Chr7 complement(547617..549833) [2217 bp, 738 aa] {...    57   2e-07
KLLA0A02497g Chr1 (218592..219680) [1089 bp, 362 aa] {ON} highly...    56   2e-07
YOR267C Chr15 complement(822588..824867) [2280 bp, 759 aa] {ON} ...    57   2e-07
ZYRO0G16082g Chr7 complement(1320266..1321714) [1449 bp, 482 aa]...    56   2e-07
SAKL0D06534g Chr4 complement(538606..540091,540155..540237) [156...    57   2e-07
TDEL0B01250 Chr2 complement(228145..229038) [894 bp, 297 aa] {ON...    55   2e-07
NCAS0A10290 Chr1 complement(2051582..2053111) [1530 bp, 509 aa] ...    56   2e-07
Ecym_7361 Chr7 complement(753862..755313) [1452 bp, 483 aa] {ON}...    56   2e-07
YNR031C Chr14 complement(680694..685433) [4740 bp, 1579 aa] {ON}...    57   2e-07
Kpol_1002.111 s1002 (277615..278664) [1050 bp, 349 aa] {ON} (277...    56   2e-07
Smik_15.449 Chr15 complement(772245..774437) [2193 bp, 730 aa] {...    57   2e-07
TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.6...    57   2e-07
SAKL0A04466g Chr1 (413816..414937) [1122 bp, 373 aa] {ON} highly...    56   2e-07
KNAG0D03980 Chr4 (721049..722170) [1122 bp, 373 aa] {ON} Anc_4.1...    56   2e-07
KAFR0E01490 Chr5 (298209..303167) [4959 bp, 1652 aa] {ON} Anc_5....    57   2e-07
SAKL0D05104g Chr4 (402641..404692) [2052 bp, 683 aa] {ON} simila...    57   2e-07
Suva_8.316 Chr8 complement(561812..563914) [2103 bp, 700 aa] {ON...    57   2e-07
KAFR0E03030 Chr5 (606567..607457) [891 bp, 296 aa] {ON} Anc_8.51...    55   2e-07
AER232C Chr5 complement(1066272..1067981) [1710 bp, 569 aa] {ON}...    56   2e-07
Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {...    56   2e-07
NCAS0A07990 Chr1 complement(1578473..1581346) [2874 bp, 957 aa] ...    57   2e-07
CAGL0I08349g Chr9 complement(813998..816001) [2004 bp, 667 aa] {...    56   2e-07
NCAS0B05560 Chr2 complement(1050313..1051371) [1059 bp, 352 aa] ...    55   2e-07
KNAG0H00560 Chr8 (89502..91268) [1767 bp, 588 aa] {ON} Anc_2.597...    56   2e-07
Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477...    56   2e-07
TBLA0B08650 Chr2 (2065061..2066308) [1248 bp, 415 aa] {ON} Anc_3...    56   2e-07
TBLA0F00860 Chr6 (219628..222570) [2943 bp, 980 aa] {ON} Anc_3.1...    57   2e-07
NDAI0C03900 Chr3 complement(883841..885310) [1470 bp, 489 aa] {O...    56   2e-07
CAGL0F04741g Chr6 (478256..479584) [1329 bp, 442 aa] {ON} simila...    56   2e-07
Kpol_1033.50 s1033 complement(126043..127197) [1155 bp, 384 aa] ...    55   2e-07
TBLA0D01200 Chr4 (303528..305198) [1671 bp, 556 aa] {ON} Anc_8.7...    56   2e-07
Ecym_4523 Chr4 (1039929..1042070) [2142 bp, 713 aa] {ON} similar...    56   2e-07
Kwal_26.8941 s26 complement(1014543..1016528) [1986 bp, 661 aa] ...    56   2e-07
Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477...    56   2e-07
ZYRO0B04906g Chr2 (395546..398089) [2544 bp, 847 aa] {ON} simila...    56   2e-07
NDAI0C05340 Chr3 (1236394..1237296) [903 bp, 300 aa] {ON}              55   2e-07
TPHA0G01450 Chr7 (297855..299861) [2007 bp, 668 aa] {ON}               56   3e-07
AFR076W Chr6 (564252..566714) [2463 bp, 820 aa] {ON} Syntenic ho...    56   3e-07
Suva_4.223 Chr4 complement(395869..397719) [1851 bp, 616 aa] {ON...    56   3e-07
ZYRO0F08778g Chr6 (702733..703626) [894 bp, 297 aa] {ON} highly ...    55   3e-07
NCAS0F02520 Chr6 (495799..500631) [4833 bp, 1610 aa] {ON} Anc_5....    56   3e-07
KAFR0K00330 Chr11 (74162..75283) [1122 bp, 373 aa] {ON} Anc_6.21...    55   3e-07
Ecym_5241 Chr5 complement(495748..497586) [1839 bp, 612 aa] {ON}...    56   3e-07
KAFR0E01810 Chr5 complement(372094..373524) [1431 bp, 476 aa] {O...    56   3e-07
TDEL0D03950 Chr4 (720229..721710) [1482 bp, 493 aa] {ON} Anc_3.2...    56   3e-07
SAKL0H10758g Chr8 complement(930403..931302) [900 bp, 299 aa] {O...    55   3e-07
Suva_2.105 Chr2 (186428..187489) [1062 bp, 353 aa] {ON} YBL016W ...    55   3e-07
YBR274W Chr2 (749594..751177) [1584 bp, 527 aa] {ON}  CHK1Serine...    56   3e-07
Kpol_1033.1 s1033 complement(1..828) [828 bp, 276 aa] {ON} compl...    55   3e-07
YDR283C Chr4 complement(1025070..1030049) [4980 bp, 1659 aa] {ON...    56   3e-07
TDEL0E05220 Chr5 complement(957515..958597) [1083 bp, 360 aa] {O...    55   3e-07
NDAI0E00960 Chr5 (195116..197251) [2136 bp, 711 aa] {ON} Anc_8.716     56   3e-07
TDEL0A06610 Chr1 complement(1151052..1152824) [1773 bp, 590 aa] ...    56   3e-07
Smik_2.417 Chr2 (735214..736797) [1584 bp, 527 aa] {ON} YBR274W ...    55   3e-07
Ecym_3547 Chr3 complement(1034494..1036107) [1614 bp, 537 aa] {O...    55   3e-07
NDAI0F01650 Chr6 (403635..404738) [1104 bp, 367 aa] {ON} Anc_6.214     55   3e-07
KLTH0F06468g Chr6 (559256..561769) [2514 bp, 837 aa] {ON} simila...    56   3e-07
Kwal_56.24059 s56 complement(829673..830734) [1062 bp, 353 aa] {...    55   3e-07
Smik_4.209 Chr4 complement(385530..386995,387230..387623) [1860 ...    56   3e-07
Skud_16.460 Chr16 complement(807116..809077) [1962 bp, 653 aa] {...    56   3e-07
KLLA0D03190g Chr4 (267933..269051) [1119 bp, 372 aa] {ON} highly...    55   3e-07
NCAS0B00420 Chr2 complement(54562..56718) [2157 bp, 718 aa] {ON}...    56   3e-07
KLLA0B09790g Chr2 complement(855327..856214) [888 bp, 295 aa] {O...    55   3e-07
Ecym_6092 Chr6 (178965..180299) [1335 bp, 444 aa] {ON} similar t...    55   3e-07
Ecym_6359 Chr6 complement(699564..702176) [2613 bp, 870 aa] {ON}...    56   3e-07
Suva_10.345 Chr10 (601536..603365) [1830 bp, 609 aa] {ON} YLR248...    55   3e-07
Ecym_2540 Chr2 (1048071..1049792) [1722 bp, 573 aa] {ON} similar...    55   3e-07
KAFR0C00930 Chr3 complement(186877..189687) [2811 bp, 936 aa] {O...    56   4e-07
KAFR0K02490 Chr11 (515669..518356) [2688 bp, 895 aa] {ON} Anc_5....    56   4e-07
Smik_4.532 Chr4 complement(956572..961554) [4983 bp, 1660 aa] {O...    56   4e-07
KLLA0F12188g Chr6 (1122745..1124385) [1641 bp, 546 aa] {ON} some...    55   4e-07
YFR014C Chr6 complement(172537..173877) [1341 bp, 446 aa] {ON}  ...    55   4e-07
TBLA0I01370 Chr9 complement(294202..296526) [2325 bp, 774 aa] {O...    55   4e-07
Kwal_26.7276 s26 (293129..295069) [1941 bp, 646 aa] {ON} YJL106W...    55   4e-07
SAKL0H05588g Chr8 (502752..504602) [1851 bp, 616 aa] {ON} simila...    55   4e-07
SAKL0G10978g Chr7 (929164..930729) [1566 bp, 521 aa] {ON} highly...    55   4e-07
Kpol_513.7 s513 (14160..15050) [891 bp, 296 aa] {ON} (14160..150...    54   4e-07
TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611...    55   4e-07
KLTH0D04356g Chr4 (405904..405987,406076..407401) [1410 bp, 469 ...    55   4e-07
YDL101C Chr4 complement(280307..281848) [1542 bp, 513 aa] {ON}  ...    55   4e-07
Smik_2.101 Chr2 (186008..187069) [1062 bp, 353 aa] {ON} YBL016W ...    55   4e-07
AFL217C Chr6 complement(30765..32840) [2076 bp, 691 aa] {ON} Syn...    55   5e-07
KLLA0E06447g Chr5 complement(577669..581154) [3486 bp, 1161 aa] ...    55   5e-07
Kpol_1064.31 s1064 complement(52651..54350) [1700 bp, 566.666666...    55   5e-07
Kpol_YGOB_1064.31 s1064 complement(52620..54350) [1731 bp, 577 a...    55   5e-07
Kwal_33.14192 s33 complement(563582..565315) [1734 bp, 577 aa] {...    55   5e-07
KLTH0G06974g Chr7 (556626..558125) [1500 bp, 499 aa] {ON} highly...    55   5e-07
SAKL0C07744g Chr3 (720519..721799) [1281 bp, 426 aa] {ON} simila...    55   5e-07
Suva_11.65 Chr11 complement(134606..136120) [1515 bp, 504 aa] {O...    55   5e-07
NDAI0B03190 Chr2 complement(815759..817309) [1551 bp, 516 aa] {O...    55   5e-07
TDEL0D04460 Chr4 complement(813075..815816) [2742 bp, 913 aa] {O...    55   5e-07
NCAS0B06000 Chr2 complement(1134919..1135808,1135909..1135957) [...    54   5e-07
NDAI0K01150 Chr11 complement(264377..266527) [2151 bp, 716 aa] {...    55   5e-07
TBLA0A10420 Chr1 (2562614..2564092) [1479 bp, 492 aa] {ON} Anc_5...    55   5e-07
SAKL0C08844g Chr3 (811712..813307) [1596 bp, 531 aa] {ON} simila...    55   5e-07
Kwal_17.2687 s17 complement(6084..7172) [1089 bp, 362 aa] {ON} Y...    54   6e-07
SAKL0C07458g Chr3 complement(687452..689395) [1944 bp, 647 aa] {...    55   6e-07
Smik_14.360 Chr14 complement(638655..643406) [4752 bp, 1583 aa] ...    55   6e-07
NDAI0G06150 Chr7 (1519393..1521780) [2388 bp, 795 aa] {ON} Anc_1...    55   6e-07
KLTH0E11396g Chr5 (1018348..1020069) [1722 bp, 573 aa] {ON} simi...    55   7e-07
TBLA0A08810 Chr1 (2161249..2162304) [1056 bp, 351 aa] {ON} Anc_8...    54   7e-07
KNAG0A03900 Chr1 complement(520500..521390) [891 bp, 296 aa] {ON...    54   7e-07
NCAS0A08610 Chr1 complement(1700839..1702704) [1866 bp, 621 aa] ...    55   7e-07
TPHA0D02740 Chr4 (566279..568819) [2541 bp, 846 aa] {ON} Anc_5.5...    55   7e-07
Smik_4.135 Chr4 complement(256861..258402) [1542 bp, 513 aa] {ON...    54   7e-07
KAFR0D04800 Chr4 complement(942369..944690) [2322 bp, 773 aa] {O...    55   7e-07
YBL016W Chr2 (192451..193512) [1062 bp, 353 aa] {ON}  FUS3Mitoge...    54   7e-07
KAFR0D03020 Chr4 (596365..598398) [2034 bp, 677 aa] {ON} Anc_2.4...    55   7e-07
KLTH0E11924g Chr5 (1059134..1060030) [897 bp, 298 aa] {ON} highl...    54   7e-07
TBLA0C06820 Chr3 (1645811..1647508) [1698 bp, 565 aa] {ON} Anc_5...    54   7e-07
Kwal_YGOB_27.11919 s27 (1003201..1003830,1004866..1005135) [900 ...    54   7e-07
Kwal_23.5576 s23 complement(1223517..1225031) [1515 bp, 504 aa] ...    54   7e-07
CAGL0K01661g Chr11 complement(147781..149229) [1449 bp, 482 aa] ...    54   8e-07
Suva_2.449 Chr2 complement(789612..794603) [4992 bp, 1663 aa] {O...    55   8e-07
KLTH0B06424g Chr2 complement(518184..520328) [2145 bp, 714 aa] {...    55   8e-07
Skud_2.90 Chr2 (176138..177199) [1062 bp, 353 aa] {ON} YBL016W (...    54   8e-07
Skud_14.362 Chr14 complement(648801..653540) [4740 bp, 1579 aa] ...    55   8e-07
NCAS0B02350 Chr2 complement(394128..395018) [891 bp, 296 aa] {ON...    54   8e-07
Suva_3.129 Chr3 (193311..194282) [972 bp, 323 aa] {ON} YCR091W (...    54   8e-07
Ecym_2566 Chr2 (1105239..1106126) [888 bp, 295 aa] {ON} similar ...    54   8e-07
Ecym_4266 Chr4 complement(564935..566329) [1395 bp, 464 aa] {ON}...    54   8e-07
Suva_13.481 Chr13 (834531..836279) [1749 bp, 582 aa] {ON} YMR291...    54   9e-07
TPHA0G02800 Chr7 (597211..598722) [1512 bp, 503 aa] {ON} Anc_2.4...    54   9e-07
TBLA0H03440 Chr8 (840759..841643) [885 bp, 294 aa] {ON} Anc_8.51...    53   9e-07
Kwal_26.8347 s26 complement(748254..750032) [1779 bp, 592 aa] {O...    54   9e-07
TBLA0D05010 Chr4 complement(1234934..1236238) [1305 bp, 434 aa] ...    54   9e-07
KLTH0G17512g Chr7 complement(1518329..1519426) [1098 bp, 365 aa]...    54   9e-07
Skud_4.154 Chr4 complement(275783..277324) [1542 bp, 513 aa] {ON...    54   9e-07
Kwal_26.7552 s26 (416444..417829) [1386 bp, 461 aa] {ON} YKL139W...    54   9e-07
TBLA0D02070 Chr4 complement(522456..523958) [1503 bp, 500 aa] {O...    54   1e-06
KLTH0H11396g Chr8 complement(973355..974668) [1314 bp, 437 aa] {...    54   1e-06
NCAS0C02390 Chr3 complement(446642..448468) [1827 bp, 608 aa] {O...    54   1e-06
CAGL0H10318g Chr8 complement(1006299..1007222) [924 bp, 307 aa] ...    53   1e-06
NDAI0D04050 Chr4 (952438..953538) [1101 bp, 366 aa] {ON} Anc_4.184     54   1e-06
Skud_4.146 Chr4 (263181..263196,263281..264173) [909 bp, 302 aa]...    53   1e-06
Smik_4.128 Chr4 (244339..244354,244439..245331) [909 bp, 302 aa]...    53   1e-06
Kwal_14.1273 s14 complement(259953..261200) [1248 bp, 415 aa] {O...    54   1e-06
Kwal_0.96 s0 complement(46082..47365) [1284 bp, 427 aa] {ON} YOL...    54   1e-06
Skud_13.465 Chr13 (826172..827929) [1758 bp, 585 aa] {ON} YMR291...    54   1e-06
KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]...    54   1e-06
TDEL0E01710 Chr5 complement(330667..332706) [2040 bp, 679 aa] {O...    54   1e-06
KLTH0E04334g Chr5 complement(391495..393723) [2229 bp, 742 aa] {...    54   1e-06
SAKL0G10384g Chr7 complement(883824..888848) [5025 bp, 1674 aa] ...    54   1e-06
ZYRO0F08272g Chr6 (668685..670508) [1824 bp, 607 aa] {ON} simila...    54   1e-06
TBLA0D00220 Chr4 (52218..54500) [2283 bp, 760 aa] {ON} Anc_2.96 ...    54   1e-06
Suva_14.385 Chr14 complement(661987..666732) [4746 bp, 1581 aa] ...    54   1e-06
YOL016C Chr15 complement(294777..296120) [1344 bp, 447 aa] {ON} ...    54   1e-06
Kwal_33.14167 s33 (554863..557379) [2517 bp, 838 aa] {ON} YDL028...    54   1e-06
SAKL0E03344g Chr5 (272024..273754) [1731 bp, 576 aa] {ON} simila...    54   1e-06
Suva_6.78 Chr6 (135988..137325) [1338 bp, 445 aa] {ON} YFR014C (...    54   1e-06
Kwal_27.11830 s27 (964584..966311) [1728 bp, 575 aa] {ON} YPL042...    54   1e-06
SAKL0C07348g Chr3 (677348..679933) [2586 bp, 861 aa] {ON} some s...    54   1e-06
TDEL0D02040 Chr4 (395555..397138) [1584 bp, 527 aa] {ON} Anc_1.3...    54   1e-06
TPHA0P01380 Chr16 (278259..279380) [1122 bp, 373 aa] {ON} Anc_3....    53   1e-06
KLTH0F18458g Chr6 complement(1491777..1493663) [1887 bp, 628 aa]...    54   1e-06
TPHA0O01400 Chr15 complement(277678..279258) [1581 bp, 526 aa] {...    54   1e-06
KLTH0E16126g Chr5 complement(1427208..1429814) [2607 bp, 868 aa]...    54   1e-06
Ecym_6307 Chr6 (578677..580227) [1551 bp, 516 aa] {ON} similar t...    54   1e-06
ZYRO0B09196g Chr2 complement(721019..722569) [1551 bp, 516 aa] {...    54   1e-06
ZYRO0E04246g Chr5 complement(322215..324035) [1821 bp, 606 aa] {...    54   1e-06
KLLA0F24618g Chr6 complement(2288943..2290613) [1671 bp, 556 aa]...    54   1e-06
ABR177C Chr2 complement(735829..738090) [2262 bp, 753 aa] {ON} S...    54   1e-06
AFL090W Chr6 (274336..275376) [1041 bp, 346 aa] {ON} Syntenic ho...    53   1e-06
Kwal_33.14554 s33 (717776..719920) [2145 bp, 714 aa] {ON} YNL161...    54   1e-06
YGR040W Chr7 (575398..576504) [1107 bp, 368 aa] {ON}  KSS1Mitoge...    53   1e-06
AGR048C Chr7 complement(807464..808825) [1362 bp, 453 aa] {ON} S...    53   2e-06
Smik_8.97 Chr8 complement(148421..149857) [1437 bp, 478 aa] {ON}...    53   2e-06
Ecym_6145 Chr6 complement(266766..267863) [1098 bp, 365 aa] {ON}...    53   2e-06
CAGL0E01683g Chr5 complement(166821..167948) [1128 bp, 375 aa] {...    53   2e-06
KNAG0F03410 Chr6 (640115..645094) [4980 bp, 1659 aa] {ON}              54   2e-06
Kpol_1050.13 s1050 (34788..36578) [1791 bp, 596 aa] {ON} (34788....    54   2e-06
KNAG0F03730 Chr6 complement(697517..699586) [2070 bp, 689 aa] {O...    54   2e-06
NCAS0D00630 Chr4 complement(107310..108593) [1284 bp, 427 aa] {O...    53   2e-06
ZYRO0G08844g Chr7 complement(711678..712766) [1089 bp, 362 aa] {...    53   2e-06
Kwal_23.5668 s23 (1263868..1268937) [5070 bp, 1689 aa] {ON} YDR2...    54   2e-06
NCAS0C03380 Chr3 complement(664012..665310) [1299 bp, 432 aa] {O...    53   2e-06
KLLA0F20053g Chr6 (1867209..1868543) [1335 bp, 444 aa] {ON} high...    53   2e-06
YHR030C Chr8 complement(168890..170344) [1455 bp, 484 aa] {ON}  ...    53   2e-06
SAKL0H16038g Chr8 complement(1401627..1402931) [1305 bp, 434 aa]...    53   2e-06
KLTH0D03080g Chr4 (295808..297730) [1923 bp, 640 aa] {ON} simila...    53   2e-06
YDL108W Chr4 (267698..267725,267807..268699) [921 bp, 306 aa] {O...    52   2e-06
Skud_8.86 Chr8 complement(149508..150953) [1446 bp, 481 aa] {ON}...    53   2e-06
NDAI0A06620 Chr1 complement(1510218..1512461) [2244 bp, 747 aa] ...    54   2e-06
NCAS0C03690 Chr3 (741930..744881) [2952 bp, 983 aa] {ON}               54   2e-06
Smik_15.153 Chr15 complement(261920..263248) [1329 bp, 442 aa] {...    53   2e-06
Kwal_56.23841 s56 (732202..733500) [1299 bp, 432 aa] {ON} YLR113...    53   2e-06
ZYRO0A03894g Chr1 (307915..309273) [1359 bp, 452 aa] {ON} simila...    53   2e-06
TDEL0B05820 Chr2 complement(1031136..1032863) [1728 bp, 575 aa] ...    53   2e-06
Suva_10.202 Chr10 (380079..381386) [1308 bp, 435 aa] {ON} YLR113...    53   2e-06
SAKL0H19668g Chr8 (1736301..1737674) [1374 bp, 457 aa] {ON} high...    53   2e-06
TPHA0A01630 Chr1 complement(328040..329347) [1308 bp, 435 aa] {O...    53   2e-06
YLR113W Chr12 (371620..372927) [1308 bp, 435 aa] {ON}  HOG1Mitog...    53   2e-06
NCAS0B08300 Chr2 (1582859..1584796) [1938 bp, 645 aa] {ON} Anc_1...    53   2e-06
NDAI0G05300 Chr7 (1289208..1290521) [1314 bp, 437 aa] {ON} Anc_1...    53   2e-06
NCAS0A09750 Chr1 (1940202..1942370) [2169 bp, 722 aa] {ON}             53   2e-06
Smik_12.173 Chr12 (351727..353034) [1308 bp, 435 aa] {ON} YLR113...    53   2e-06
TPHA0B03130 Chr2 complement(719624..721372) [1749 bp, 582 aa] {O...    53   2e-06
Ecym_2203 Chr2 (401590..402648) [1059 bp, 352 aa] {ON} similar t...    52   2e-06
ZYRO0D06182g Chr4 complement(529121..530416) [1296 bp, 431 aa] {...    53   2e-06
ABL055C Chr2 complement(295495..297105) [1611 bp, 536 aa] {ON} S...    53   2e-06
YPR161C Chr16 complement(864449..866422) [1974 bp, 657 aa] {ON} ...    53   2e-06
TBLA0H01330 Chr8 complement(297718..299163) [1446 bp, 481 aa] {O...    53   2e-06
TPHA0D01770 Chr4 (365255..370279) [5025 bp, 1674 aa] {ON} Anc_5....    53   2e-06
Skud_12.181 Chr12 (354407..355702) [1296 bp, 431 aa] {ON} YLR113...    53   2e-06
Ecym_6400 Chr6 complement(779716..781983) [2268 bp, 755 aa] {ON}...    53   2e-06
Smik_13.507 Chr13 (835298..837058) [1761 bp, 586 aa] {ON} YMR291...    53   2e-06
YMR291W Chr13 (852630..854390) [1761 bp, 586 aa] {ON}  TDA1Prote...    53   2e-06
TDEL0F00840 Chr6 (144884..146875) [1992 bp, 663 aa] {ON} Anc_2.9...    53   2e-06
Suva_4.138 Chr4 (256421..257197) [777 bp, 258 aa] {ON} YDL108W (...    52   2e-06
NDAI0B03310 Chr2 complement(844616..845557) [942 bp, 313 aa] {ON...    52   2e-06
NDAI0A04760 Chr1 complement(1088637..1090103) [1467 bp, 488 aa] ...    53   2e-06
KLTH0F06578g Chr6 complement(568519..570309) [1791 bp, 596 aa] {...    53   2e-06
Ecym_7206 Chr7 complement(423402..425576) [2175 bp, 724 aa] {ON}...    53   2e-06
KAFR0B00520 Chr2 (105553..107502) [1950 bp, 649 aa] {ON} Anc_4.1...    53   2e-06
Suva_4.145 Chr4 complement(268826..270370) [1545 bp, 514 aa] {ON...    53   3e-06
KLTH0G12738g Chr7 complement(1085500..1086804) [1305 bp, 434 aa]...    52   3e-06
KNAG0K01250 Chr11 (246241..247467) [1227 bp, 408 aa] {ON} Anc_3....    52   3e-06
CAGL0K01617g Chr11 complement(143308..145632) [2325 bp, 774 aa] ...    53   3e-06
Kpol_161.2 s161 complement(3125..4246) [1122 bp, 373 aa] {ON} co...    52   3e-06
NDAI0H02340 Chr8 complement(568767..570887) [2121 bp, 706 aa] {O...    53   3e-06
KLLA0A02717g Chr1 (245082..246380) [1299 bp, 432 aa] {ON} weakly...    52   3e-06
NCAS0A04360 Chr1 (880768..882822) [2055 bp, 684 aa] {ON} Anc_2.446     53   3e-06
ACL191C Chr3 complement(26475..27572) [1098 bp, 365 aa] {ON} Syn...    52   3e-06
NDAI0G05060 Chr7 complement(1227369..1229495) [2127 bp, 708 aa] ...    53   3e-06
KLLA0F01276g Chr6 complement(120001..121560) [1560 bp, 519 aa] {...    53   3e-06
TBLA0B03590 Chr2 (834488..837022) [2535 bp, 844 aa] {ON} Anc_8.7...    53   3e-06
KLTH0G18194g Chr7 (1570885..1572132) [1248 bp, 415 aa] {ON} weak...    52   3e-06
Kpol_1031.76 s1031 (193193..194923) [1731 bp, 576 aa] {ON} (1931...    52   3e-06
NDAI0B00400 Chr2 (74403..76643) [2241 bp, 746 aa] {ON} Anc_1.149       53   3e-06
ZYRO0F12122g Chr6 complement(984069..985910) [1842 bp, 613 aa] {...    52   3e-06
KNAG0I02830 Chr9 (549811..554358) [4548 bp, 1515 aa] {ON} Anc_1....    53   3e-06
CAGL0J04290g Chr10 complement(403542..404615) [1074 bp, 357 aa] ...    52   3e-06
TDEL0F04290 Chr6 (801456..802739) [1284 bp, 427 aa] {ON} Anc_8.3...    52   3e-06
Smik_6.125 Chr6 (201071..202177) [1107 bp, 368 aa] {ON} YGR040W ...    52   3e-06
TBLA0B07330 Chr2 complement(1745229..1746821,1746990..1747013) [...    52   3e-06
TPHA0B02440 Chr2 (560189..561592) [1404 bp, 467 aa] {ON} Anc_5.2...    52   3e-06
NDAI0A06630 Chr1 complement(1514165..1515943) [1779 bp, 592 aa] ...    52   3e-06
TPHA0H00750 Chr8 complement(150811..152043) [1233 bp, 410 aa] {O...    52   3e-06
Kwal_55.20326 s55 complement(351010..353262) [2253 bp, 750 aa] {...    52   3e-06
TPHA0F02150 Chr6 complement(475516..477768) [2253 bp, 750 aa] {O...    52   3e-06
CAGL0K03399g Chr11 complement(311316..313427) [2112 bp, 703 aa] ...    52   3e-06
AGL242C Chr7 complement(246896..247790,247838..247854) [912 bp, ...    52   3e-06
KAFR0B05410 Chr2 complement(1111152..1112771) [1620 bp, 539 aa] ...    52   3e-06
Kpol_1041.29 s1041 (73725..74876) [1152 bp, 383 aa] {ON} (73725....    52   3e-06
SAKL0D08294g Chr4 (692455..693966) [1512 bp, 503 aa] {ON} some s...    52   3e-06
ADR174C Chr4 complement(1008796..1010811) [2016 bp, 671 aa] {ON}...    52   3e-06
KNAG0G02300 Chr7 (528489..529748) [1260 bp, 419 aa] {ON} Anc_8.3...    52   3e-06
CAGL0G09020g Chr7 (860266..861351) [1086 bp, 361 aa] {ON} highly...    52   3e-06
TPHA0L01470 Chr12 (303604..304497) [894 bp, 297 aa] {ON} Anc_8.5...    51   3e-06
NDAI0G03920 Chr7 complement(934765..935889) [1125 bp, 374 aa] {O...    52   4e-06
CAGL0M11748g Chr13 (1168856..1170199) [1344 bp, 447 aa] {ON} hig...    52   4e-06
Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {...    52   4e-06
NDAI0E03080 Chr5 complement(653882..655798) [1917 bp, 638 aa] {O...    52   4e-06
TPHA0G00730 Chr7 (139442..141364) [1923 bp, 640 aa] {ON} Anc_8.7...    52   4e-06
NDAI0K01370 Chr11 (313672..315714) [2043 bp, 680 aa] {ON}              52   4e-06
TBLA0D05640 Chr4 (1380616..1383066) [2451 bp, 816 aa] {ON} Anc_1...    52   4e-06
AFL188C Chr6 complement(88793..90211) [1419 bp, 472 aa] {ON} Syn...    52   4e-06
NDAI0G02700 Chr7 complement(618268..619611) [1344 bp, 447 aa] {O...    52   4e-06
AFR372W Chr6 (1109169..1111493) [2325 bp, 774 aa] {ON} Syntenic ...    52   4e-06
AEL185C Chr5 complement(291129..292676) [1548 bp, 515 aa] {ON} S...    52   4e-06
NCAS0G02070 Chr7 (372747..374960) [2214 bp, 737 aa] {ON} Anc_2.96      52   4e-06
KLTH0H12650g Chr8 (1072961..1074592) [1632 bp, 543 aa] {ON} simi...    52   4e-06
Suva_6.208 Chr6 (369853..371880) [2028 bp, 675 aa] {ON} YJL128C ...    52   4e-06
YJL128C Chr10 complement(178097..180103) [2007 bp, 668 aa] {ON} ...    52   4e-06
KAFR0C03010 Chr3 (598970..601342) [2373 bp, 790 aa] {ON} Anc_8.1...    52   4e-06
ABL028W Chr2 (345953..348121) [2169 bp, 722 aa] {ON} Syntenic ho...    52   4e-06
CAGL0B04301g Chr2 (420544..422172) [1629 bp, 542 aa] {ON} simila...    52   4e-06
CAGL0F03707g Chr6 complement(359839..361665) [1827 bp, 608 aa] {...    52   4e-06
Skud_4.546 Chr4 complement(967636..972618) [4983 bp, 1660 aa] {O...    52   5e-06
Skud_14.172 Chr14 (323327..325564) [2238 bp, 745 aa] {ON} YNL161...    52   5e-06
Suva_11.99 Chr11 (192143..194197) [2055 bp, 684 aa] {ON} YMR104C...    52   5e-06
NDAI0B02500 Chr2 (625206..629036) [3831 bp, 1276 aa] {ON} Anc_8....    52   5e-06
KAFR0F03900 Chr6 (763094..764203) [1110 bp, 369 aa] {ON} Anc_4.1...    51   5e-06
SAKL0B05082g Chr2 (436707..438896) [2190 bp, 729 aa] {ON} simila...    52   5e-06
NCAS0A08880 Chr1 (1756271..1757539) [1269 bp, 422 aa] {ON} Anc_1...    52   5e-06
TDEL0E03300 Chr5 complement(621448..626409) [4962 bp, 1653 aa] {...    52   5e-06
Smik_16.420 Chr16 complement(725685..727658) [1974 bp, 657 aa] {...    52   5e-06
TPHA0C01780 Chr3 complement(407048..407965) [918 bp, 305 aa] {ON...    51   5e-06
ADL168C Chr4 complement(398517..399605) [1089 bp, 362 aa] {ON} S...    51   5e-06
Ecym_3160 Chr3 complement(304537..306957) [2421 bp, 806 aa] {ON}...    52   5e-06
Kpol_1072.1 s1072 (686..2683) [1998 bp, 665 aa] {ON} (686..2683)...    52   5e-06
KNAG0J01290 Chr10 complement(230493..232019) [1527 bp, 508 aa] {...    52   5e-06
CAGL0K04169g Chr11 (384567..385763) [1197 bp, 398 aa] {ON} simil...    51   5e-06
ZYRO0C02772g Chr3 (216325..217464) [1140 bp, 379 aa] {ON} highly...    51   5e-06
ZYRO0B04796g Chr2 (385611..387683) [2073 bp, 690 aa] {ON} simila...    52   5e-06
KLLA0E01585g Chr5 (149305..149370,149488..150960) [1539 bp, 512 ...    52   5e-06
Kpol_1031.67 s1031 (174170..175663) [1494 bp, 497 aa] {ON} (1741...    52   6e-06
ZYRO0G05214g Chr7 (420482..422980) [2499 bp, 832 aa] {ON} some s...    52   6e-06
Kpol_543.55 s543 (126256..127533) [1278 bp, 425 aa] {ON} (126256...    51   6e-06
Suva_7.325 Chr7 (550760..551866) [1107 bp, 368 aa] {ON} YGR040W ...    51   6e-06
Kwal_26.7682 s26 complement(470565..472121) [1557 bp, 518 aa] {O...    52   6e-06
KLLA0B12716g Chr2 (1109939..1112089) [2151 bp, 716 aa] {ON} simi...    52   6e-06
NCAS0J00960 Chr10 (157010..159121) [2112 bp, 703 aa] {ON}              52   6e-06
TBLA0A07770 Chr1 complement(1916632..1917939) [1308 bp, 435 aa] ...    51   6e-06
CAGL0D02002g Chr4 (207419..209080) [1662 bp, 553 aa] {ON} simila...    52   6e-06
KLLA0F23155g Chr6 (2157146..2158429) [1284 bp, 427 aa] {ON} simi...    51   6e-06
AFR035W Chr6 (498529..500688) [2160 bp, 719 aa] {ON} Syntenic ho...    52   6e-06
CAGL0J06072g Chr10 complement(574501..576822) [2322 bp, 773 aa] ...    52   6e-06
YKL048C Chr11 complement(347214..349136) [1923 bp, 640 aa] {ON} ...    52   7e-06
KNAG0J01700 Chr10 (309962..312424) [2463 bp, 820 aa] {ON}              52   7e-06
NCAS0F01460 Chr6 complement(290441..292465) [2025 bp, 674 aa] {O...    52   7e-06
Kwal_27.9763 s27 (54483..57089) [2607 bp, 868 aa] {ON} YAR019C (...    52   7e-06
SAKL0H11352g Chr8 complement(975064..976857) [1794 bp, 597 aa] {...    51   7e-06
AGL249C Chr7 complement(234347..236092) [1746 bp, 581 aa] {ON} S...    51   7e-06
AFR205C Chr6 complement(805580..806953) [1374 bp, 457 aa] {ON} S...    51   7e-06
Smik_14.167 Chr14 (311655..312284,312591..314228) [2268 bp, 755 ...    52   7e-06
ZYRO0D10252g Chr4 (860458..863109) [2652 bp, 883 aa] {ON} simila...    52   7e-06
Ecym_6196 Chr6 (364576..365652) [1077 bp, 358 aa] {ON} similar t...    51   7e-06
Kpol_1018.162 s1018 (414868..416904) [2037 bp, 678 aa] {ON} (414...    51   7e-06
TPHA0C04650 Chr3 complement(1006190..1007119) [930 bp, 309 aa] {...    50   7e-06
Ecym_2457 Chr2 (888054..890165) [2112 bp, 703 aa] {ON} similar t...    51   7e-06
YNL161W Chr14 (332597..334867) [2271 bp, 756 aa] {ON}  CBK1Serin...    51   8e-06
Skud_11.103 Chr11 (192587..194629) [2043 bp, 680 aa] {ON} YMR104...    51   8e-06
TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON} Anc_8...    51   8e-06
NDAI0H02930 Chr8 (715278..716846) [1569 bp, 522 aa] {ON} Anc_2.391     51   8e-06
NCAS0A02120 Chr1 (401097..402230) [1134 bp, 377 aa] {ON} Anc_4.184     50   9e-06
ZYRO0B07854g Chr2 complement(613992..616007) [2016 bp, 671 aa] {...    51   9e-06
Skud_4.176 Chr4 complement(308461..309594) [1134 bp, 377 aa] {ON...    50   9e-06
Ecym_2357 Chr2 (700079..701914) [1836 bp, 611 aa] {ON} similar t...    51   9e-06
CAGL0K04301g Chr11 (405248..406315) [1068 bp, 355 aa] {ON} simil...    50   9e-06
KAFR0B02980 Chr2 (623470..624804) [1335 bp, 444 aa] {ON} Anc_8.3...    51   9e-06
CAGL0L12650g Chr12 (1360085..1361788) [1704 bp, 567 aa] {ON} sim...    51   9e-06
YLR248W Chr12 (634252..636084) [1833 bp, 610 aa] {ON}  RCK2Prote...    51   9e-06
TDEL0A02220 Chr1 (402496..404565) [2070 bp, 689 aa] {ON} Anc_2.4...    51   9e-06
Skud_10.87 Chr10 complement(153140..155164) [2025 bp, 674 aa] {O...    51   9e-06
ABL011C Chr2 complement(378257..380362) [2106 bp, 701 aa] {ON} S...    51   9e-06
Smik_11.113 Chr11 (191688..193730) [2043 bp, 680 aa] {ON} YMR104...    51   1e-05
Skud_12.329 Chr12 (580813..582645) [1833 bp, 610 aa] {ON} YLR248...    51   1e-05
AER222C Chr5 complement(1043479..1044750) [1272 bp, 423 aa] {ON}...    50   1e-05
KAFR0I01570 Chr9 (330982..332574) [1593 bp, 530 aa] {ON} Anc_2.5...    51   1e-05
Kwal_0.307 s0 (145676..147145) [1470 bp, 490 aa] {OFF} YCR008W (...    51   1e-05
Suva_14.178 Chr14 (328862..331195) [2334 bp, 777 aa] {ON} YNL161...    51   1e-05
Kwal_YGOB_0.307 s0 (145676..147175) [1500 bp, 500 aa] {ON} ANNOT...    51   1e-05
Smik_10.106 Chr10 complement(175752..177776) [2025 bp, 674 aa] {...    51   1e-05
NDAI0F03200 Chr6 complement(770618..772924) [2307 bp, 768 aa] {O...    51   1e-05
AAL029W Chr1 (289989..291593) [1605 bp, 534 aa] {ON} Syntenic ho...    50   1e-05
YKL161C Chr11 complement(149386..150687) [1302 bp, 433 aa] {ON} ...    50   1e-05
Smik_12.321 Chr12 (579087..580919) [1833 bp, 610 aa] {ON} YLR248...    51   1e-05
NDAI0H01020 Chr8 complement(225366..228566) [3201 bp, 1066 aa] {...    51   1e-05
KLTH0F18942g Chr6 (1535941..1537032) [1092 bp, 363 aa] {ON} high...    50   1e-05
Skud_15.144 Chr15 complement(254620..255969) [1350 bp, 449 aa] {...    50   1e-05
AAR009W Chr1 (358947..360308) [1362 bp, 453 aa] {ON} Syntenic ho...    50   1e-05
Kwal_55.22001 s55 (1069907..1070998) [1092 bp, 363 aa] {ON} YNL3...    50   1e-05
ZYRO0G20306g Chr7 complement(1675578..1677227) [1650 bp, 549 aa]...    50   1e-05
TBLA0J00250 Chr10 (42058..44457) [2400 bp, 799 aa] {ON} Anc_7.51...    51   1e-05
KLLA0B13112g Chr2 complement(1146006..1148198) [2193 bp, 730 aa]...    51   1e-05
TBLA0D02730 Chr4 complement(674994..676427) [1434 bp, 477 aa] {O...    50   1e-05
Suva_11.86 Chr11 (169096..170685) [1590 bp, 529 aa] {ON} YKL139W...    50   1e-05
NCAS0H03070 Chr8 complement(590494..592440) [1947 bp, 648 aa] {O...    50   1e-05
ZYRO0G02530g Chr7 (194463..196577) [2115 bp, 704 aa] {ON} highly...    50   1e-05
ADR253W Chr4 (1141941..1143083) [1143 bp, 380 aa] {ON} Syntenic ...    50   1e-05
Suva_2.157 Chr2 complement(275484..277064) [1581 bp, 526 aa] {ON...    50   1e-05
KLLA0E07437g Chr5 complement(672690..673787) [1098 bp, 365 aa] {...    50   1e-05
ZYRO0G17094g Chr7 complement(1404552..1406804) [2253 bp, 750 aa]...    50   1e-05
TBLA0B01990 Chr2 complement(458264..461623) [3360 bp, 1119 aa] {...    51   1e-05
Skud_7.337 Chr7 (562750..563856) [1107 bp, 368 aa] {ON} YGR040W ...    50   1e-05
NCAS0C03560 Chr3 complement(710551..712476) [1926 bp, 641 aa] {O...    50   1e-05
AFR019W Chr6 (471481..472560) [1080 bp, 359 aa] {ON} Syntenic ho...    50   1e-05
CAGL0K11550g Chr11 (1118971..1120587) [1617 bp, 538 aa] {ON} sim...    50   1e-05
YKL126W Chr11 (205707..207749) [2043 bp, 680 aa] {ON}  YPK1Serin...    50   1e-05
Suva_16.491 Chr16 complement(848824..850794) [1971 bp, 656 aa] {...    50   1e-05
TPHA0O01620 Chr15 (321912..324359) [2448 bp, 815 aa] {ON} Anc_2....    50   1e-05
NCAS0B07380 Chr2 complement(1396315..1397898) [1584 bp, 527 aa] ...    50   1e-05
KLLA0D08415g Chr4 (714473..716797) [2325 bp, 774 aa] {ON} simila...    50   1e-05
KLLA0C07535g Chr3 (658746..660620) [1875 bp, 624 aa] {ON} some s...    50   1e-05
NCAS0C04540 Chr3 complement(929920..931056) [1137 bp, 378 aa] {O...    50   2e-05
Kpol_513.17 s513 (49097..50824) [1728 bp, 575 aa] {ON} (49097..5...    50   2e-05
ZYRO0A07062g Chr1 (576600..576615,576675..577561) [903 bp, 300 a...    49   2e-05
NCAS0A15040 Chr1 complement(2962030..2964036) [2007 bp, 668 aa] ...    50   2e-05
Ecym_2042 Chr2 complement(67312..68397) [1086 bp, 361 aa] {ON} s...    50   2e-05
TPHA0G02090 Chr7 complement(429178..430527) [1350 bp, 449 aa] {O...    50   2e-05
Kpol_529.18 s529 (52782..55118) [2337 bp, 778 aa] {ON} (52782..5...    50   2e-05
Smik_11.97 Chr11 (168854..170491) [1638 bp, 545 aa] {ON} YKL139W...    50   2e-05
AEL173W Chr5 (313261..314856) [1596 bp, 531 aa] {ON} Syntenic ho...    50   2e-05
Ecym_2531 Chr2 (1034031..1034047,1034135..1035023) [906 bp, 301 ...    49   2e-05
Ecym_6056 Chr6 complement(107449..108888) [1440 bp, 479 aa] {ON}...    50   2e-05
KAFR0C00920 Chr3 complement(185475..186674) [1200 bp, 399 aa] {O...    50   2e-05
Kpol_1055.25 s1055 complement(62930..67933) [5004 bp, 1667 aa] {...    50   2e-05
NCAS0I02060 Chr9 (386630..388573) [1944 bp, 647 aa] {ON} Anc_3.1...    50   2e-05
SAKL0E12342g Chr5 complement(1021369..1023795) [2427 bp, 808 aa]...    50   2e-05
Kpol_534.14 s534 (34465..34591,34724..35616) [1020 bp, 339 aa] {...    49   2e-05
KAFR0B01510 Chr2 complement(284425..286092) [1668 bp, 555 aa] {O...    50   2e-05
Suva_11.178 Chr11 complement(330253..332184) [1932 bp, 643 aa] {...    50   2e-05
KLLA0D10527g Chr4 (892955..894892) [1938 bp, 645 aa] {ON} simila...    50   2e-05
TDEL0D04560 Chr4 (835822..837885) [2064 bp, 687 aa] {ON} Anc_3.1...    50   2e-05
KNAG0E01390 Chr5 (275055..276776) [1722 bp, 573 aa] {ON} Anc_1.4...    50   2e-05
Suva_15.216 Chr15 complement(376197..377624) [1428 bp, 475 aa] {...    50   2e-05
ZYRO0A05192g Chr1 complement(416951..418198) [1248 bp, 415 aa] {...    50   2e-05
TBLA0B09740 Chr2 (2312062..2314815) [2754 bp, 917 aa] {ON} Anc_2...    50   2e-05
TDEL0A02010 Chr1 (365325..366782) [1458 bp, 485 aa] {ON} Anc_2.4...    50   2e-05
TDEL0C03740 Chr3 (658468..660702) [2235 bp, 744 aa] {ON} Anc_1.1...    50   2e-05
NCAS0C01110 Chr3 (207664..209664) [2001 bp, 666 aa] {ON} Anc_8.716     50   2e-05
KAFR0A06790 Chr1 complement(1371892..1372806) [915 bp, 304 aa] {...    49   2e-05
CAGL0B02739g Chr2 complement(262590..264620) [2031 bp, 676 aa] {...    50   2e-05
Suva_13.281 Chr13 complement(455094..457136) [2043 bp, 680 aa] {...    50   2e-05
TPHA0C02880 Chr3 (623723..624778) [1056 bp, 351 aa] {ON} Anc_8.1...    49   2e-05
ZYRO0A12826g Chr1 (1014651..1015751) [1101 bp, 366 aa] {ON} high...    49   2e-05
ZYRO0G18546g Chr7 (1530693..1533050) [2358 bp, 785 aa] {ON} simi...    50   2e-05
TDEL0B01470 Chr2 complement(257397..259169) [1773 bp, 590 aa] {O...    50   2e-05
KLLA0D11814g Chr4 complement(1007240..1009021) [1782 bp, 593 aa]...    50   2e-05
CAGL0K07458g Chr11 complement(737165..739279) [2115 bp, 704 aa] ...    50   2e-05
NDAI0B00220 Chr2 (29825..32470) [2646 bp, 881 aa] {ON} Anc_1.180       50   2e-05
SAKL0D07656g Chr4 complement(627469..628767) [1299 bp, 432 aa] {...    49   2e-05
SAKL0F15510g Chr6 complement(1251475..1253373) [1899 bp, 632 aa]...    50   2e-05
KLLA0E10539g Chr5 (929989..931104) [1116 bp, 371 aa] {ON} highly...    49   2e-05
KAFR0D02900 Chr4 (575853..577313) [1461 bp, 486 aa] {ON} Anc_7.5...    49   3e-05
ZYRO0F03014g Chr6 complement(255189..260003) [4815 bp, 1604 aa] ...    50   3e-05
YNL307C Chr14 complement(56446..57573) [1128 bp, 375 aa] {ON}  M...    49   3e-05
KAFR0C01720 Chr3 (351078..352208) [1131 bp, 376 aa] {ON} Anc_3.4...    49   3e-05
TBLA0A08290 Chr1 complement(2039328..2041376) [2049 bp, 682 aa] ...    49   3e-05
YKL116C Chr11 complement(221344..222900) [1557 bp, 518 aa] {ON} ...    49   3e-05
Skud_14.32 Chr14 complement(49930..51057) [1128 bp, 375 aa] {ON}...    49   3e-05
ZYRO0F07370g Chr6 (595931..598219) [2289 bp, 762 aa] {ON} simila...    49   3e-05
KLLA0D07810g Chr4 complement(669095..671251) [2157 bp, 718 aa] {...    49   3e-05
SAKL0C12870g Chr3 (1145051..1146142) [1092 bp, 363 aa] {ON} high...    49   3e-05
AEL118C Chr5 complement(399738..401789) [2052 bp, 683 aa] {ON} S...    49   3e-05
YDL079C Chr4 complement(312951..314044,314337..314748) [1506 bp,...    49   3e-05
KAFR0A07370 Chr1 complement(1487868..1490012) [2145 bp, 714 aa] ...    49   3e-05
CAGL0M13167g Chr13 complement(1293074..1294906) [1833 bp, 610 aa...    49   3e-05
Kwal_56.22788 s56 complement(281404..282951) [1548 bp, 515 aa] {...    49   3e-05
SAKL0E03608g Chr5 complement(291806..294007) [2202 bp, 733 aa] {...    49   3e-05
YKL168C Chr11 complement(131288..133462) [2175 bp, 724 aa] {ON} ...    49   3e-05
KAFR0G00440 Chr7 (124896..127328) [2433 bp, 810 aa] {ON} Anc_1.1...    49   3e-05
CAGL0H01199g Chr8 (110610..115556) [4947 bp, 1648 aa] {ON} highl...    49   4e-05
TPHA0A04170 Chr1 (937692..939233) [1542 bp, 513 aa] {ON} Anc_3.2...    49   4e-05
TPHA0G02910 Chr7 (624676..626727) [2052 bp, 683 aa] {ON} Anc_2.4...    49   4e-05
KLLA0E11947g Chr5 complement(1060048..1061892) [1845 bp, 614 aa]...    49   4e-05
Smik_14.24 Chr14 complement(40883..42010) [1128 bp, 375 aa] {ON}...    49   4e-05
NDAI0C03610 Chr3 (829317..831476) [2160 bp, 719 aa] {ON} Anc_5.38      49   4e-05
Ecym_6294 Chr6 complement(551351..552982) [1632 bp, 543 aa] {ON}...    49   4e-05
KNAG0F01440 Chr6 (261403..263685) [2283 bp, 760 aa] {ON}               49   4e-05
Suva_14.32 Chr14 complement(52757..53884) [1128 bp, 375 aa] {ON}...    49   4e-05
SAKL0D06666g Chr4 (551260..552522) [1263 bp, 420 aa] {ON} some s...    49   4e-05
Kwal_55.21900 s55 complement(1027253..1029130) [1878 bp, 625 aa]...    49   4e-05
KLTH0D04818g Chr4 (439491..441566) [2076 bp, 691 aa] {ON} simila...    49   4e-05
NCAS0A09570 Chr1 complement(1907017..1909200) [2184 bp, 727 aa] ...    49   4e-05
NCAS0B05910 Chr2 (1120092..1121645) [1554 bp, 517 aa] {ON} Anc_2...    49   4e-05
KNAG0A02220 Chr1 complement(198240..199979) [1740 bp, 579 aa] {O...    49   4e-05
KLTH0D05082g Chr4 complement(457124..458680) [1557 bp, 518 aa] {...    49   4e-05
Kwal_26.7635 s26 (451306..453381) [2076 bp, 691 aa] {ON} YKL126W...    49   4e-05
Ecym_1502 Chr1 (1030765..1031838) [1074 bp, 357 aa] {ON} similar...    48   4e-05
TDEL0D04450 Chr4 complement(811665..812924) [1260 bp, 419 aa] {O...    49   5e-05
TDEL0A00600 Chr1 complement(101753..102877) [1125 bp, 374 aa] {O...    48   5e-05
KAFR0A04070 Chr1 complement(817388..819325) [1938 bp, 645 aa] {O...    49   5e-05
AFR150C Chr6 complement(707303..708352) [1050 bp, 349 aa] {ON} S...    48   5e-05
KNAG0C01040 Chr3 complement(203429..204976) [1548 bp, 515 aa] {O...    49   5e-05
Smik_4.157 Chr4 complement(289446..290605,290830..291250) [1581 ...    49   5e-05
KLTH0H10318g Chr8 complement(888661..890128,890228..890316) [155...    49   5e-05
Kwal_33.13222 s33 (127342..127788) [447 bp, 148 aa] {OFF} YDR507...    46   5e-05
TPHA0O01030 Chr15 complement(191875..193890) [2016 bp, 671 aa] {...    49   5e-05
KLLA0C14278g Chr3 (1240990..1242615) [1626 bp, 541 aa] {ON} simi...    49   5e-05
NCAS0D00710 Chr4 (122875..124737) [1863 bp, 620 aa] {ON}               49   5e-05
KNAG0A05580 Chr1 (830643..831560) [918 bp, 305 aa] {ON} Anc_2.33...    48   5e-05
KLLA0E14785g Chr5 complement(1323743..1324675) [933 bp, 310 aa] ...    48   5e-05
KLTH0F04730g Chr6 complement(417013..419133) [2121 bp, 706 aa] {...    49   5e-05
Smik_2.146 Chr2 complement(275270..276850) [1581 bp, 526 aa] {ON...    49   6e-05
YMR104C Chr13 complement(473420..475453) [2034 bp, 677 aa] {ON} ...    49   6e-05
TBLA0E04970 Chr5 (1272310..1273944) [1635 bp, 544 aa] {ON} Anc_4...    49   6e-05
NCAS0C02470 Chr3 complement(460460..461378,461483..461499) [936 ...    48   6e-05
KNAG0C02430 Chr3 complement(472213..474804) [2592 bp, 863 aa] {O...    49   6e-05
TDEL0C00590 Chr3 complement(94223..99031) [4809 bp, 1602 aa] {ON...    49   6e-05
NDAI0E01960 Chr5 (397897..399717) [1821 bp, 606 aa] {ON} Anc_2.425     49   6e-05
Kpol_1037.7 s1037 (15938..17182) [1245 bp, 414 aa] {ON} (15938.....    48   6e-05
TBLA0A01660 Chr1 complement(391368..392828) [1461 bp, 486 aa] {O...    48   6e-05
Smik_4.25 Chr4 complement(52454..54547) [2094 bp, 697 aa] {ON} Y...    49   6e-05
Ecym_8098 Chr8 (210698..212857) [2160 bp, 719 aa] {ON} similar t...    49   6e-05
KAFR0H01460 Chr8 complement(269957..271705) [1749 bp, 582 aa] {O...    48   6e-05
Kpol_185.2 s185 complement(1614..3704) [2091 bp, 696 aa] {ON} co...    49   6e-05
Kpol_487.14 s487 complement(56520..58394) [1875 bp, 624 aa] {ON}...    48   6e-05
CAGL0L07326g Chr12 (810529..812049) [1521 bp, 506 aa] {ON} simil...    48   7e-05
KNAG0I01480 Chr9 (287733..289055) [1323 bp, 440 aa] {ON} Anc_1.3...    48   7e-05
ABL143C Chr2 complement(128215..130392) [2178 bp, 725 aa] {ON} S...    48   7e-05
Kpol_1056.20 s1056 complement(44529..46724) [2196 bp, 731 aa] {O...    48   7e-05
KAFR0A01340 Chr1 (259300..261171) [1872 bp, 623 aa] {ON} Anc_1.2...    48   7e-05
TPHA0O01080 Chr15 complement(205407..207653) [2247 bp, 748 aa] {...    48   7e-05
Skud_10.107 Chr10 (189314..191254) [1941 bp, 646 aa] {ON} YJL106...    48   7e-05
Suva_6.182 Chr6 complement(328699..330642) [1944 bp, 647 aa] {ON...    48   7e-05
ZYRO0E05588g Chr5 (430271..431686) [1416 bp, 471 aa] {ON} simila...    48   8e-05
ZYRO0C09768g Chr3 (740592..742925) [2334 bp, 777 aa] {ON} simila...    48   8e-05
KAFR0I02440 Chr9 complement(493668..495128) [1461 bp, 486 aa] {O...    48   8e-05
Kwal_33.13831 s33 complement(413256..415358) [2103 bp, 700 aa] {...    48   8e-05
Suva_16.286 Chr16 complement(495354..496254,496351..496367) [918...    47   9e-05
TPHA0H01880 Chr8 (441140..442402) [1263 bp, 420 aa] {ON} Anc_6.2...    47   9e-05
Smik_13.290 Chr13 complement(457921..459951) [2031 bp, 676 aa] {...    48   9e-05
NDAI0J01990 Chr10 (491491..493758) [2268 bp, 755 aa] {ON} Anc_4....    48   9e-05
Skud_16.251 Chr16 complement(457106..458006,458108..458124) [918...    47   9e-05
KLLA0F17006g Chr6 complement(1561859..1563106) [1248 bp, 415 aa]...    47   9e-05
Ecym_1508 Chr1 (1045857..1050941) [5085 bp, 1694 aa] {ON} simila...    48   9e-05
YJL106W Chr10 (221390..223327) [1938 bp, 645 aa] {ON}  IME2Serin...    48   9e-05
KAFR0H01570 Chr8 complement(290698..291897) [1200 bp, 399 aa] {O...    47   9e-05
Kpol_463.19 s463 complement(53246..55561) [2316 bp, 771 aa] {ON}...    48   9e-05
KAFR0H01530 Chr8 complement(283589..284509) [921 bp, 306 aa] {ON...    47   9e-05
Skud_11.88 Chr11 (169115..170659) [1545 bp, 514 aa] {ON} YKL139W...    47   1e-04
Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556...    48   1e-04
KLLA0A06820g Chr1 complement(615686..618004) [2319 bp, 772 aa] {...    48   1e-04
Skud_11.56 Chr11 complement(117617..119776) [2160 bp, 719 aa] {O...    48   1e-04
Kpol_1033.55 s1033 (138831..140555,140557..140895) [2064 bp, 687...    48   1e-04
AER195C Chr5 complement(1005431..1006945) [1515 bp, 504 aa] {ON}...    47   1e-04
Skud_13.262 Chr13 complement(448758..450791) [2034 bp, 677 aa] {...    48   1e-04
ZYRO0D07502g Chr4 complement(652782..654320) [1539 bp, 512 aa] {...    47   1e-04
TPHA0L01240 Chr12 (263357..264814) [1458 bp, 485 aa] {ON} Anc_8....    47   1e-04
KNAG0A02310 Chr1 complement(216545..217453) [909 bp, 302 aa] {ON...    47   1e-04
TPHA0I03100 Chr9 complement(681645..683666) [2022 bp, 673 aa] {O...    47   1e-04
YKL139W Chr11 (182958..184544) [1587 bp, 528 aa] {ON}  CTK1Catal...    47   1e-04
CAGL0F03245g Chr6 complement(316924..320034) [3111 bp, 1036 aa] ...    47   1e-04
CAGL0K10604g Chr11 complement(1030055..1031395) [1341 bp, 446 aa...    47   1e-04
Skud_11.181 Chr11 complement(326935..328845) [1911 bp, 636 aa] {...    47   1e-04
CAGL0B03509g Chr2 complement(349638..351431) [1794 bp, 597 aa] {...    47   1e-04
YPL031C Chr16 complement(492018..492918,493021..493037) [918 bp,...    47   1e-04
KNAG0A01330 Chr1 complement(34784..35977) [1194 bp, 397 aa] {ON}...    47   1e-04
SAKL0D09240g Chr4 (764130..765761) [1632 bp, 543 aa] {ON} some s...    47   1e-04
NDAI0G05190 Chr7 complement(1258638..1260452) [1815 bp, 604 aa] ...    47   1e-04
YBR028C Chr2 complement(294425..296002) [1578 bp, 525 aa] {ON}  ...    47   1e-04
KLLA0E12145g Chr5 (1080245..1081612) [1368 bp, 455 aa] {ON} simi...    47   1e-04
KNAG0B01670 Chr2 (307587..309860) [2274 bp, 757 aa] {ON} Anc_1.2...    47   1e-04
Ecym_4448 Chr4 complement(917136..918872) [1737 bp, 578 aa] {ON}...    47   2e-04
TPHA0D00360 Chr4 complement(55596..60206) [4611 bp, 1536 aa] {ON...    47   2e-04
Kpol_2001.30 s2001 (87817..90093) [2277 bp, 758 aa] {ON} (87817....    47   2e-04
NDAI0E03170 Chr5 complement(677441..678392,678524..678543) [972 ...    46   2e-04
Smik_14.147 Chr14 complement(272373..274742) [2370 bp, 789 aa] {...    47   2e-04
Kpol_1033.63 s1033 complement(158652..160205) [1554 bp, 517 aa] ...    47   2e-04
KLTH0B07106g Chr2 (571005..573260) [2256 bp, 751 aa] {ON} simila...    47   2e-04
SAKL0H11638g Chr8 complement(994049..994946,995016..995032) [915...    46   2e-04
NDAI0G03110 Chr7 complement(725984..731107) [5124 bp, 1707 aa] {...    47   2e-04
TBLA0C02310 Chr3 complement(546887..548596) [1710 bp, 569 aa] {O...    47   2e-04
KNAG0B05880 Chr2 (1155395..1157695) [2301 bp, 766 aa] {ON} Anc_4...    47   2e-04
KLLA0F02838g Chr6 (264329..266596) [2268 bp, 755 aa] {ON} simila...    47   2e-04
Kpol_1045.46 s1045 complement(106567..108372) [1806 bp, 601 aa] ...    47   2e-04
TBLA0D04420 Chr4 complement(1097314..1099356) [2043 bp, 680 aa] ...    47   2e-04
KLLA0B06501g Chr2 complement(576636..579089) [2454 bp, 817 aa] {...    47   2e-04
TPHA0B01010 Chr2 complement(229538..231634) [2097 bp, 698 aa] {O...    47   2e-04
CAGL0M08360g Chr13 complement(833220..835520) [2301 bp, 766 aa] ...    47   2e-04
KLTH0E11220g Chr5 (1005953..1005969,1006040..1006931) [909 bp, 3...    46   2e-04
Suva_4.33 Chr4 complement(63334..65427) [2094 bp, 697 aa] {ON} Y...    47   2e-04
Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON} ...    47   2e-04
TBLA0I01800 Chr9 complement(401728..403617) [1890 bp, 629 aa] {O...    47   2e-04
KNAG0C01820 Chr3 (355604..357376) [1773 bp, 590 aa] {ON}               47   2e-04
NDAI0J00420 Chr10 (73312..75606) [2295 bp, 764 aa] {ON} Anc_7.515      47   2e-04
Kpol_1042.20 s1042 (45090..47261) [2172 bp, 723 aa] {ON} (45090....    47   2e-04
KAFR0A06190 Chr1 complement(1251546..1253690) [2145 bp, 714 aa] ...    47   2e-04
KLTH0E16104g Chr5 complement(1425822..1427042) [1221 bp, 406 aa]...    46   2e-04
Smik_10.132 Chr10 (212933..214873) [1941 bp, 646 aa] {ON} YJL106...    47   2e-04
SAKL0H01364g Chr8 complement(143450..145141) [1692 bp, 563 aa] {...    47   2e-04
ADR033W Chr4 (764716..766449) [1734 bp, 577 aa] {ON} Syntenic ho...    47   2e-04
NDAI0B04700 Chr2 complement(1164332..1165918) [1587 bp, 528 aa] ...    46   2e-04
ADL283W Chr4 (205173..205197,205250..206145) [921 bp, 306 aa] {O...    46   2e-04
CAGL0G04455g Chr7 (426386..428641) [2256 bp, 751 aa] {ON} simila...    47   2e-04
Suva_16.274 Chr16 complement(476249..477916) [1668 bp, 555 aa] {...    46   2e-04
TBLA0B00770 Chr2 complement(168444..170519) [2076 bp, 691 aa] {O...    46   2e-04
KAFR0G00460 Chr7 complement(128077..130023) [1947 bp, 648 aa] {O...    46   2e-04
NDAI0A00940 Chr1 complement(193710..195800) [2091 bp, 696 aa] {O...    46   3e-04
TBLA0H02950 Chr8 complement(721123..723906) [2784 bp, 927 aa] {O...    47   3e-04
CAGL0I06248g Chr9 (600351..602792) [2442 bp, 813 aa] {ON} simila...    47   3e-04
ZYRO0D10472g Chr4 (876899..880357) [3459 bp, 1152 aa] {ON} simil...    47   3e-04
Skud_16.239 Chr16 complement(438063..439727) [1665 bp, 554 aa] {...    46   3e-04
Kpol_1067.14 s1067 (29413..31050) [1638 bp, 545 aa] {ON} (29413....    46   3e-04
TPHA0H01470 Chr8 complement(329451..333578) [4128 bp, 1375 aa] {...    47   3e-04
Kpol_1018.137 s1018 complement(366178..367914) [1737 bp, 578 aa]...    46   3e-04
Ecym_2397 Chr2 complement(771343..773961) [2619 bp, 872 aa] {ON}...    46   3e-04
CAGL0I05390g Chr9 complement(508677..510041) [1365 bp, 454 aa] {...    46   3e-04
SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] ...    46   3e-04
KLLA0F01507g Chr6 (144356..145774) [1419 bp, 472 aa] {ON} some s...    46   3e-04
KAFR0C03520 Chr3 (715667..720019) [4353 bp, 1450 aa] {ON} Anc_8....    46   3e-04
KAFR0C04480 Chr3 (894906..896213) [1308 bp, 435 aa] {ON} Anc_1.3...    46   3e-04
NCAS0I02850 Chr9 (529637..532042) [2406 bp, 801 aa] {ON} Anc_1.180     46   3e-04
SAKL0E12958g Chr5 (1066434..1068653) [2220 bp, 739 aa] {ON} simi...    46   3e-04
Ecym_3371 Chr3 (706573..706597,706675..707570) [921 bp, 306 aa] ...    45   3e-04
KNAG0C01020 Chr3 (200271..202595) [2325 bp, 774 aa] {ON} Anc_1.1...    46   3e-04
TPHA0G02480 Chr7 (509815..511860) [2046 bp, 681 aa] {ON} Anc_2.4...    46   3e-04
NDAI0E01690 Chr5 (335849..337051) [1203 bp, 400 aa] {ON} Anc_2.391     46   3e-04
TDEL0F00530 Chr6 complement(88187..90517) [2331 bp, 776 aa] {ON}...    46   3e-04
YPL042C Chr16 complement(473040..474707) [1668 bp, 555 aa] {ON} ...    46   3e-04
Skud_4.39 Chr4 complement(70857..72947) [2091 bp, 696 aa] {ON} Y...    46   3e-04
Kpol_1007.17 s1007 (32671..32687,32861..33767) [924 bp, 307 aa] ...    45   3e-04
Skud_14.151 Chr14 complement(284115..286490) [2376 bp, 791 aa] {...    46   3e-04
Suva_10.464 Chr10 (809505..811721) [2217 bp, 738 aa] {ON} YLR362...    46   3e-04
Kpol_1014.8 s1014 (13007..14368) [1362 bp, 453 aa] {ON} (13007.....    46   3e-04
Suva_14.158 Chr14 complement(289281..291650) [2370 bp, 789 aa] {...    46   3e-04
TDEL0H00560 Chr8 (94614..96500) [1887 bp, 628 aa] {ON} Anc_7.515...    46   3e-04
TPHA0D03940 Chr4 (825250..826989) [1740 bp, 579 aa] {ON} Anc_3.4...    46   3e-04
Kpol_1035.17 s1035 complement(39908..41503) [1596 bp, 531 aa] {O...    46   3e-04
TPHA0E02270 Chr5 (471696..472916) [1221 bp, 406 aa] {ON} Anc_5.2...    45   4e-04
TDEL0B01540 Chr2 complement(272561..273458,273562..273578) [915 ...    45   4e-04
KNAG0C02080 Chr3 complement(404332..405588) [1257 bp, 418 aa] {O...    45   4e-04
YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}  R...    46   4e-04
Kwal_27.9773 s27 (57252..58472) [1221 bp, 406 aa] {ON} YAR018C (...    45   4e-04
Suva_11.108 Chr11 complement(207520..209070) [1551 bp, 516 aa] {...    46   4e-04
Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON} ...    46   4e-04
Suva_11.54 Chr11 complement(116221..118401) [2181 bp, 726 aa] {O...    46   4e-04
Smik_16.193 Chr16 complement(350311..351978) [1668 bp, 555 aa] {...    45   4e-04
Skud_2.141 Chr2 complement(264097..265677) [1581 bp, 526 aa] {ON...    45   4e-04
TDEL0F03120 Chr6 (570471..572192) [1722 bp, 573 aa] {ON} Anc_3.4...    45   4e-04
Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON} ...    46   4e-04
Kwal_14.2497 s14 complement(784224..785480) [1257 bp, 418 aa] {O...    45   4e-04
CAGL0L12474g Chr12 complement(1347340..1348248) [909 bp, 302 aa]...    45   4e-04
NCAS0G01820 Chr7 complement(323288..325690) [2403 bp, 800 aa] {O...    46   4e-04
Ecym_5252 Chr5 (525687..526976) [1290 bp, 429 aa] {ON} similar t...    45   4e-04
TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8....    46   5e-04
YNL183C Chr14 complement(293137..295509) [2373 bp, 790 aa] {ON} ...    45   5e-04
CAGL0J11308g Chr10 (1099969..1102155) [2187 bp, 728 aa] {ON} sim...    45   5e-04
NCAS0F02190 Chr6 complement(435844..437706) [1863 bp, 620 aa] {O...    45   5e-04
CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} si...    46   5e-04
KAFR0A07560 Chr1 (1525225..1527504) [2280 bp, 759 aa] {ON} Anc_2...    45   5e-04
Kwal_33.14434 s33 complement(672031..674310) [2280 bp, 759 aa] {...    45   5e-04
TDEL0D01220 Chr4 complement(228529..230451) [1923 bp, 640 aa] {O...    45   5e-04
NCAS0E01150 Chr5 complement(217594..219315) [1722 bp, 573 aa] {O...    45   5e-04
TBLA0D05770 Chr4 (1424960..1427671) [2712 bp, 903 aa] {ON} Anc_1...    45   5e-04
SAKL0E06534g Chr5 complement(533369..534267,534334..534358) [924...    45   5e-04
TBLA0B09590 Chr2 (2272405..2273328) [924 bp, 307 aa] {ON} Anc_2....    45   5e-04
CAGL0I04422g Chr9 (394159..395427) [1269 bp, 422 aa] {ON} some s...    45   5e-04
Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {O...    45   5e-04
TBLA0J00990 Chr10 (224999..227335) [2337 bp, 778 aa] {ON} Anc_1....    45   6e-04
KNAG0J01950 Chr10 complement(352815..354317) [1503 bp, 500 aa] {...    45   6e-04
TPHA0D00430 Chr4 complement(73651..74730) [1080 bp, 359 aa] {ON}...    45   6e-04
NCAS0G03420 Chr7 (628644..630668) [2025 bp, 674 aa] {ON} Anc_1.507     45   6e-04
KAFR0K01540 Chr11 (320997..322706) [1710 bp, 569 aa] {ON} Anc_3....    45   6e-04
Smik_11.125 Chr11 complement(208208..209764) [1557 bp, 518 aa] {...    45   6e-04
TPHA0I00820 Chr9 (177222..179651) [2430 bp, 809 aa] {ON} Anc_1.2...    45   6e-04
Kpol_1044.26 s1044 complement(60216..62666) [2451 bp, 816 aa] {O...    45   6e-04
TDEL0A01120 Chr1 complement(189217..191466) [2250 bp, 749 aa] {O...    45   7e-04
Kpol_2001.10 s2001 (30724..33018) [2295 bp, 764 aa] {ON} (30724....    45   7e-04
TPHA0P00640 Chr16 (132185..133963) [1779 bp, 592 aa] {ON} Anc_3....    45   7e-04
KAFR0F01790 Chr6 complement(347491..349884) [2394 bp, 797 aa] {O...    45   7e-04
KAFR0B03170 Chr2 complement(656163..658025) [1863 bp, 620 aa] {O...    45   7e-04
ZYRO0F08074g Chr6 (654009..654025,654107..655004) [915 bp, 304 a...    44   7e-04
Ecym_5624 Chr5 (1256658..1258022) [1365 bp, 454 aa] {ON} similar...    45   7e-04
ZYRO0F01034g Chr6 (80328..82826) [2499 bp, 832 aa] {ON} similar ...    45   8e-04
Skud_11.113 Chr11 complement(207796..209355) [1560 bp, 519 aa] {...    45   8e-04
Suva_4.168 Chr4 complement(302527..303654) [1128 bp, 375 aa] {ON...    44   8e-04
KLLA0F01408g Chr6 (135424..136302) [879 bp, 292 aa] {ON} conserv...    44   8e-04
NCAS0A04220 Chr1 (855791..857353) [1563 bp, 520 aa] {ON} Anc_2.425     45   8e-04
Kpol_209.1 s209 (1823..5734) [3912 bp, 1303 aa] {ON} (1823..5734...    45   9e-04
CAGL0F00649g Chr6 (71961..73505) [1545 bp, 514 aa] {ON} similar ...    44   9e-04
KAFR0F00380 Chr6 complement(91358..92800) [1443 bp, 480 aa] {ON}...    44   9e-04
YLR362W Chr12 (849866..852019) [2154 bp, 717 aa] {ON}  STE11Sign...    45   0.001
Smik_11.200 Chr11 complement(333676..335592) [1917 bp, 638 aa] {...    45   0.001
Smik_6.178 Chr6 (291601..293322) [1722 bp, 573 aa] {ON} YGR092W ...    44   0.001
Kwal_27.11777 s27 (942591..943985) [1395 bp, 464 aa] {ON} YPL026...    44   0.001
Kpol_1018.148 s1018 (393064..394413) [1350 bp, 449 aa] {ON} (393...    44   0.001
KAFR0D03100 Chr4 complement(610106..611635) [1530 bp, 509 aa] {O...    44   0.001
TBLA0H00370 Chr8 (71216..73393) [2178 bp, 725 aa] {ON} Anc_2.425...    44   0.001
NDAI0G01280 Chr7 complement(281834..283573) [1740 bp, 579 aa] {O...    44   0.001
Ecym_6425 Chr6 (825834..828095) [2262 bp, 753 aa] {ON} similar t...    44   0.001
Suva_2.413 Chr2 (735541..736923) [1383 bp, 460 aa] {ON} YDR247W ...    44   0.001
Kwal_23.3471 s23 (305414..306196) [783 bp, 260 aa] {OFF} YDL108W...    44   0.001
ZYRO0D02970g Chr4 complement(231363..233669) [2307 bp, 768 aa] {...    44   0.001
KLLA0D11990g Chr4 complement(1022895..1023792,1023928..1023944) ...    44   0.001
Kwal_YGOB_23.3471 s23 (305207..305234,305298..306196) [927 bp, 3...    44   0.001
Suva_6.246 Chr6 (439815..442373) [2559 bp, 852 aa] {ON} YJL165C ...    44   0.001
Suva_7.106 Chr7 (202969..204540) [1572 bp, 523 aa] {ON} YGL158W ...    44   0.001
KAFR0F02190 Chr6 (428623..430095) [1473 bp, 490 aa] {ON} Anc_3.1...    44   0.001
NCAS0A11530 Chr1 (2281835..2283223) [1389 bp, 462 aa] {ON} Anc_3...    44   0.001
CAGL0I05896g Chr9 (560169..562505) [2337 bp, 778 aa] {ON} some s...    44   0.001
Skud_11.67 Chr11 complement(135815..137341) [1527 bp, 508 aa] {O...    44   0.001
Kpol_1041.9 s1041 (27806..29059) [1254 bp, 417 aa] {ON} (27806.....    44   0.001
KLTH0F09504g Chr6 (824743..824770,824831..825729) [927 bp, 308 a...    43   0.001
CAGL0B04147g Chr2 (402798..404498) [1701 bp, 566 aa] {ON} highly...    44   0.001
TBLA0B03840 Chr2 complement(881914..884490) [2577 bp, 858 aa] {O...    44   0.001
NCAS0A04010 Chr1 complement(809163..810299) [1137 bp, 378 aa] {O...    44   0.001
Ecym_2744 Chr2 complement(1442759..1444465) [1707 bp, 568 aa] {O...    44   0.001
Kpol_1013.52 s1013 (123332..125881) [2550 bp, 849 aa] {ON} (1233...    44   0.002
Ecym_6301 Chr6 complement(566248..567324) [1077 bp, 358 aa] {ON}...    44   0.002
Ecym_6044 Chr6 complement(84500..85756) [1257 bp, 418 aa] {ON} s...    44   0.002
TDEL0G02620 Chr7 (501589..501613,501677..502566) [915 bp, 304 aa...    43   0.002
ZYRO0A02772g Chr1 complement(223226..224473) [1248 bp, 415 aa] {...    44   0.002
NDAI0F03390 Chr6 (816047..818380) [2334 bp, 777 aa] {ON}               44   0.002
Kpol_1066.19 s1066 (31013..32806) [1794 bp, 597 aa] {OFF} (31013...    44   0.002
Kpol_YGOB_1066.19 s1066 (30983..32806) [1824 bp, 607 aa] {ON} AN...    44   0.002
TPHA0F03520 Chr6 (755480..757756) [2277 bp, 758 aa] {ON} Anc_1.5...    44   0.002
AEL083W Chr5 (470964..472574) [1611 bp, 536 aa] {ON} Syntenic ho...    44   0.002
NCAS0B08320 Chr2 complement(1585766..1588471) [2706 bp, 901 aa] ...    44   0.002
Kwal_23.4276 s23 complement(648061..649626) [1566 bp, 521 aa] {O...    44   0.002
NCAS0C03770 Chr3 complement(761101..765897) [4797 bp, 1598 aa] {...    44   0.002
KNAG0E03200 Chr5 complement(641437..646020) [4584 bp, 1527 aa] {...    44   0.002
SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {...    44   0.002
ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic ho...    44   0.002
YDL214C Chr4 complement(74446..76545) [2100 bp, 699 aa] {ON}  PR...    44   0.002
KNAG0F01240 Chr6 complement(223003..225591) [2589 bp, 862 aa] {O...    44   0.002
Smik_12.450 Chr12 (788896..791106) [2211 bp, 736 aa] {ON} YLR362...    43   0.002
TPHA0A02770 Chr1 complement(597703..600129) [2427 bp, 808 aa] {O...    43   0.002
NCAS0E02230 Chr5 (429499..430176,430250..431104) [1533 bp, 510 a...    43   0.003
Suva_7.375 Chr7 (643870..645591) [1722 bp, 573 aa] {ON} YGR092W ...    43   0.003
Kwal_14.1159 s14 complement(219896..224461) [4566 bp, 1521 aa] {...    44   0.003
Skud_4.509 Chr4 (910551..911945) [1395 bp, 464 aa] {ON} YDR247W ...    43   0.003
YAR018C Chr1 complement(170396..171703) [1308 bp, 435 aa] {ON}  ...    43   0.003
YKL171W Chr11 (127475..130261) [2787 bp, 928 aa] {ON}  NNK1Prote...    43   0.003
YGR092W Chr7 (668189..669907) [1719 bp, 572 aa] {ON}  DBF2Ser/Th...    43   0.003
NDAI0G05370 Chr7 (1313015..1315555) [2541 bp, 846 aa] {ON} Anc_1...    43   0.003
TBLA0G01910 Chr7 complement(500551..502596) [2046 bp, 681 aa] {O...    43   0.003
TPHA0N01450 Chr14 complement(318088..320340) [2253 bp, 750 aa] {...    43   0.003
KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} simila...    43   0.003
CAGL0H01837g Chr8 complement(176352..178736) [2385 bp, 794 aa] {...    43   0.003
Skud_10.49 Chr10 complement(81651..84206) [2556 bp, 851 aa] {ON}...    43   0.003
KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} sim...    43   0.003
SAKL0F06094g Chr6 (457709..459442) [1734 bp, 577 aa] {ON} unipro...    43   0.003
NCAS0A04440 Chr1 complement(895181..896935) [1755 bp, 584 aa] {O...    43   0.003
TDEL0H00890 Chr8 complement(146908..149088) [2181 bp, 726 aa] {O...    43   0.004
Skud_12.447 Chr12 (790003..792210) [2208 bp, 735 aa] {ON} YLR362...    43   0.004
YGL158W Chr7 (207033..208571) [1539 bp, 512 aa] {ON}  RCK1Protei...    42   0.004
Ecym_4773 Chr4 complement(1504949..1506541) [1593 bp, 530 aa] {O...    42   0.004
TBLA0B06620 Chr2 complement(1556378..1559671) [3294 bp, 1097 aa]...    43   0.004
KNAG0A02350 Chr1 complement(223757..225022) [1266 bp, 421 aa] {O...    42   0.004
KLTH0C08932g Chr3 (749308..750867) [1560 bp, 519 aa] {ON} simila...    42   0.004
NDAI0K01480 Chr11 complement(337108..338706) [1599 bp, 532 aa] {...    42   0.004
Suva_15.271 Chr15 complement(460466..463813) [3348 bp, 1115 aa] ...    42   0.004
Smik_10.65 Chr10 complement(104987..107545) [2559 bp, 852 aa] {O...    42   0.004
KLLA0F26983g Chr6 (2489326..2490729) [1404 bp, 467 aa] {ON} some...    42   0.004
KNAG0C02600 Chr3 complement(504486..507134) [2649 bp, 882 aa] {O...    42   0.005
ADR163W Chr4 (989728..991008) [1281 bp, 426 aa] {ON} Syntenic ho...    42   0.005
TDEL0B06160 Chr2 complement(1086672..1088327) [1656 bp, 551 aa] ...    42   0.005
KAFR0D04500 Chr4 (887515..889989) [2475 bp, 824 aa] {ON} Anc_1.5...    42   0.005
Skud_1.73 Chr1 (144821..146128) [1308 bp, 435 aa] {ON} YAR018C (...    42   0.005
KNAG0A05920 Chr1 complement(883522..884742) [1221 bp, 406 aa] {O...    42   0.005
KAFR0F01940 Chr6 complement(379908..382283) [2376 bp, 791 aa] {O...    42   0.005
SAKL0B11308g Chr2 complement(984543..986369) [1827 bp, 608 aa] {...    42   0.005
KNAG0B01130 Chr2 complement(208528..210279) [1752 bp, 583 aa] {O...    42   0.006
ZYRO0C15884g Chr3 (1241605..1245873) [4269 bp, 1422 aa] {ON} sim...    42   0.006
TPHA0O00670 Chr15 (125331..127088) [1758 bp, 585 aa] {ON} Anc_1....    42   0.006
TDEL0G00630 Chr7 complement(128151..129764) [1614 bp, 537 aa] {O...    42   0.006
KLLA0D14905g Chr4 (1256065..1257768) [1704 bp, 567 aa] {ON} simi...    42   0.006
TDEL0B01590 Chr2 complement(280143..281573) [1431 bp, 476 aa] {O...    42   0.006
Smik_11.60 Chr11 complement(116793..118970) [2178 bp, 725 aa] {O...    42   0.006
ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic h...    42   0.006
KAFR0E00330 Chr5 complement(74619..76574) [1956 bp, 651 aa] {ON}...    42   0.006
NCAS0D00400 Chr4 complement(61545..63716) [2172 bp, 723 aa] {ON}...    42   0.006
Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C...    42   0.007
CAGL0G03047g Chr7 (282299..283918) [1620 bp, 539 aa] {ON} highly...    42   0.007
Skud_15.519 Chr15 complement(932720..934216) [1497 bp, 498 aa] {...    42   0.007
KLLA0A09713g Chr1 (851952..853625) [1674 bp, 557 aa] {ON} simila...    42   0.007
YJL165C Chr10 complement(106894..109461) [2568 bp, 855 aa] {ON} ...    42   0.007
YPR106W Chr16 (740061..741392) [1332 bp, 443 aa] {ON}  ISR1Predi...    42   0.007
KLLA0A05819g Chr1 (541545..543659) [2115 bp, 704 aa] {ON} simila...    42   0.007
Smik_15.535 Chr15 complement(940569..942050) [1482 bp, 493 aa] {...    42   0.007
ZYRO0D01584g Chr4 (124739..126688) [1950 bp, 649 aa] {ON} some s...    42   0.007
KLLA0F23507g Chr6 complement(2198603..2200066) [1464 bp, 487 aa]...    42   0.008
NDAI0G01760 Chr7 (384420..385700) [1281 bp, 426 aa] {ON}               41   0.008
NDAI0A04040 Chr1 complement(907696..910041) [2346 bp, 781 aa] {O...    42   0.008
Suva_11.24 Chr11 complement(52742..52930,52961..54523) [1752 bp,...    42   0.008
NCAS0D01230 Chr4 complement(225213..226661) [1449 bp, 482 aa] {O...    41   0.008
YJL141C Chr10 complement(147967..150390) [2424 bp, 807 aa] {ON} ...    42   0.008
Smik_10.349 Chr10 (534756..537209) [2454 bp, 817 aa] {ON} YJR059...    42   0.008
KAFR0H02430 Chr8 complement(464446..466800) [2355 bp, 784 aa] {O...    42   0.008
ABR088C Chr2 complement(546325..547920) [1596 bp, 531 aa] {ON} S...    41   0.008
Smik_4.494 Chr4 (900954..902321) [1368 bp, 455 aa] {ON} YDR247W ...    41   0.009
Suva_8.405 Chr8 complement(730738..732348) [1611 bp, 536 aa] {ON...    41   0.009
YOR351C Chr15 complement(995018..996511) [1494 bp, 497 aa] {ON} ...    41   0.009
SAKL0C05280g Chr3 complement(502205..504490) [2286 bp, 761 aa] {...    41   0.009
CAGL0H09152g Chr8 complement(895722..898055) [2334 bp, 777 aa] {...    41   0.010
Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp...    41   0.010
Kwal_33.13984 s33 complement(471429..473378) [1950 bp, 649 aa] {...    41   0.010
Suva_1.84 Chr1 complement(148430..149737) [1308 bp, 435 aa] {ON}...    41   0.011
NCAS0F02410 Chr6 complement(476683..478071) [1389 bp, 462 aa] {O...    41   0.011
TBLA0A06660 Chr1 complement(1626147..1630400) [4254 bp, 1417 aa]...    41   0.011
TBLA0G00820 Chr7 complement(191559..192833) [1275 bp, 424 aa] {O...    41   0.011
Smik_8.156 Chr8 complement(234928..238269) [3342 bp, 1113 aa] {O...    41   0.011
TPHA0A02760 Chr1 (594482..597502) [3021 bp, 1006 aa] {ON} Anc_1....    41   0.011
Smik_10.91 Chr10 complement(145745..148153) [2409 bp, 802 aa] {O...    41   0.011
Kwal_55.20221 s55 (304482..308006) [3525 bp, 1174 aa] {ON} YHR07...    41   0.012
YPR111W Chr16 (747306..749000) [1695 bp, 564 aa] {ON}  DBF20Ser/...    41   0.012
Suva_16.157 Chr16 complement(270891..273389) [2499 bp, 832 aa] {...    41   0.012
TBLA0D03740 Chr4 complement(926538..929057) [2520 bp, 839 aa] {O...    41   0.012
TDEL0E02600 Chr5 (501545..504934) [3390 bp, 1129 aa] {ON} Anc_5....    41   0.012
Kwal_14.1249 s14 (252877..253911) [1035 bp, 344 aa] {ON} YFL029C...    40   0.012
YJR059W Chr10 (545787..548243) [2457 bp, 818 aa] {ON}  PTK2Putat...    41   0.013
NCAS0E01560 Chr5 (294095..295345) [1251 bp, 416 aa] {ON}               40   0.013
NDAI0D01450 Chr4 (339780..341948) [2169 bp, 722 aa] {ON} Anc_1.507     41   0.013
Kpol_2001.31 s2001 complement(90402..93110) [2709 bp, 902 aa] {O...    41   0.013
Smik_1.78 Chr1 complement(147996..149303) [1308 bp, 435 aa] {ON}...    40   0.013
NCAS0B02530 Chr2 complement(422882..424207) [1326 bp, 441 aa] {O...    40   0.013
Skud_7.391 Chr7 (652479..654200) [1722 bp, 573 aa] {ON} YGR092W ...    40   0.014
KLTH0D08712g Chr4 complement(728072..729886) [1815 bp, 604 aa] {...    41   0.014
KLTH0F05522g Chr6 complement(477035..478975) [1941 bp, 646 aa] {...    41   0.014
CAGL0I09504g Chr9 (909589..911175) [1587 bp, 528 aa] {ON} simila...    40   0.015
Skud_16.398 Chr16 (712145..713827) [1683 bp, 560 aa] {ON} YPR111...    40   0.015
TBLA0J01000 Chr10 complement(227869..231072) [3204 bp, 1067 aa] ...    41   0.015
NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {O...    41   0.015
ADR379C Chr4 complement(1386598..1388076) [1479 bp, 492 aa] {ON}...    40   0.015
Skud_10.283 Chr10 (503324..505765) [2442 bp, 813 aa] {ON} YJR059...    41   0.016
Kwal_27.11803 s27 (952938..953678) [741 bp, 246 aa] {ON} YPL031C...    40   0.016
AGR334W Chr7 (1355098..1356693) [1596 bp, 531 aa] {ON} Syntenic ...    40   0.017
Ecym_2302 Chr2 (587299..588951) [1653 bp, 550 aa] {ON} similar t...    40   0.017
Suva_16.439 Chr16 (755102..756796) [1695 bp, 564 aa] {ON} YPR111...    40   0.017
CAGL0G01716g Chr7 complement(155248..156390) [1143 bp, 380 aa] {...    40   0.017
Suva_6.221 Chr6 (399862..400920,400924..402096) [2232 bp, 743 aa...    40   0.018
SAKL0D06820g Chr4 (566145..567938) [1794 bp, 597 aa] {ON} simila...    40   0.018
NDAI0H03740 Chr8 (912611..915373) [2763 bp, 920 aa] {ON} Anc_2.71      40   0.019
TDEL0B06900 Chr2 complement(1220590..1222257) [1668 bp, 555 aa] ...    40   0.019
Smik_16.354 Chr16 (625456..627150) [1695 bp, 564 aa] {ON} YPR111...    40   0.020
Smik_16.204 Chr16 complement(369272..370021) [750 bp, 249 aa] {O...    39   0.020
SAKL0C06248g Chr3 complement(577990..580185) [2196 bp, 731 aa] {...    40   0.020
NCAS0I02680 Chr9 (498371..500752) [2382 bp, 793 aa] {ON}               40   0.020
TPHA0G01600 Chr7 complement(329313..331850) [2538 bp, 845 aa] {O...    40   0.020
Suva_16.433 Chr16 (747883..749205) [1323 bp, 440 aa] {ON} YPR106...    40   0.022
Kpol_1002.21 s1002 complement(62702..63895) [1194 bp, 397 aa] {O...    40   0.023
YPL153C Chr16 complement(261727..264192) [2466 bp, 821 aa] {ON} ...    40   0.023
TPHA0A03700 Chr1 complement(808996..813273) [4278 bp, 1425 aa] {...    40   0.024
Suva_12.148 Chr12 (223571..225982) [2412 bp, 804 aa] {ON} YJR059...    40   0.024
NDAI0C00570 Chr3 (108274..110547) [2274 bp, 757 aa] {ON}               40   0.025
NDAI0C05160 Chr3 (1199533..1201026) [1494 bp, 497 aa] {ON} Anc_8...    40   0.026
YHR079C Chr8 complement(258244..261591) [3348 bp, 1115 aa] {ON} ...    40   0.026
Skud_7.114 Chr7 (211645..213153) [1509 bp, 502 aa] {ON} YGL158W ...    40   0.027
Smik_6.350 Chr6 (559997..562465) [2469 bp, 822 aa] {ON} YPL153C ...    40   0.031
TBLA0A01630 Chr1 complement(385348..386386,386496..386512) [1056...    39   0.031
Skud_10.73 Chr10 complement(123049..125436) [2388 bp, 795 aa] {O...    40   0.032
ZYRO0G20570g Chr7 (1695518..1697305) [1788 bp, 595 aa] {ON} simi...    39   0.034
Smik_16.346 Chr16 (617471..618802) [1332 bp, 443 aa] {ON} YPR106...    39   0.035
Kwal_33.13825 s33 (409772..412477) [2706 bp, 901 aa] {ON} YKL171...    40   0.035
ZYRO0C12408g Chr3 (979857..981593) [1737 bp, 578 aa] {ON} highly...    39   0.036
ZYRO0G04488g Chr7 complement(360635..362545) [1911 bp, 636 aa] {...    39   0.038
CAGL0M13541g Chr13 (1333846..1335714) [1869 bp, 622 aa] {ON} sim...    39   0.038
KAFR0C05130 Chr3 (1018035..1019402) [1368 bp, 455 aa] {ON} Anc_7...    39   0.039
NCAS0H01740 Chr8 complement(331436..335284) [3849 bp, 1282 aa] {...    39   0.043
KNAG0B00260 Chr2 complement(36240..38477) [2238 bp, 745 aa] {ON}...    39   0.044
ADL102C Chr4 complement(503667..504785) [1119 bp, 372 aa] {ON} S...    39   0.045
TBLA0B09215 Chr2 complement(2180179..2181375) [1197 bp, 398 aa] ...    39   0.047
Suva_6.222 Chr6 (400975..402096) [1122 bp, 373 aa] {ON} YJL141C ...    39   0.048
NCAS0C02510 Chr3 complement(468113..469390) [1278 bp, 425 aa] {O...    39   0.049
Suva_11.52 Chr11 (112355..115156) [2802 bp, 933 aa] {ON} YKL171W...    39   0.050
ACR249C Chr3 complement(797020..798951) [1932 bp, 643 aa] {ON} S...    39   0.052
KLTH0F12012g Chr6 complement(1013169..1014881) [1713 bp, 570 aa]...    39   0.053
NCAS0C01370 Chr3 complement(250693..253092) [2400 bp, 799 aa] {O...    39   0.055
NDAI0G06240 Chr7 (1546580..1549282) [2703 bp, 900 aa] {ON} Anc_1...    39   0.057
CAGL0J04972g Chr10 (475587..476606) [1020 bp, 339 aa] {ON} some ...    38   0.061
Smik_7.115 Chr7 (201140..202663) [1524 bp, 507 aa] {ON} YGL158W ...    39   0.064
TPHA0A05460 Chr1 (1233608..1235170) [1563 bp, 520 aa] {ON} Anc_5...    39   0.070
KAFR0D04250 Chr4 (837888..839207) [1320 bp, 439 aa] {ON} Anc_3.4...    38   0.073
YKL198C Chr11 complement(68232..70220) [1989 bp, 662 aa] {ON}  P...    39   0.073
Skud_8.139 Chr8 complement(232178..235534) [3357 bp, 1118 aa] {O...    39   0.073
Skud_16.129 Chr16 complement(233341..235824) [2484 bp, 827 aa] {...    39   0.075
Smik_2.239 Chr2 (421843..426207) [4365 bp, 1454 aa] {ON} YBR097W...    39   0.076
Skud_15.25 Chr15 complement(43728..44864) [1137 bp, 378 aa] {ON}...    38   0.076
KAFR0C03480 Chr3 (708186..709277) [1092 bp, 363 aa] {ON} Anc_8.4...    38   0.079
KLLA0E04247g Chr5 (382874..383995) [1122 bp, 373 aa] {ON} simila...    38   0.079
SAKL0H11748g Chr8 complement(1002207..1003541) [1335 bp, 444 aa]...    38   0.095
Smik_15.25 Chr15 complement(46541..47668) [1128 bp, 375 aa] {ON}...    38   0.096
Kwal_47.18098 s47 (685497..686621) [1125 bp, 374 aa] {ON} YIL035...    38   0.10 
Smik_11.24 Chr11 complement(52600..54522) [1923 bp, 640 aa] {ON}...    38   0.11 
Smik_9.156 Chr9 complement(261998..263116) [1119 bp, 372 aa] {ON...    37   0.11 
Skud_11.20 Chr11 complement(51603..53558) [1956 bp, 651 aa] {ON}...    38   0.11 
Kwal_23.3992 s23 complement(515493..517208) [1716 bp, 571 aa] {O...    38   0.11 
Skud_9.134 Chr9 complement(256610..257728) [1119 bp, 372 aa] {ON...    37   0.11 
KLTH0E03828g Chr5 (345775..349131) [3357 bp, 1118 aa] {ON} simil...    38   0.12 
TBLA0B06510 Chr2 (1536156..1538489) [2334 bp, 777 aa] {ON} Anc_1...    38   0.12 
Suva_9.165 Chr9 complement(276469..277587) [1119 bp, 372 aa] {ON...    37   0.12 
KNAG0J02520 Chr10 (472464..476795) [4332 bp, 1443 aa] {ON} Anc_3...    38   0.13 
YOL128C Chr15 complement(78352..79479) [1128 bp, 375 aa] {ON}  Y...    37   0.14 
NCAS0I01210 Chr9 complement(218242..222582) [4341 bp, 1446 aa] {...    38   0.14 
Ecym_4364 Chr4 (772870..773997) [1128 bp, 375 aa] {ON} similar t...    37   0.14 
KLLA0F08877g Chr6 (825217..826182) [966 bp, 321 aa] {ON} uniprot...    37   0.15 
SAKL0B04752g Chr2 (416940..418259) [1320 bp, 439 aa] {ON} weakly...    37   0.17 
TBLA0F01730 Chr6 complement(431961..433004) [1044 bp, 347 aa] {O...    37   0.17 
Ecym_3487 Chr3 complement(910575..914810) [4236 bp, 1411 aa] {ON...    37   0.17 
YIL035C Chr9 complement(287790..288908) [1119 bp, 372 aa] {ON}  ...    37   0.17 
KNAG0D02790 Chr4 (507235..508848) [1614 bp, 537 aa] {ON} Anc_5.3...    37   0.17 
Suva_6.133 Chr6 (221952..223955) [2004 bp, 667 aa] {ON} YJL057C ...    37   0.20 
YPL026C Chr16 complement(500675..502183) [1509 bp, 502 aa] {ON} ...    37   0.20 
CAGL0D02244g Chr4 complement(229504..230967) [1464 bp, 487 aa] {...    37   0.21 
KNAG0G00280 Chr7 complement(43196..45262) [2067 bp, 688 aa] {ON}...    37   0.21 
KNAG0B04500 Chr2 (865766..869089) [3324 bp, 1107 aa] {ON} Anc_5....    37   0.22 
KLTH0F04686g Chr6 (413669..416209) [2541 bp, 846 aa] {ON} weakly...    37   0.23 
Skud_16.391 Chr16 (704392..705723) [1332 bp, 443 aa] {ON} YPR106...    37   0.23 
TDEL0C00660 Chr3 complement(107849..108952) [1104 bp, 367 aa] {O...    37   0.24 
NDAI0C01890 Chr3 (419452..423777) [4326 bp, 1441 aa] {ON} Anc_5....    37   0.24 
KNAG0K01710 Chr11 (360438..361931) [1494 bp, 497 aa] {ON} Anc_3....    37   0.24 
ZYRO0E05170g Chr5 complement(390866..392593) [1728 bp, 575 aa] {...    37   0.26 
TPHA0I02660 Chr9 (582108..584219) [2112 bp, 703 aa] {ON} Anc_1.3...    37   0.26 
Skud_16.256 Chr16 complement(465728..467362) [1635 bp, 544 aa] {...    37   0.26 
CAGL0H08437g Chr8 complement(825191..829423) [4233 bp, 1410 aa] ...    37   0.27 
Skud_2.225 Chr2 (405095..409459) [4365 bp, 1454 aa] {ON} YBR097W...    37   0.28 
TDEL0C04810 Chr3 (867670..871932) [4263 bp, 1420 aa] {ON} Anc_3....    37   0.29 
KNAG0E03260 Chr5 complement(654134..655246) [1113 bp, 370 aa] {O...    36   0.29 
KLTH0E15972g Chr5 complement(1414595..1416016) [1422 bp, 473 aa]...    36   0.30 
TBLA0F01550 Chr6 complement(385184..386716) [1533 bp, 510 aa] {O...    36   0.32 
KNAG0H02860 Chr8 (531728..532843) [1116 bp, 371 aa] {ON}               36   0.32 
Suva_4.344 Chr4 (606007..610371) [4365 bp, 1454 aa] {ON} YBR097W...    37   0.33 
KLTH0G18282g Chr7 complement(1576512..1577558) [1047 bp, 348 aa]...    36   0.33 
ADR293C Chr4 complement(1207021..1210425) [3405 bp, 1134 aa] {ON...    36   0.35 
YBR097W Chr2 (436951..441315) [4365 bp, 1454 aa] {ON}  VPS15Myri...    36   0.35 
KAFR0A00840 Chr1 complement(151896..152894) [999 bp, 332 aa] {ON...    36   0.37 
KLTH0A03542g Chr1 (306667..307803) [1137 bp, 378 aa] {ON} highly...    36   0.38 
CAGL0M02233g Chr13 complement(267332..269635) [2304 bp, 767 aa] ...    36   0.41 
TPHA0K02030 Chr11 (432238..434505) [2268 bp, 755 aa] {ON} Anc_4....    36   0.43 
KNAG0E00360 Chr5 (54187..55563) [1377 bp, 458 aa] {ON}                 35   0.47 
Ecym_1313 Chr1 complement(633556..634455) [900 bp, 299 aa] {ON} ...    35   0.47 
TBLA0D02510 Chr4 complement(626101..627234) [1134 bp, 377 aa] {O...    35   0.51 
KLTH0E11110g Chr5 (997486..998847) [1362 bp, 453 aa] {ON} simila...    35   0.51 
KAFR0G01670 Chr7 (363200..367459) [4260 bp, 1419 aa] {ON} Anc_3....    36   0.53 
AEL179W Chr5 (302948..303817) [870 bp, 289 aa] {ON} NOHBY510; No...    35   0.55 
TPHA0J02290 Chr10 (508389..510779) [2391 bp, 796 aa] {ON} Anc_6....    35   0.55 
NDAI0G03150 Chr7 complement(741321..742463) [1143 bp, 380 aa] {O...    35   0.60 
KNAG0F02100 Chr6 complement(399443..401944) [2502 bp, 833 aa] {O...    35   0.60 
Suva_16.291 Chr16 complement(504006..505433) [1428 bp, 475 aa] {...    35   0.67 
Kpol_1035.34 s1035 (79914..80978) [1065 bp, 354 aa] {ON} (79914....    35   0.68 
Smik_16.209 Chr16 complement(377965..379425) [1461 bp, 486 aa] {...    35   0.69 
ZYRO0D04752g Chr4 complement(397364..398215,398290..398907) [147...    35   0.77 
CAGL0K11275g Chr11 (1094626..1096203) [1578 bp, 525 aa] {ON} sim...    35   0.80 
Kpol_1065.6 s1065 (12266..12916,12918..13280,13332..13340,13394....    35   0.84 
Suva_6.29 Chr6 complement(51588..52691) [1104 bp, 367 aa] {ON} Y...    35   0.85 
KNAG0A04080 Chr1 complement(551409..552635) [1227 bp, 408 aa] {O...    35   0.88 
CAGL0G02035g Chr7 (179911..180930) [1020 bp, 339 aa] {ON} highly...    35   0.92 
CAGL0I05192g Chr9 complement(493635..494756) [1122 bp, 373 aa] {...    35   0.94 
NCAS0A12200 Chr1 (2417539..2419782) [2244 bp, 747 aa] {ON} Anc_1...    35   1.0  
TDEL0H04100 Chr8 complement(706443..707306,707369..707974) [1470...    35   1.1  
SAKL0B11044g Chr2 complement(962142..962940,963019..963086,96315...    34   1.1  
Kwal_33.13225 s33 (127676..130570) [2895 bp, 964 aa] {ON} YFR016...    34   1.3  
KAFR0A02560 Chr1 complement(532248..533351) [1104 bp, 367 aa] {O...    34   1.3  
KAFR0D04760 Chr4 complement(932849..936205) [3357 bp, 1118 aa] {...    34   1.3  
KLTH0D02970g Chr4 complement(284533..285945) [1413 bp, 470 aa] {...    34   1.4  
NDAI0A02720 Chr1 complement(612346..613455) [1110 bp, 369 aa] {O...    34   1.7  
TDEL0B02610 Chr2 complement(470263..471282) [1020 bp, 339 aa] {O...    33   1.8  
TPHA0B02780 Chr2 complement(633307..634449) [1143 bp, 380 aa] {O...    33   1.9  
TBLA0A03220 Chr1 complement(765108..768590) [3483 bp, 1160 aa] {...    34   1.9  
KLTH0D01386g Chr4 (129448..130053,130132..130974) [1449 bp, 482 ...    33   2.1  
KAFR0E02850 Chr5 (575512..576786) [1275 bp, 424 aa] {ON} Anc_8.4...    33   2.3  
NCAS0A13320 Chr1 (2622149..2623258) [1110 bp, 369 aa] {ON}             33   2.4  
NCAS0C03810 Chr3 complement(772530..773660) [1131 bp, 376 aa] {O...    33   2.5  
NDAI0A07790 Chr1 (1790683..1795206) [4524 bp, 1507 aa] {ON} Anc_...    33   2.5  
Suva_15.32 Chr15 complement(56314..57447) [1134 bp, 377 aa] {ON}...    33   2.7  
SAKL0B01474g Chr2 complement(145734..146777) [1044 bp, 347 aa] {...    33   3.0  
TPHA0J03180 Chr10 complement(691886..694882) [2997 bp, 998 aa] {...    33   3.2  
TPHA0H01300 Chr8 (293254..294282) [1029 bp, 342 aa] {ON} Anc_5.6...    33   3.3  
NCAS0G00490 Chr7 complement(83953..84996) [1044 bp, 347 aa] {ON}...    33   3.4  
KAFR0A07320 Chr1 complement(1478564..1480033) [1470 bp, 489 aa] ...    33   3.5  
TDEL0G01540 Chr7 complement(303940..306300) [2361 bp, 786 aa] {O...    33   3.7  
Kpol_1027.1 s1027 (1..2088) [2088 bp, 695 aa] {ON} (1..2088) [20...    33   3.7  
YFL029C Chr6 complement(78055..79161) [1107 bp, 368 aa] {ON}  CA...    32   3.9  
KLLA0B11924g Chr2 complement(1043344..1047582) [4239 bp, 1412 aa...    33   4.0  
KAFR0K00880 Chr11 (188439..191069) [2631 bp, 876 aa] {ON} Anc_5....    33   4.4  
SAKL0B07326g Chr2 (627224..631477) [4254 bp, 1417 aa] {ON} simil...    33   4.7  
SAKL0C05236g Chr3 (498347..501385) [3039 bp, 1012 aa] {ON} simil...    33   4.9  
ZYRO0B16038g Chr2 (1300484..1301515) [1032 bp, 343 aa] {ON} high...    32   5.8  
CAGL0L10230g Chr12 (1100910..1102043) [1134 bp, 377 aa] {ON} sim...    32   6.5  
NDAI0H00610 Chr8 complement(141913..143022) [1110 bp, 369 aa] {O...    32   7.1  
KLLA0F22297g Chr6 complement(2083448..2085547) [2100 bp, 699 aa]...    32   8.6  
Smik_15.241 Chr15 (407598..408617) [1020 bp, 339 aa] {ON} YOR061...    31   9.2  
Kpol_489.20 s489 complement(59150..60178) [1029 bp, 342 aa] {ON}...    31   9.6  
TBLA0E02460 Chr5 (620609..621745) [1137 bp, 378 aa] {ON} Anc_7.2...    31   9.9  

>ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL095W (PRK1) and
           YNL020C (ARK1)
          Length = 750

 Score = 1444 bits (3737), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 703/750 (93%), Positives = 703/750 (93%)

Query: 1   MNQVPQDCLQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGPIQGSLACLKRVHVP 60
           MNQVPQDCLQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGPIQGSLACLKRVHVP
Sbjct: 1   MNQVPQDCLQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGPIQGSLACLKRVHVP 60

Query: 61  DKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFM 120
           DKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFM
Sbjct: 61  DKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFM 120

Query: 121 NSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSV 180
           NSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSV
Sbjct: 121 NSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSV 180

Query: 181 SGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCY 240
           SGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCY
Sbjct: 181 SGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCY 240

Query: 241 FTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRIQG 300
           FTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRIQG
Sbjct: 241 FTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRIQG 300

Query: 301 VPCPLPNFYLERMKHGACTPVHHSASQPALPLATHQFSTSTPMVTHPQPPANQMSPLPHG 360
           VPCPLPNFYLERMKHGACTPVHHSASQPALPLATHQFSTSTPMVTHPQPPANQMSPLPHG
Sbjct: 301 VPCPLPNFYLERMKHGACTPVHHSASQPALPLATHQFSTSTPMVTHPQPPANQMSPLPHG 360

Query: 361 IQPITSNMVYMMHNTTPNIKDIPRENPAATIQKNALYSMSGSEHLSALSSDMHFNRPQLE 420
           IQPITSNMVYMMHNTTPNIKDIPRENPAATIQKNALYSMSGSEHLSALSSDMHFNRPQLE
Sbjct: 361 IQPITSNMVYMMHNTTPNIKDIPRENPAATIQKNALYSMSGSEHLSALSSDMHFNRPQLE 420

Query: 421 NSHTFSGVGPRSSSNPIKIPRNEIQKFLSGTPPTSAKKPTYVDSETQTGDIITSNKSGSR 480
           NSHTFSGVGPRSSSNPIKIPRNEIQKFLSGTPPTSAKKPTYVDSETQTGDIITSNKSGSR
Sbjct: 421 NSHTFSGVGPRSSSNPIKIPRNEIQKFLSGTPPTSAKKPTYVDSETQTGDIITSNKSGSR 480

Query: 481 PFAMXXXXXXXXXXXXXXXTGNSLLGRLSRKTIRSPTSDKGSNPLKSKSSVGDDLASLLS 540
           PFAM               TGNSLLGRLSRKTIRSPTSDKGSNPLKSKSSVGDDLASLLS
Sbjct: 481 PFAMSLSPLSSPELFSEQSTGNSLLGRLSRKTIRSPTSDKGSNPLKSKSSVGDDLASLLS 540

Query: 541 SPSRNLSFPAQSSKSSKRNSADLSSRKSPVLNKSRIAMSYSGPEKXXXXXXXXXXXXXXX 600
           SPSRNLSFPAQSSKSSKRNSADLSSRKSPVLNKSRIAMSYSGPEK               
Sbjct: 541 SPSRNLSFPAQSSKSSKRNSADLSSRKSPVLNKSRIAMSYSGPEKSSATGLESSSSSLFG 600

Query: 601 XQNGEHRPPSSTDRHKSNSTSFRLVPTKKGQTSIQERVHKLLATSAQEDVXXXXXXXXXX 660
            QNGEHRPPSSTDRHKSNSTSFRLVPTKKGQTSIQERVHKLLATSAQEDV          
Sbjct: 601 SQNGEHRPPSSTDRHKSNSTSFRLVPTKKGQTSIQERVHKLLATSAQEDVSKKASKKTTN 660

Query: 661 XXXXXXLEHQKGDEQSISTGSMSKIDAISMDLSSIAAGNVSKFQFTSVENVLKAAANGSV 720
                 LEHQKGDEQSISTGSMSKIDAISMDLSSIAAGNVSKFQFTSVENVLKAAANGSV
Sbjct: 661 SATSAKLEHQKGDEQSISTGSMSKIDAISMDLSSIAAGNVSKFQFTSVENVLKAAANGSV 720

Query: 721 TAGKKPTTSETSKSAVSASATNSRKAPNCK 750
           TAGKKPTTSETSKSAVSASATNSRKAPNCK
Sbjct: 721 TAGKKPTTSETSKSAVSASATNSRKAPNCK 750

>Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar to
           Ashbya gossypii ADL217W
          Length = 748

 Score =  605 bits (1561), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/659 (51%), Positives = 430/659 (65%), Gaps = 24/659 (3%)

Query: 1   MNQVPQDCLQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGPIQGSLACLKRVHVP 60
           MNQ+PQD  QPG +LTVGSH+VK+++YLTSGGFAQIY CEV+SP      +ACLKRVHVP
Sbjct: 1   MNQLPQDSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDSKVKDVACLKRVHVP 60

Query: 61  DKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFM 120
           DK SLNTLRAEVDAMK+L+G++H+VSYIDSHA+KS  ++G+YEV LLMEYC RGGLI FM
Sbjct: 61  DKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISFM 120

Query: 121 NSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSV 180
           N+RLQ RL EFEVL+IM+ V QGI+AMHAL PPLIHRDIKIENVLI+ +GD KVCDFGSV
Sbjct: 121 NTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGSV 180

Query: 181 SGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCY 240
            GVIRPPKN YE +YVQHDILKNTTAQYRAPEMIDLYR   VDEKSDIWALGVFLYK+CY
Sbjct: 181 CGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLCY 240

Query: 241 FTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRIQG 300
           +TTPFEK GE AIL+A FQFPSYPQY++RLKNLI+VML+E+P+ RPN CQVLEEV RIQG
Sbjct: 241 YTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRIQG 300

Query: 301 VPCPLPNFYLER-MKHGACTPVHHSASQPALPLATHQFSTSTPMVTHPQPPANQMSPLPH 359
            PCP+ NFYLER +K    + + HS SQP + +   Q     P+V     P  Q S LP 
Sbjct: 301 QPCPVKNFYLERSLKQQIPSQLRHSVSQPMIAMNPQQ--AKIPIVI----PQVQNSVLPS 354

Query: 360 GIQPITSNMVYMMHNTTPNIK-DIPRENPAATIQKNALYSMS--GSEHLSALSSDMHFNR 416
                T NM Y+     P  + +  R + A  + K  L S +    +  + +    + ++
Sbjct: 355 N----TMNMGYVTGAFQPASQPNEVRGDTALRVSKAKLLSTACDWDKTQNFVPGSNYNSK 410

Query: 417 PQLENSH--TFSGVGPRSSSNPIKIPRNEIQKFLSGTPPTSAKKPTYVDSETQTGDIITS 474
             +E+ H  T S   PRSS +P++  R  I K ++   P + K+P YVDSE QT D+ + 
Sbjct: 411 ASVESGHLPTSSLPTPRSSVSPVRSGRGNINKIIAAN-PINIKRPVYVDSEMQTTDLASL 469

Query: 475 NKSGSRPFAMXXXXXXXXXXXXXXXTGNSLLGRLSRKTIRSP-TSDKGSNPLKSKSSVGD 533
            K+ SRP ++               TG S +   S +  + P T DK +  + SKS+ GD
Sbjct: 470 KKANSRPLSLSLSSLPSQESFSLHYTGISAVE--SSQQFQGPVTFDKNNLLVNSKSNTGD 527

Query: 534 DLASLLSSPSRNLSFPAQSSKSSKRNSADLSSRKSPVLN---KSRIAMSYSGPEKXXXXX 590
             +S     +R L +   + + +   S+++SS+K P LN   K+  ++S +   +     
Sbjct: 528 SKSSSPELINRTLRYSYHAPEPASWESSEMSSKKLPYLNAILKTPKSLSAAEVSESRRSE 587

Query: 591 XXXXXXXXXXXQNGEHRPPSSTDRHKSNSTSFRLVPTKKGQTSIQERVHKLLATS-AQE 648
                       N     P S   H S+     L+ TK GQ SIQ+RVH LLA S AQE
Sbjct: 588 LERDSLANVPINNEYAVDPDSGGYHPSSGGLVSLLSTKNGQVSIQKRVHLLLANSDAQE 646

>SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095W PRK1 Protein serine/threonine kinase regulates
           the organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 791

 Score =  563 bits (1452), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/671 (47%), Positives = 408/671 (60%), Gaps = 40/671 (5%)

Query: 1   MNQVPQDCLQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGPIQGSLACLKRVHVP 60
           M+Q P +    G +LTVGSH+ +II+YLTSGGFA IYS E+  P P   S+ACLKRV VP
Sbjct: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDPNSSSIACLKRVLVP 60

Query: 61  DKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFM 120
           DKPSLN+LRAEVDAMK+LK H+ VVSYIDSHAAKS  ++G+YEV+LLMEYC RGGLIDFM
Sbjct: 61  DKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDFM 120

Query: 121 NSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSV 180
           N+RLQ RL EFEVLKIMS V+QG+ AMHAL PPLIHRDIKIENVLIS DG+FKVCDFGSV
Sbjct: 121 NTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGSV 180

Query: 181 SGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCY 240
            GVIRPPKN  E NYVQHDILKNTTAQYR+PEMIDLYR LPVDEKSDIWALGVFLYK+CY
Sbjct: 181 CGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLCY 240

Query: 241 FTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRIQG 300
           +TTPFEK GE AIL +KFQFP+YPQY+D+LKNLIS +L E+P+QRPNICQ+L EVSRIQG
Sbjct: 241 YTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEVSRIQG 300

Query: 301 VPCPLPNFYLER--------MKHGACTPVHHSASQPALPLATHQFSTSTPMVTHPQP--- 349
           VPCP+ NFYLER         +     P+ HS SQP +   T       P+   P P   
Sbjct: 301 VPCPVKNFYLERKMLLQQQQQQQQQLQPLRHSVSQPQMEAIT------LPITLQPHPQKV 354

Query: 350 -PANQMSPLPHGIQPITSNMVYMMHNTTPNIKDIP-RENPAATIQKNALYSMSGSEHLSA 407
             + Q+S    G+    +    ++++ +   + +P R +P   + K+ L           
Sbjct: 355 LASAQVSYANTGLTASPTAQQKLLYSRS---QPLPARNDPFLNLDKSNLLPPKTKLEF-- 409

Query: 408 LSSDMHFNRPQLEN-SHTFSGVGPRSSSNPIKIPRNEIQKFLSGTPPTSAKKPTYVDSET 466
              ++ +N+ QL     T      R S +P++  R +I K L   P +  +  +YVDSET
Sbjct: 410 --PELKYNKEQLNGIPATTPYATQRRSVSPVRNGRGDISKILKSNPTSVDRLSSYVDSET 467

Query: 467 QTGDIIT--SNKSGSRPFAMXXXXXXXXXXXXXXXTGNSLLGRLSRKTIRSPTSD-KGSN 523
           QT + I   S                         TG S   R+  K  R  +++ + ++
Sbjct: 468 QTFETIEPLSRSVSRSVSRGSASSASSQDSVEEQSTGGSFTRRIGDKLKRIISNEPRNTS 527

Query: 524 PLKSKSSVGDDLASLLSSPSRNLSFPAQSSKSSKRNSADLSSRK-SPVLNKSRIAMSYSG 582
           P++S+ + G    S  S+  R  S    SS  SKRNS D S R+     NK R++ S S 
Sbjct: 528 PIRSRQNTGGSTRSAFSTLRRGTS-SNFSSDRSKRNSVDFSVRRLGSGGNKVRVSSSKSI 586

Query: 583 PEKXXXXX--------XXXXXXXXXXXQNGEHRPPSSTDRHKSNSTSFRLVPTKKGQTSI 634
            EK                           E +  S +  +    +  ++   ++ + SI
Sbjct: 587 EEKGNTNKFENKGHNRSVSTSSITSDLNKYEGKAGSVSRGYNQAHSPIKMSANRESRNSI 646

Query: 635 QERVHKLLATS 645
           Q+RVH LL  S
Sbjct: 647 QKRVHDLLKNS 657

>KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} similar
           to uniprot|P40494 Saccharomyces cerevisiae YIL095W PRK1
           Protein serine/threonine kinase regulates the
           organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p- Sla1p-End3p
           protein complex
          Length = 790

 Score =  549 bits (1414), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/599 (52%), Positives = 368/599 (61%), Gaps = 54/599 (9%)

Query: 1   MNQVPQDCLQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGPIQ--GSLACLKRVH 58
           MNQ   D  QPG  LTVGSH  +II+YLTSGGFA IY+ E+  P  +     +ACLKRV 
Sbjct: 1   MNQSLNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEIC-PADLSSPAKIACLKRVL 59

Query: 59  VPDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLID 118
           VPDKPSLN LRAEVDAMK+L+G++HVVSYIDSHAAKS  HDG+YEV+LLMEYC  GGLID
Sbjct: 60  VPDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLID 119

Query: 119 FMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFG 178
           FMN+RLQ RL E EVLKI S + QGI AMHAL PPLIHRDIKIENVLIS D  FKVCDFG
Sbjct: 120 FMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFG 179

Query: 179 SVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKV 238
           SV GVIRPPKN  EFNYVQHDILKNTTAQYRAPEMIDLYR  P++EKSDIWALGVFLYK+
Sbjct: 180 SVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKL 239

Query: 239 CYFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRI 298
           CY+TTPFEKVGE AIL ++FQFPSYPQY+D LK+LIS MLSE+P QRPNICQVLEEVSRI
Sbjct: 240 CYYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRI 299

Query: 299 QGVPCPLPNFYLERMKHGACT------PVHHSASQPALPLATHQFSTSTPMVTHPQP--- 349
           QG PCPL NFY+ R                HSASQP L  A +  +    M +H QP   
Sbjct: 300 QGTPCPLRNFYVTRAMQQQQQHQQPKIKFDHSASQPKLDSANNIINVPFKM-SHNQPLRS 358

Query: 350 -------PANQMS--------PLPHGIQPITSNMVYMMHNTTPNIKDIPRENPAATIQKN 394
                  P N  S        PLP  IQP++S+                   P   I+ N
Sbjct: 359 TQTFAGAPVNAASNGYLPALKPLP--IQPVSSSFT---------------NGPFKFIEGN 401

Query: 395 ALYSMSGSEHLS-ALSSDMHFNRPQLENSHTF---SGVGPRSSSNPIKIPRNEIQKFLSG 450
                  + H    +S D  FNR  L  S TF   S +  RSS +P    R +I K +S 
Sbjct: 402 KALQSKQTPHFQPPISHD--FNR--LGRSQTFTPTSTLASRSSVSPPLAGRGDISKIISA 457

Query: 451 TPPTSAKKPTYVDSETQTGDIITSNKSGSRPFAMXXXXXXXXXXXXXXXTGNSLLGRLSR 510
            P      P Y+ S TQT D   S+ +                      TG S   R  +
Sbjct: 458 NPTNVEPSPIYLSSGTQTDDGFASSHALKLERTKSIASLSSSESVESQHTGGSATRRFGQ 517

Query: 511 KTIRSPTSDKGSNPLKSKSSVGDDLASLLSSPSRNLSFPA-QSSKSSKRNSADLSSRKS 568
           K        +  +P+KS+ + GD + S  ++  R  S  + +S   +KRNS D+SS  S
Sbjct: 518 KLKVFTGERRSISPIKSRQNTGDSVRSAFATLRRGFSGGSFKSELPNKRNSLDISSTSS 576

>Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {ON}
           YIL095W (PRK1) - probable serine/threonine-protein
           kinase [contig 27] FULL
          Length = 791

 Score =  530 bits (1364), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 302/596 (50%), Positives = 377/596 (63%), Gaps = 44/596 (7%)

Query: 1   MNQVPQDCLQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGPIQ-GSLACLKRVHV 59
           MNQ        G  LTVGSH+ +II+YLTSGGFA IYS E+    P   G++ACLKRV V
Sbjct: 1   MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLV 60

Query: 60  PDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDF 119
           PDK SLN LRAEVDAMK+L+G++HVVSYIDSHAAKS   DG+YEV+LLMEYC  GGLIDF
Sbjct: 61  PDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDF 120

Query: 120 MNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGS 179
           MN+RLQ RL+E EVLKIMS + QGI AMHAL+PPLIHRDIKIENVLIS D  FKVCDFGS
Sbjct: 121 MNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGS 180

Query: 180 VSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVC 239
           V GVIRPPKNA EF+YVQ+DILKNTTAQYR+PEMIDLYR  P++EKSDIWALGVFLYK+C
Sbjct: 181 VCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLC 240

Query: 240 YFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRIQ 299
           Y+TTPFEKVG+ AIL ++FQFP+YPQY+DRLKNLISVMLSE+P QRPNICQVLEEVSRIQ
Sbjct: 241 YYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRIQ 300

Query: 300 GVPCPLPNFYLERMKHGA------------CTPVHHSASQPALPLATHQFSTSTPMVT-- 345
            VPCPL NFYL R                    VHHS SQP + L       + P++T  
Sbjct: 301 NVPCPLRNFYLLRSMQQQQQQHQQQQQTFPSVEVHHSLSQPRMDLK------NGPVLTPF 354

Query: 346 -HPQPPANQMSPLPHG--IQPITSNMVYMM--HNTTPNIKDIPRENPAATIQKNALYSMS 400
            H Q  A + S    G  +    +N V ++  H   P ++   R +P  +I +  +    
Sbjct: 355 KHAQSSALRTSKTFDGAAMNGSINNYVPVLKPHQAQP-VQQNYRSDPFTSIDRRTVL--- 410

Query: 401 GSEHLSALSSDMHFNRPQLENSHTFSGVG---PRSSSNPIKIPRNEIQKFLSGTPPTSAK 457
             E +    +   F R  L  + TF  V     RSS++P    R +I   +S  P     
Sbjct: 411 -QEKIPLQPASADFQR--LSRAQTFVPVTKSPKRSSASPSFGGRGDISMIVSANPTNVDP 467

Query: 458 KPTYVDSETQT---GDIITSNKSGSRPFAMXXXXXXXXXXXXXXXTGNSLLGRLSRKTIR 514
            P Y++S  QT   G  +  +K  +R   +               TG S      R+  +
Sbjct: 468 TPIYLNSSVQTDNPGSDLYLSKQNTR---LSESSTSSSESIETQSTGGSFSRTFGRRLKK 524

Query: 515 SPTSDKGS-NPLKSKSSVGDDLASLLSSPSRNLSFPAQSSKS-SKRNSADLSSRKS 568
             T +K S +P+KS+ + G+ + S  ++  R  S  +   +  SK+N+ D+++  S
Sbjct: 525 VFTGEKRSISPIKSRQNTGESVKSAFATLRRGFSSGSHKGEQLSKKNTVDVTTNGS 580

>KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095W PRK1 Protein serine/threonine kinase regulates
           the organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 777

 Score =  521 bits (1341), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 292/597 (48%), Positives = 383/597 (64%), Gaps = 39/597 (6%)

Query: 1   MNQVPQDCLQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGPI-QGSLACLKRVHV 59
           MNQ   +    G IL VGSH+VK+++YL SGGFA +YS E+  P P+   ++ACLKRV V
Sbjct: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVV 60

Query: 60  PDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDF 119
           PDK SLNTLRAEVD+MK L+G++ +VSYIDSHA KSP + G YEVYLLMEYC  GGLIDF
Sbjct: 61  PDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDF 120

Query: 120 MNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGS 179
           MN+RLQ RL EFE+L IMS V+QG+ AMHAL PPLIHRDIKIENVL+S + +FK+CDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGS 180

Query: 180 VSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVC 239
           VSGVIR P+N  EFNYVQ+DI+KNTTAQYR PEMIDLYR LP+DEKSDIWALGVFLYK C
Sbjct: 181 VSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTC 240

Query: 240 YFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRIQ 299
           Y+TTPFEK GE+AIL +KF+FP+YP+Y+DR+KNLISVML   P++RPNICQV+EEVSRIQ
Sbjct: 241 YYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEVSRIQ 300

Query: 300 GVPCPLPNFYLERMKHGACTPVHHSASQPALPLATHQFSTSTPMVTHPQPP---ANQMSP 356
           G+PCP+ NFYL RM      P    +  P +P  T   +  T + T   PP   +N  +P
Sbjct: 301 GIPCPIKNFYLLRMMDKQEQP--RVSPPPHVPQMTVPATVPTSVSTQHLPPQVVSNVQTP 358

Query: 357 --------LPH----GIQPITSNMVYMMHNTTPNIKDIPR-------ENPAATIQKNALY 397
                   LP+      QP+ +    ++    P  K +P+        +P + I ++AL 
Sbjct: 359 SKTASIQHLPYLHVSKSQPMVTQQ-DLLSQKQPAGKTVPQTVSNYTSSDPFSKIDRSALL 417

Query: 398 SMSGSEHLSALSSDMHFNRPQLENSHTFS---GVGPRSSSNPIKIPRNEIQKFLSGTPPT 454
           S S +  + +L   M   + + +  H  +    V PR+S +P++  R  I   L+    T
Sbjct: 418 STSAT--MESLPRAMRIPQLEYQQPHLLTRSQSVVPRASVSPVRNGRGAISSILASN-RT 474

Query: 455 SAKKPTYVDSETQTGD---IITSNKSGSRPFAMXXXXXXXXXXXXXXXTGNSLLGRLSRK 511
           S  +P YVDSETQT D    +  ++S SR                   TG SL  ++  K
Sbjct: 475 SLDRPKYVDSETQTSDHPSELGLSRSLSR--KSVASSLSSAESLEATSTGGSLTRKIGSK 532

Query: 512 TIRSPTSDK-GSNPLKSKSSVGDDLASLLSSPSRNLSFPAQSSKSSKRNSADLSSRK 567
             +  T +K G + ++S  + G+ + S  ++  + +S    +  SS R S+ L +RK
Sbjct: 533 MKKVITGEKRGFSTIRSAQNTGESVKSAFNALRKGISSMQFTGDSSSRKSS-LEARK 588

>Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W
           (REAL)
          Length = 808

 Score =  510 bits (1313), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 292/564 (51%), Positives = 360/564 (63%), Gaps = 53/564 (9%)

Query: 5   PQDCL-QPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGP-IQGSLACLKRVHVPDK 62
           PQ  L +PG ILTVGSH  KII+YLTSGGFAQ+Y+ E+  P P    ++ACLKRV VPDK
Sbjct: 4   PQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIVPDK 63

Query: 63  PSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNS 122
             LNTLRAEVDAMK+LK ++HVVSYIDSHAAKS  +   YEV++LME+C RGGLIDFMN+
Sbjct: 64  QGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSV-NGVAYEVFVLMEFCERGGLIDFMNT 122

Query: 123 RLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSG 182
           RLQ RL E E+L+IMS   QGI AMHAL PPLIHRDIKIENVLIS +G +KVCDFGSVSG
Sbjct: 123 RLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGSVSG 182

Query: 183 VIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYFT 242
           VIRPP+N  EFNYVQHDIL NTTAQYR+PEMIDLYR LP+DEKSDIWALG+FLYK+CY+T
Sbjct: 183 VIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKICYYT 242

Query: 243 TPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRIQGVP 302
           TPFEK GE  IL A++Q+P +PQY+DRLKNLI +ML E P +RPNICQVLEEVSR+Q  P
Sbjct: 243 TPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRLQIKP 302

Query: 303 CPLPNFYLERMKHGACTPVHHSASQPALPLATHQFSTSTPMVTHPQPPANQMSPLPHGIQ 362
           CP+ NFYL R           + SQ      T Q ++  P + +   P  +  P   G+Q
Sbjct: 303 CPIRNFYLLR-----------AMSQ------TAQLASEPPSMKY--VPTQKFLP-AQGLQ 342

Query: 363 PI--TSNMVYMMH-NTTPNIKDIPR---ENPAATIQKNALYSMSGSEHLSA--------- 407
            +   SNM+ + H  TTPN+  +PR   +N    + K       G  ++           
Sbjct: 343 SMKPISNMIPVSHVRTTPNLSTLPRSIDDNNMTDVTKQISLQFVGDSNVDTPLKKTKSVP 402

Query: 408 LSSD---MHFNRPQ-LENSHTFSGV----GPRSSSNPIKI--PRNEIQKFLSGTPPTSAK 457
           LS D   +++      + S TF  V     P+  S P     P N I   L  T PT  +
Sbjct: 403 LSDDFASLYYRELHPFQKSQTFKSVENFQSPQRRSMPPSSLPPANSI--ILDKT-PTMNR 459

Query: 458 KPTYVDSETQTGDIITSNKSGSRP-FAMXXXXXXXXXXXXXXXTGNSLLGRLSRKTIRSP 516
              YVDSETQT DIIT + S   P                   +G +++  LS K  +  
Sbjct: 460 PNNYVDSETQTTDIITMSGSKLSPALTNKPVNSQKEFIAPENVSGGNIVRSLSSKLKKVI 519

Query: 517 TSD-KGSNPLKSKSSVGDDLASLL 539
           T + +GS+P+KS+ + GD   S L
Sbjct: 520 TGESRGSSPIKSRQNTGDSTRSAL 543

>CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095w PRK1
          Length = 688

 Score =  496 bits (1277), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 228/313 (72%), Positives = 261/313 (83%), Gaps = 1/313 (0%)

Query: 1   MNQVPQDCLQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGPIQGS-LACLKRVHV 59
           MNQ   D +  G  LTVG+H VKI++YLTSGGFAQIY+ E+LS G   GS +ACLKRV V
Sbjct: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKV 60

Query: 60  PDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDF 119
           PDK SLN LRAEVDAMK+L  ++HVVSYIDSHA +SP +DGTYEV+LLMEYC  GGLIDF
Sbjct: 61  PDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDF 120

Query: 120 MNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGS 179
           MN+RLQ RL+E E+L IMS   QGI  MHALVPPL+HRDIKIENVL+S  G +KVCDFGS
Sbjct: 121 MNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGS 180

Query: 180 VSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVC 239
           VSGVIRPP+N  E  YVQHDI+KNTTAQYR PEM+DLYR LP+DEK+DIWALGVFLYK+C
Sbjct: 181 VSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLC 240

Query: 240 YFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRIQ 299
           Y+TTPFEK+GE AIL A+FQFPS+P Y+DRLKNLI  ML EHP  RPN+CQVLEEVSR+Q
Sbjct: 241 YYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVSRMQ 300

Query: 300 GVPCPLPNFYLER 312
            VPCP+ NFYL R
Sbjct: 301 NVPCPIRNFYLLR 313

>Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W
           (REAL)
          Length = 805

 Score =  500 bits (1288), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 290/578 (50%), Positives = 347/578 (60%), Gaps = 83/578 (14%)

Query: 4   VPQDCL-QPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGPIQ-GSLACLKRVHVPD 61
            PQ  L +PG ILTVGSH  KII+YLTSGGFAQ+YS E+  P P    ++ACLKRV VPD
Sbjct: 3   TPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYSAEISPPDPYSSANIACLKRVIVPD 62

Query: 62  KPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMN 121
           K  LNTLRAEVDAMK+LK ++HVVSYIDSHAAKS  +   YEV++LMEYC RGGLIDFMN
Sbjct: 63  KQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSV-NGVAYEVFVLMEYCERGGLIDFMN 121

Query: 122 SRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVS 181
           +RL+ RL E E+L IM    QGI AMHAL PPLIHRDIKIENVLIS +G +KVCDFGSVS
Sbjct: 122 TRLKNRLQESEILDIMGQTVQGIAAMHALQPPLIHRDIKIENVLISHEGLYKVCDFGSVS 181

Query: 182 GVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYF 241
           GVIRPPKN  EFNYVQHDIL NTTAQYR+PEMIDLYR LP+DEKSDIWALGVFLYK+CY+
Sbjct: 182 GVIRPPKNPQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGVFLYKICYY 241

Query: 242 TTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRIQGV 301
           TTPFEK GE AIL A++Q+PS+PQY+DRLKNLI +ML E P QRPNICQVLEEVSR+Q  
Sbjct: 242 TTPFEKTGEAAILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNICQVLEEVSRLQNR 301

Query: 302 PCPLPNFYLER-MKHGACTPVHHSASQPALPLATHQFSTSTPMVTHPQPPANQMSPLPHG 360
           PCP+ NFYL R M   A                  QF + +  +T+   PA Q+      
Sbjct: 302 PCPIRNFYLLRAMNQNA------------------QFGSESTSMTY--TPAQQL------ 335

Query: 361 IQPITSNMVYMMHNTTP--NIKDIPRENPAATIQKN-----ALYSMS------------- 400
           + P +   +  M N  P  NIK  P  + A+    N     A+  +              
Sbjct: 336 VSPQSFQNIQAMPNIVPLSNIKTTPNLDSASNFVNNNNKMEAMLQLRTQKLETGPNFSIP 395

Query: 401 ---------GSEHLSALSSDMH-FNRPQLENSHTFSGVGPRSSSNPIKIPRNEIQKFLSG 450
                      +  S    ++H F +P     HTF  V    S     IP        S 
Sbjct: 396 LTKTKSVPLSDDFTSLYYKELHPFQKP-----HTFKSVEGSQSPQRKSIP-------FSP 443

Query: 451 TPPTS--------AKKP-TYVDSETQTGDIITSNKSGSRP-FAMXXXXXXXXXXXXXXXT 500
           TP  S          +P  YVDSETQT D I + K    P  +                T
Sbjct: 444 TPVNSNNYDRVSTINRPNNYVDSETQTLDSIATLKLKPSPTISNKTTGFSKESTVPENVT 503

Query: 501 GNSLLGRLSRKTIRSPTSD-KGSNPLKSKSSVGDDLAS 537
           G  ++  LS K  R  T + +  +P+KS+ + GD + S
Sbjct: 504 GGKIVRSLSSKLKRVITGESRNGSPIKSRQNTGDSIRS 541

>YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protein
           serine/threonine kinase; regulates the organization and
           function of the actin cytoskeleton and reduces endocytic
           ability of cell through the phosphorylation of the
           Pan1p-Sla1p-End3p protein complex
          Length = 810

 Score =  496 bits (1276), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 283/563 (50%), Positives = 352/563 (62%), Gaps = 53/563 (9%)

Query: 5   PQDCL-QPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGPI-QGSLACLKRVHVPDK 62
           PQ  L +PG ILTVGSH  KII+YLTSGGFAQ+Y+ E+  P P    ++ACLKRV VP K
Sbjct: 4   PQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANIACLKRVIVPHK 63

Query: 63  PSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNS 122
             LNTLRAEVDAMK+L+ ++HVVSYIDSHAA+S  +   YEV++LME+C RGGLIDFMN+
Sbjct: 64  QGLNTLRAEVDAMKLLRNNKHVVSYIDSHAARSV-NGIAYEVFVLMEFCERGGLIDFMNT 122

Query: 123 RLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSG 182
           RLQ RL E E+L+IMS   QGI AMHAL PPLIHRDIKIENVLIS DG +KVCDFGSVSG
Sbjct: 123 RLQNRLQESEILEIMSQTVQGITAMHALQPPLIHRDIKIENVLISHDGLYKVCDFGSVSG 182

Query: 183 VIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYFT 242
           VIRPP+N  EFNYVQHDIL NTTAQYR+PEMIDLYR LP+DEKSDIWALGVFLYK+CY+T
Sbjct: 183 VIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGVFLYKICYYT 242

Query: 243 TPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRIQGVP 302
           TPFEK GE  IL A++Q+PS+PQY+DRLKNLI +ML E P QRPNICQVLEEVSR+Q  P
Sbjct: 243 TPFEKSGEAGILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNICQVLEEVSRLQNKP 302

Query: 303 CPLPNFYLER-MKHGACTPVHHSASQPALPLATHQFSTSTPMVTHPQPPANQMSPLPH-- 359
           CP+ NFYL R M   A T +    S     + T +F     + +  QPP   M P+ H  
Sbjct: 303 CPIRNFYLLRAMNQNANTQLAGEPSSTTY-VPTQKFIPVQSLQSINQPP--NMMPVTHVS 359

Query: 360 -----GIQPITSN------------MVYMMHN--TTP--NIKDIPRENPAATIQKNALYS 398
                G  PI+ N            +    H+  T+P    K +P  +  A++    L+ 
Sbjct: 360 TTPNLGTFPISINDNNKTEVTAHAGLQVGSHSNLTSPLMKTKSVPLSDEFASLYYKELHP 419

Query: 399 MSGSEHLSALSSDMHFNRPQLENSHTFSGVGPRSSSNPIKIP--RNEIQKFLSGTPPTSA 456
              S+   ++ S   F  PQ            R S  P+ +    N+I   +S       
Sbjct: 420 FQKSQTFKSVES---FQSPQ------------RKSMPPLSLTPVNNDIFDRVSAI----N 460

Query: 457 KKPTYVDSETQTGD-IITSNKSGSRPFAMXXXXXXXXXXXXXXXTGNSLLGRLSRKTIRS 515
           +   YVDSETQT D +   N   S                     G+ ++  LS K  + 
Sbjct: 461 RPNNYVDSETQTIDNMAVPNLKLSPTITSKSLSSTKEIAAPDNINGSKIVRSLSSKLKKV 520

Query: 516 PTSD-KGSNPLKSKSSVGDDLAS 537
            T + +G++P+KS+ + GD + S
Sbjct: 521 ITGESRGNSPIKSRQNTGDSIRS 543

>TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.284
           YNL020C
          Length = 661

 Score =  489 bits (1258), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 265/476 (55%), Positives = 326/476 (68%), Gaps = 28/476 (5%)

Query: 1   MNQVPQDCLQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVL-SPGPIQGSLACLKRVHV 59
           MNQ       PG +LTVGSH  K+I YLTSGGFAQ+YS E+  +   I  ++ACLKRV V
Sbjct: 1   MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIV 60

Query: 60  PDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDF 119
           PDKPSLNTLRAEVDAMK+L+ ++HVVSYIDSHAAKS   +G+YEV+LLMEYC  GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDF 120

Query: 120 MNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGS 179
           MN+RLQ RL EFE+L IMS V QGI AMHAL PPLIHRDIKIENVLIS  G +KVCDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGS 180

Query: 180 VSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVC 239
           V GVIRPP+N  EF YVQHD+LKNTTAQYR+PEMIDLYR  P+DEKSDIWALGVFLYK+C
Sbjct: 181 VCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLC 240

Query: 240 YFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRIQ 299
           Y+TTPFEK GE AIL ++FQFP+ P Y+DRLK LI  ML E+P QRPN+CQVLE+VSR+Q
Sbjct: 241 YYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRMQ 300

Query: 300 GVPCPLPNFYL----ERMKHGACTPVHHSASQPALPLATHQFSTSTPMVTHPQP-PANQM 354
           G+ CP+ NFYL    E+ +      + +S +QP L         + P+++ P   P +Q+
Sbjct: 301 GIQCPVRNFYLLRAMEQQQQSTQNQLRYSRTQPVL---------NVPIISQPVGFPMHQI 351

Query: 355 SPLPHGIQPITSNMVYMMHNTTPNIKDIPRENPAATIQKNALYSMSGSEHLSALSSDMHF 414
           S  P G    TS++V    N+ P +   PR   +A          + S    +  S   F
Sbjct: 352 SGAPLGSS--TSHIV--PSNSVPILAARPR---SAGSNGTGRSFQTPSTSSLSAKSSQTF 404

Query: 415 NRPQLENSHTFSGVGPRSSSNPIKIPRNEIQKFLSGTPPTSAKKPTYVDSETQTGD 470
           +R     + + S V    S++P++  R  I + +     TS  +P YVDS TQT D
Sbjct: 405 HR-----AASRSPVSTHLSTSPVRHGRGNISQIVESN-RTSFDRPRYVDSVTQTSD 454

>KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {ON}
           Anc_2.284 YNL020C
          Length = 780

 Score =  491 bits (1265), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 283/586 (48%), Positives = 367/586 (62%), Gaps = 68/586 (11%)

Query: 1   MNQVPQDCLQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGP-IQGSLACLKRVHV 59
           MN    +    G ILTVGSH  K+I+YLTSGG+AQ+Y  E+    P I  ++ACLKRV V
Sbjct: 1   MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIV 60

Query: 60  PDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDF 119
           PDKPSLNTLRAEVDAMK+LK +RHVVSYIDSHA+KS  ++G YEV++LME+C RGGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDF 120

Query: 120 MNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGS 179
           MNSRLQ RL+E E+L IMSH +QGI AMH L P L+HRDIKIENVLIS + ++KVCDFGS
Sbjct: 121 MNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGS 180

Query: 180 VSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVC 239
           V G++RPPKN  EFN+V HDI+KNTTAQYR+PEM+DL + LP++EKSDIWALGVFLYK+C
Sbjct: 181 VCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLC 240

Query: 240 YFTTPFEKV-GENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRI 298
           Y+TTPFEK  GE AILQA+FQ+PSYP Y+DRLKNLI VMLS++P  RPN+CQVLEEVSR+
Sbjct: 241 YYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSRL 300

Query: 299 QGVPCPLPNFYLER-MKHGACT---PVHH-----SASQPA-----------LPLATHQFS 338
           QG+PCP+ NFYL R M++   T   PV +     + SQP+           LP A  +F+
Sbjct: 301 QGIPCPIRNFYLLRAMENNKRTIEQPVQNVYMPTTLSQPSTQMNLASLNDTLPTAALKFN 360

Query: 339 TSTPMVTHPQPPANQMS---------PLPHGIQPITSNMVYMMHNTTPN---IKDIPREN 386
            +T       PP NQ S         PLP    P+   + ++    +P+    K      
Sbjct: 361 QTTI------PPTNQHSPHLLHTQTLPLPTNDHPVA--ISHVQDKISPHELLKKSSKSLG 412

Query: 387 PAATIQKNALYSMSGSEHLSALSSDMHFNRPQLENSHTFSGVGPRSSSNPIKIPRNEIQK 446
              T  KN +   S  +H + L   +H ++       ++  V   +SS+   +PR     
Sbjct: 413 STGTSNKNVI-DTSAPDHFTKL---LHASK---NTDLSYQPVTVPTSSSLYNLPRAN--- 462

Query: 447 FLSGTPPTS----------AKKPT-YVDSETQTGDIITSNKSGSRPFAMXXXXXXXXXXX 495
            LS +P  S          +K+PT YVD ETQT    ++    +                
Sbjct: 463 -LSSSPQKSWKSINDNYDVSKRPTNYVDEETQTYTGQSTFLRRTSSNRSNRSISSQYSGV 521

Query: 496 XXXXTGNSLLGRLSRKTIRSPTSDKGSNPLKSKSSVGDDLASLLSS 541
               TG+SL+ +LS K     T +     +KS+ + GD + S ++S
Sbjct: 522 QENTTGSSLVRKLSVKLKNVLTGES----IKSRQNTGDSIRSAMNS 563

>Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W
           (REAL)
          Length = 809

 Score =  491 bits (1264), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 282/560 (50%), Positives = 350/560 (62%), Gaps = 47/560 (8%)

Query: 5   PQDCL-QPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGPI-QGSLACLKRVHVPDK 62
           PQ  L  PG +LTVGSH  KII+YLTSGGFAQ+Y+ E+  P P    + ACLKRV VPDK
Sbjct: 4   PQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIVPDK 63

Query: 63  PSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNS 122
             LNTLRAEVDAMK+LK ++HVVSYIDSHAAKS  +   YEV++LME+C RGGLIDFMN+
Sbjct: 64  QGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSV-NGIAYEVFVLMEFCERGGLIDFMNT 122

Query: 123 RLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSG 182
           RLQ+RL E E+L+IMS   QGI AMH L PPLIHRDIKIENVLIS DG +KVCDFGSVSG
Sbjct: 123 RLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGSVSG 182

Query: 183 VIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYFT 242
           VIRPP+N+ EFNYVQHDIL NTTAQYR+PEMIDLYR  P+DEKSDIWALGVFLYK+CY+T
Sbjct: 183 VIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKICYYT 242

Query: 243 TPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRIQGVP 302
           TPFEK GE AIL +++Q+PS+PQY+DRLK LI +ML E P QRPNICQVLEEVSR+Q  P
Sbjct: 243 TPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRLQNEP 302

Query: 303 CPLPNFYLERM----KHGACTP--VHHSASQPALPLATHQ----FSTSTPMVTHPQPPAN 352
           CP+ NFYL R        A  P  V + ++Q  LP  T Q      +  P VTH +   N
Sbjct: 303 CPIRNFYLLRAMGQNAQLASEPPSVTYVSAQQLLPAQTLQGIKHLQSMVP-VTHVRTTPN 361

Query: 353 -------------QMSPLPHGIQPITSNMVYMMHNTTPNIKDIPRENPAATIQKNALYSM 399
                          S LP   QP +      + N     K +P  +  A++    L+  
Sbjct: 362 LGTLTKAITNNNQTESILPVRTQPESD---LNLGNPLMKTKSVPLSDDFASLYYRELHPF 418

Query: 400 SGSEHLSALSSDMHFNRPQLENSHTFSGVGPRSSSNPIKIPRNEIQKFLSGTPPTSAKKP 459
             S+   ++ S   F  PQ +       +   SSS+P+    N+       +  T  +  
Sbjct: 419 QKSQTFKSVES---FQSPQRK-------LSTPSSSSPVNSKNND-----RASTSTVDRPN 463

Query: 460 TYVDSETQTGDIITSNKSGSRPFAMXX-XXXXXXXXXXXXXTGNSLLGRLSRKTIRSPTS 518
            YVDS TQT D + +        A+                TG S++  LS K  +  T 
Sbjct: 464 NYVDSVTQTIDNMAALNLNQSSVAINKPSGPPKESIVPENVTGGSIVRSLSSKLKKVITG 523

Query: 519 D-KGSNPLKSKSSVGDDLAS 537
           + + S+P+KS+ + GD + S
Sbjct: 524 ESRSSSPIKSRQNTGDSIRS 543

>NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {ON} 
          Length = 661

 Score =  483 bits (1244), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 221/311 (71%), Positives = 257/311 (82%), Gaps = 1/311 (0%)

Query: 1   MNQVPQDCLQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGPIQGS-LACLKRVHV 59
           MNQ      QPG +LTVGSH+V++++YLTSGGFAQIY+ ++  P     + +ACLKRV V
Sbjct: 1   MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIV 60

Query: 60  PDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDF 119
           PDKPSLNTLRAEVD MK+L+ + HVVSYIDSHAAK   ++G+YEV+LLMEYC  GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDF 120

Query: 120 MNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGS 179
           MN+RLQ RL E E+L IMS V QGI AMHAL PPL+HRDIKIENVL++  G++KVCDFGS
Sbjct: 121 MNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGS 180

Query: 180 VSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVC 239
           V G+IRPP NA E +YVQHDI+KNTTAQYRAPEMIDLYR LP+DEKSDIWALGVFLYK+C
Sbjct: 181 VCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLC 240

Query: 240 YFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRIQ 299
           Y+TTPFEK GE AIL A FQFP+YPQY+DRLK LI+ ML E P QRPN  QVLEEVS +Q
Sbjct: 241 YYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSSMQ 300

Query: 300 GVPCPLPNFYL 310
            V CP+PNFYL
Sbjct: 301 NVQCPIPNFYL 311

>TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON}
           Anc_2.284 YNL020C
          Length = 717

 Score =  485 bits (1248), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 221/315 (70%), Positives = 258/315 (81%), Gaps = 1/315 (0%)

Query: 1   MNQVPQDCLQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGPIQG-SLACLKRVHV 59
           MNQ       PG  L VG H+V II+YLTSGGFAQIY  +V  P PI G +LACLKRV V
Sbjct: 1   MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIV 60

Query: 60  PDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDF 119
           P+K  LNTLRAEV+AM++LKG  HVV YIDS+AA+S  +DGTYEV  LME+C  GGLIDF
Sbjct: 61  PEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDF 120

Query: 120 MNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGS 179
           MN+RLQ RL EFEVL IM+ V QGI+AMH+L PPLIHRDIKIENVLIS +G++KVCDFGS
Sbjct: 121 MNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGS 180

Query: 180 VSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVC 239
           VSG+IRPPKN  EFN+VQ DI+KNTTAQYR PEM+DLYR  P++EKSDIWALGVFLYK+C
Sbjct: 181 VSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKIC 240

Query: 240 YFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRIQ 299
           Y+TTPFE  GE AIL A++Q+P YP Y+ RLKNLI +ML E P QRPN+CQVLEEVS +Q
Sbjct: 241 YYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQ 300

Query: 300 GVPCPLPNFYLERMK 314
           G+PCPLPNFYL+R +
Sbjct: 301 GIPCPLPNFYLQRQQ 315

>NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284
          Length = 621

 Score =  473 bits (1218), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 214/313 (68%), Positives = 259/313 (82%), Gaps = 1/313 (0%)

Query: 1   MNQVPQDCLQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGP-IQGSLACLKRVHV 59
           MNQ       PG +L+VGSH+ +II+YLTSGGFAQ+Y+ E+    P I  S+ CLKRV V
Sbjct: 1   MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIV 60

Query: 60  PDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDF 119
           PDKPSLNTLRAEVDAMK+L+ + HVVSYIDSHAAK   + G+YEV+LLMEYC RGGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDF 120

Query: 120 MNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGS 179
           MN+RLQ RL E E+L IMS V+QG+ AMHAL PPL+HRDIKIENVL++  G +K+CDFGS
Sbjct: 121 MNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGS 180

Query: 180 VSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVC 239
           V G+IRPP N  EF YVQHDI+KNTTAQYR+PEMI+L + LP++EKSDIWALGVFLYK+C
Sbjct: 181 VCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLC 240

Query: 240 YFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRIQ 299
           Y+TTPFEK GENAIL A FQFP++P Y+DR+K+LI + L+  P QRPNI Q+LEEVS+IQ
Sbjct: 241 YYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKIQ 300

Query: 300 GVPCPLPNFYLER 312
            VPCP+P+FYL+R
Sbjct: 301 NVPCPIPDFYLQR 313

>TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.284
           YNL020C
          Length = 697

 Score =  475 bits (1222), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 226/352 (64%), Positives = 274/352 (77%), Gaps = 8/352 (2%)

Query: 1   MNQVPQDCLQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGPIQG--SLACLKRVH 58
           MNQ       PGIIL VGSH+ KI++YLTSGGFAQ+Y  E+ SP  I    ++ACLKRV 
Sbjct: 1   MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEI-SPYDIHSGSNIACLKRVI 59

Query: 59  VPDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRH----DGTYEVYLLMEYCLRG 114
           VPDK SLN  RAEV+AMK+L+ +++VVSYIDSHAAKS       +G+YEV+LLMEYC   
Sbjct: 60  VPDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGK 119

Query: 115 GLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKV 174
           GLIDFMN+RLQ RL EFE+L IMSHV+QG+ AMHAL PPL+HRDIKIENVLIS   +FK+
Sbjct: 120 GLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKL 179

Query: 175 CDFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVF 234
           CDFGSV GVIRPP N  E ++VQHDILKNTTAQYR+PEM+ L +++P++EKSDIWALGVF
Sbjct: 180 CDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVF 239

Query: 235 LYKVCYFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEE 294
           LYKVCY+TTPFEK GENAIL +++Q+P+YPQY+D LKNLI VML   P +RPNICQV+EE
Sbjct: 240 LYKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEE 299

Query: 295 VSRIQGVPCPLPNFYLER-MKHGACTPVHHSASQPALPLATHQFSTSTPMVT 345
           VSR+QGVPCPL NFYLER ++  A    H +      P    Q S S+P ++
Sbjct: 300 VSRLQGVPCPLKNFYLERAIRQTAVQDNHFNHQMEQFPPLHLQHSISSPALS 351

>KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {ON}
           Anc_2.284 YNL020C
          Length = 369

 Score =  462 bits (1190), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 219/319 (68%), Positives = 264/319 (82%), Gaps = 4/319 (1%)

Query: 1   MNQVPQDCLQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGPIQGS-LACLKRVHV 59
           MNQ   D   PG IL VGSH+V+II+Y+TSGGFAQIY+ E+  P     S +ACLKRV V
Sbjct: 1   MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIV 60

Query: 60  PDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDF 119
           PDKPSLNTLRAEVDAMK+L+ ++HVVSYIDSHA+KS  ++G+YEV+LLMEYC RGGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDF 120

Query: 120 MNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGS 179
           MN+RLQ RL+E EVL I S VAQGI AMHAL PPL+HRDIKIENVLIS    +K+CDFGS
Sbjct: 121 MNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGS 180

Query: 180 VSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVC 239
           VSG+IRPP N  E  YVQHD+LKNTTAQYR+PEMID YR LP+DEKSDIWA+GVFLYK+C
Sbjct: 181 VSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLC 240

Query: 240 YFTTPFEKV-GENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRI 298
           Y+TTPFEK  GE AIL A++++P++P Y++RLK+LI  ML E+P QRPNI QV+EE+S++
Sbjct: 241 YYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKM 300

Query: 299 QGVPCPLPNFYL--ERMKH 315
           Q VPCP+ NFYL  ++ KH
Sbjct: 301 QNVPCPIVNFYLVTQQQKH 319

>NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa]
           {ON} Anc_2.284
          Length = 723

 Score =  471 bits (1212), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 229/361 (63%), Positives = 270/361 (74%), Gaps = 20/361 (5%)

Query: 1   MNQVPQDCLQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGPIQGS-LACLKRVHV 59
           MNQ       PG +LTVGSH  KII+YLTSGGFAQIY+ E+    P   S  ACLKRV V
Sbjct: 1   MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIV 60

Query: 60  PDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDF 119
           PDK  LNTLRAEVDAMK+LK +RHVVSYIDSHAA+S    G YEV+LLMEYC  GGLIDF
Sbjct: 61  PDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDF 120

Query: 120 MNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGS 179
           MN+RLQ RL+E E+L I+S   QG+ AMHAL P LIHRDIKIENVLIS  G+FK+CDFGS
Sbjct: 121 MNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGS 180

Query: 180 VSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVC 239
           V   IRPP+N  E  YVQHD+LKNTTAQYRAPEM+DLYR LP++EKSDIWALGVFLYK+C
Sbjct: 181 VCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLC 240

Query: 240 YFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRIQ 299
           Y+TTPFEK GE AIL +++Q+P++P YTD+LKNLI   L E P +RPNICQ+LEE+SRIQ
Sbjct: 241 YYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISRIQ 300

Query: 300 GVPCPLPNFYLER-------MKHGACTPVHHSA---SQP---------ALPLATHQFSTS 340
           G+PCP+ NFYL R       + +   TP   +A   SQ          A+PLA+ + ST+
Sbjct: 301 GIPCPINNFYLSRTINVQASLMNPIITPTQQTALKHSQSSATISDQSYAVPLASSRSSTT 360

Query: 341 T 341
           T
Sbjct: 361 T 361

>Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON}
           (89266..91407) [2142 nt, 714 aa]
          Length = 713

 Score =  469 bits (1206), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 214/316 (67%), Positives = 252/316 (79%), Gaps = 1/316 (0%)

Query: 1   MNQVPQDCLQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGPIQGS-LACLKRVHV 59
           MNQ        GI L VG H   I++YLTSGG+AQ+Y  ++  P    GS + CLKR+ V
Sbjct: 1   MNQPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIV 60

Query: 60  PDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDF 119
           PDK SLNT RAEVDAMK+L+   HVVSYIDS+AAKS  H+G YEV LLME+C  GGLIDF
Sbjct: 61  PDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDF 120

Query: 120 MNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGS 179
           MN+RLQ RL EFE+L IMS V QG+ AMH+L PPL+HRDIKIENVLIS  G++K+CDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGS 180

Query: 180 VSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVC 239
           V GVIRPP +  EFN+VQHDILKNTTAQYRAPEMIDL R LP+DEKSDIWALGVFLYK+C
Sbjct: 181 VCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLC 240

Query: 240 YFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRIQ 299
           Y+TTPFEK GE AIL +++++ +YP Y+D LKNLI +ML+  P QRPNICQVLEEVSR+Q
Sbjct: 241 YYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQ 300

Query: 300 GVPCPLPNFYLERMKH 315
           G+PCP+ NFYLER  H
Sbjct: 301 GIPCPIKNFYLERAIH 316

>NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {ON}
           Anc_2.284
          Length = 756

 Score =  470 bits (1209), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 222/322 (68%), Positives = 262/322 (81%), Gaps = 9/322 (2%)

Query: 1   MNQVPQDCLQP-GIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGPI----QGSLACLK 55
           MNQ P   L P G +LTVG+H   I +YLTSGGFAQIY+ E+    P+    + ++ACLK
Sbjct: 1   MNQ-PNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEI---TPVDTYSKSNVACLK 56

Query: 56  RVHVPDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGG 115
           RV VP K  LNTLRAEVDAMK+LK +RHVVSYIDS+A KS  ++G+YEV LLMEYC  GG
Sbjct: 57  RVIVPTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGG 116

Query: 116 LIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVC 175
           LIDFMNSRLQ RLSE E+L I+S  AQG+  MHAL P L+HRDIKIENVL SG+G+FK+C
Sbjct: 117 LIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLC 176

Query: 176 DFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFL 235
           DFGSV G IRPP+N  E +YVQHDILKNTTAQYR PEM+DLYR LP+DEKSDIWALGVFL
Sbjct: 177 DFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFL 236

Query: 236 YKVCYFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEV 295
           YK+CY+TTPFEK GENAIL +KFQ+P++P Y+DRLKNLI VMLSE+P +RPNIC++LEE+
Sbjct: 237 YKLCYYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEI 296

Query: 296 SRIQGVPCPLPNFYLERMKHGA 317
           S IQGVPCP+ NFYL R +  A
Sbjct: 297 SSIQGVPCPIQNFYLIRAQQLA 318

>ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} similar
           to uniprot|P40494 Saccharomyces cerevisiae YIL095W PRK1
           Protein serine/threonine kinase regulates the
           organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 704

 Score =  468 bits (1203), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 256/494 (51%), Positives = 317/494 (64%), Gaps = 38/494 (7%)

Query: 11  PGIILTVGSHEVKIIQYLTSGGFAQIYSCEVL-SPGPIQGSLACLKRVHVPDKPSLNTLR 69
           PG +L+VG+H  KI++Y+ SGGFAQ+YS E+  +  P   +  CLKRV +P+K  LN LR
Sbjct: 11  PGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVIIPEKAGLNALR 70

Query: 70  AEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTRLS 129
           AEV+AMK+LKG +HVV YIDSHAA+S   +GTYEV+LLME+C  GGLIDFMN+RLQ RL 
Sbjct: 71  AEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDFMNTRLQNRLK 130

Query: 130 EFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKN 189
           E+E+L IMS V QGI AMHAL PPLIHRDIKIENVLIS DG++KVCDFGSVSG IRPP+N
Sbjct: 131 EYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGSVSGPIRPPRN 190

Query: 190 AYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYFTTPFEKVG 249
             EF +VQHDILKNTTAQYR+PEMIDLYR   +DEKSDIWALG+FLYK+CY+TTPFEK G
Sbjct: 191 PQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLCYYTTPFEKGG 250

Query: 250 ENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRIQGVPCPLPNFY 309
           + AIL +++QF ++P Y+DRLKNLIS MLS+ P+QRPNICQVLEEVSR+QGV  P+ NFY
Sbjct: 251 DQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEVSRMQGVSSPMRNFY 310

Query: 310 LER-MKHGACTPVHHSASQPALPLATHQFSTSTPMVTHPQPPANQM---------SPLPH 359
           L R M+H   T    S   P + +       + P    P  PA  +         +P P 
Sbjct: 311 LLRAMQH---TNTSTSFITPPVSMVNTNTFMAPPAQVAPLTPAQSLGANGMPVGVTPQPM 367

Query: 360 GIQPITSNMVYMMHNTTPNIKDIPRENPAATIQKNALYSMSGSEHLSALSSDMH------ 413
            I   T + +    N  P        NP     +     ++G   +   S DM       
Sbjct: 368 PIMAKTRSGISTGGNIFPGAA-----NPMVVPTQLGPAQVAGPVPMG--SQDMSSGILPP 420

Query: 414 FNRPQLENSHTFSGVGPRSSSNPIKIPRNEIQKFLSGTPPTSAKKP-TYVDSETQTGDI- 471
           FNR     +  FS  GP             I   ++  P T   +P  YVDSETQT D  
Sbjct: 421 FNRASTLPTDGFS-TGPGKDGG-------VITSAVNTGPETIKDRPFNYVDSETQTSDAG 472

Query: 472 -ITSNKSGSRPFAM 484
            IT++K    P A+
Sbjct: 473 SITTSKPYLHPSAV 486

>YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON}
           ARK1Serine/threonine protein kinase involved in
           regulation of the cortical actin cytoskeleton; involved
           in control of endocytosis
          Length = 638

 Score =  453 bits (1166), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 213/336 (63%), Positives = 264/336 (78%), Gaps = 4/336 (1%)

Query: 1   MNQVPQDCLQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGP-IQGSLACLKRVHV 59
           MNQ        G  LTVGSH+V+II+YLTSGGFAQ+YS  +  P P    S+ACLKRV V
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIV 60

Query: 60  PDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDF 119
           PDKPSLNTLRAEVDAM++LK +R+VVSYIDSHAAK+  H+G+YEV++LMEYC RGGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120

Query: 120 MNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGS 179
           MN+RLQ RL EFE+L+IMS V QG+ AMHAL PPLIHRDIKIENVLIS + ++K+CDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180

Query: 180 VSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVC 239
           V G+IRPP+N+ E +YVQ DILKNTTAQYR+PEMID +R LP+DEKSDIWALG+FLYK+C
Sbjct: 181 VCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLC 240

Query: 240 YFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRIQ 299
           Y+TTPFEK G+ AIL  KF+FP YP Y+++LK LI  +L + P  RPN+ Q+L+ +S +Q
Sbjct: 241 YYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQ 300

Query: 300 GVPCPLPNFYLERM--KHGACTPVHH-SASQPALPL 332
            VPCP+ +  + +    H   T +H  SA+Q  L L
Sbjct: 301 NVPCPINDIQVVQAPSSHLNLTELHQLSATQNILSL 336

>Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {ON}
           YNL020C (REAL)
          Length = 639

 Score =  452 bits (1163), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 209/339 (61%), Positives = 266/339 (78%), Gaps = 4/339 (1%)

Query: 1   MNQVPQDCLQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGP-IQGSLACLKRVHV 59
           MNQ        G  LTVGSH+V+I++YLTSGGFAQ+YS  +  P P    ++ACLKRV V
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIVKYLTSGGFAQVYSALISPPDPHSHSNIACLKRVIV 60

Query: 60  PDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDF 119
           PDKPSLNTLRAEVDAM++L+ +R+VVSYIDSHAAK+  H+G+YEV++LMEYC RGGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMRLLRNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120

Query: 120 MNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGS 179
           MN+RLQ RL EFE+L+IMS V QG+ AMHAL PPLIHRDIKIENVLIS + ++K+CDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180

Query: 180 VSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVC 239
           V GVIRPP+N  E +YVQ DI KNTTAQYR+PEM+D++R LP+DEKSDIWALG+FLYK+C
Sbjct: 181 VCGVIRPPRNPQELSYVQQDIFKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 240 YFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRIQ 299
           Y+TTPFEK GE AIL   F+FP YP Y+++L++LI  +L ++P QRPN+ Q+L+ +S +Q
Sbjct: 241 YYTTPFEKGGEPAILSGHFEFPPYPDYSEQLRDLIRDILVQNPCQRPNVYQLLKRISIMQ 300

Query: 300 GVPCPLPNFYLERM--KHGACTPVHH-SASQPALPLATH 335
            VPCP+ +  + +    H   T +H  SA+Q    L +H
Sbjct: 301 NVPCPISDIQVPQAPDSHLNLTELHQLSATQNIRSLNSH 339

>Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {ON}
           YNL020C (REAL)
          Length = 637

 Score =  447 bits (1149), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 216/371 (58%), Positives = 274/371 (73%), Gaps = 16/371 (4%)

Query: 1   MNQVPQDCLQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGP-IQGSLACLKRVHV 59
           MNQ        G  LTVGSH+V+II+YLTSGGFAQ+YS  +  P P    ++ACLKRV V
Sbjct: 1   MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIV 60

Query: 60  PDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDF 119
           PDKPSLNTLRAEVDAM++LK +R+VVSYIDSHAAK+   +G+YEV++LMEYC RGGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDF 120

Query: 120 MNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGS 179
           MN+RLQ RL EFE+L+I+S V QG+ AMHAL PPLIHRDIKIENVLIS + ++K+CDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGS 180

Query: 180 VSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVC 239
           V G+IR P+N+ E +YVQ DILKNTTAQYR+PEMID++R LP+DEKSDIWALG+FLYK+C
Sbjct: 181 VCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 240 YFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRIQ 299
           Y+TTPFEK GE AIL  KF+FP YP Y+++LK+LI  +L ++P  RP++ Q+L+ +S +Q
Sbjct: 241 YYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQ 300

Query: 300 GVPCPLPNFYLERM--KHGACTPVHH-SASQ------------PALPLATHQFSTSTPMV 344
            VPCP+ +    +    H   T +H  SA+Q             ++P    QFST   M 
Sbjct: 301 NVPCPINDIQTVQAPSSHLNLTELHQLSATQNIQSLNSHLVMGNSIPTTAFQFSTPVNMA 360

Query: 345 THPQPPANQMS 355
           T    P  + S
Sbjct: 361 TAQTLPIKEES 371

>TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON}
           Anc_2.284 YNL020C
          Length = 1443

 Score =  464 bits (1193), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 204/317 (64%), Positives = 253/317 (79%), Gaps = 3/317 (0%)

Query: 1   MNQVPQDCLQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGPIQ---GSLACLKRV 57
           MNQ      + G +L +G+H+V I +YL  GGFAQ+YS  V+     +   G++ACLKRV
Sbjct: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV 60

Query: 58  HVPDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLI 117
            VPDK  LNTLRAEVDAMK+LKG++++VSYIDSHA +S    G YEV+LLMEYC RGG+I
Sbjct: 61  IVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI 120

Query: 118 DFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDF 177
           DF+N+RL  RL EFE+LKIMS V QG+ AMH L PPLIHRDIKIENVLIS +GD+K+CDF
Sbjct: 121 DFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDF 180

Query: 178 GSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYK 237
           GS   V+RPPK   E  ++ HDI+ NTTAQYR+PEMID Y   P+DEKSDIWALGVFLYK
Sbjct: 181 GSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYK 240

Query: 238 VCYFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSR 297
           +CY+TTPFEK GENAIL  KFQFPSYPQY+D ++N+I++ML++ P++RPNICQVLE+VS+
Sbjct: 241 LCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSK 300

Query: 298 IQGVPCPLPNFYLERMK 314
           +QGVPCP+ NF L R+K
Sbjct: 301 LQGVPCPIENFMLTRIK 317

>Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {ON}
           YNL020C (REAL)
          Length = 632

 Score =  436 bits (1121), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 196/306 (64%), Positives = 248/306 (81%), Gaps = 1/306 (0%)

Query: 1   MNQVPQDCLQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGP-IQGSLACLKRVHV 59
           MNQ        G  LTVGSH+V+II+YLTSGGFAQ+YS  +  P P    ++ACLKRV V
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIV 60

Query: 60  PDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDF 119
           PDK SLNTLRAEVDAMK+L+ +R+VVSYIDSHAAK+  H+G+YEV++LMEYC RGGLIDF
Sbjct: 61  PDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDF 120

Query: 120 MNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGS 179
           MN+RLQ RL E E+L+IM  V QG+ AMHAL PPLIHRDIKIENVLIS   ++K+CDFGS
Sbjct: 121 MNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGS 180

Query: 180 VSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVC 239
           V GVIRPP+N  E +YV+ D+LKNTTAQYR+PEM+D++R LP+DEKSDIWALG+FLYK+C
Sbjct: 181 VCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 240 YFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRIQ 299
           Y+TTPFEK GE AIL  +F+F  YP Y+++L+NLI  +L ++P QRPN+ Q+L++++ +Q
Sbjct: 241 YYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNMQ 300

Query: 300 GVPCPL 305
             P P+
Sbjct: 301 NAPYPI 306

>KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {ON}
           Anc_2.284 YNL020C
          Length = 592

 Score =  431 bits (1108), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 200/324 (61%), Positives = 250/324 (77%), Gaps = 1/324 (0%)

Query: 1   MNQVPQDCLQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGPIQGS-LACLKRVHV 59
           MNQ        G  LTVGSH+V+II+YLT+GGFAQIY   +    P  G+ +ACLKRV V
Sbjct: 1   MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIV 60

Query: 60  PDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDF 119
           PDKPSLN LRAEVDAMK+L+ +R VVSYIDSHAAKS   +GTYEV+LLMEYC  GGLI+F
Sbjct: 61  PDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINF 120

Query: 120 MNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGS 179
           +NSRLQ RL E EV+ IM  V+QG+ AMHAL PPL+HRDIKIENVL+S + +FK+CDFGS
Sbjct: 121 LNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGS 180

Query: 180 VSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVC 239
           VSG IRPP N  E   VQ+DI++NTTAQYR+PEMID+ R  P+DEKSDIWALGVFLYK+C
Sbjct: 181 VSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKIC 240

Query: 240 YFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRIQ 299
           Y+TTPFEK GE  IL ++++FP++P Y+DRL++LIS +L+  P  RPNI  V++E+S ++
Sbjct: 241 YYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKELSDMK 300

Query: 300 GVPCPLPNFYLERMKHGACTPVHH 323
            + CP+ NFYL+     A   + H
Sbjct: 301 NISCPIINFYLKPNMTDASNNIQH 324

>KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {ON}
           Anc_2.284 YNL020C
          Length = 788

 Score =  430 bits (1105), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 253/569 (44%), Positives = 337/569 (59%), Gaps = 40/569 (7%)

Query: 1   MNQVPQDCLQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGP--IQGSLACLKRVH 58
           MNQ       PG ++ VGSH+ KI++YLTSGGFAQIYS E+ SP       ++ACLKRV 
Sbjct: 1   MNQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEI-SPKDEYTNSNIACLKRVI 59

Query: 59  VPDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLID 118
           VP+K  LN LR EVDAMK+LK +RHVVSYIDS+AAKS   +G+YEV+LLMEYC RG L+D
Sbjct: 60  VPNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLD 119

Query: 119 FMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFG 178
           FMN++L+ RL E EVL IM+ V QGI AMH L+PPLIHRDIKIENVLISGDG FKVCDFG
Sbjct: 120 FMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFG 179

Query: 179 SVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKV 238
           SV G+IRPP+N  E  YVQHD++KNTTAQYR+PEMIDL +  P++ K           ++
Sbjct: 180 SVCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQI 239

Query: 239 CYFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRI 298
                 F +  E AIL  ++Q+P+YP Y+DRLKN++ V+LS HPV+RPNICQ+LEE+S+I
Sbjct: 240 MLLHYTFREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEISKI 299

Query: 299 QGVPCPLPNFYLERMKH-GACT--PVHHSASQPALPLATHQFSTSTPMVTHPQPPANQMS 355
           Q +PCP+ NFYLER +H GA +  PV+ S +       T QF+  +   T       ++S
Sbjct: 300 QNIPCPIDNFYLERSRHQGAVSVMPVNFSRAN------TTQFTDQSAKETTAIRVGKEIS 353

Query: 356 PLPHGIQPITSNM--VYMMHNTTPNIKDIPRENPAATIQKNALYSMSGSEHLSALSSDMH 413
           PL   + PI S+   V +M  TTPN  +     P   I  N   +         L + + 
Sbjct: 354 PLKPQLSPIKSSYGPVLVMTKTTPNSFNSHHTPPPIGIVSNKTIA-------KPLYNSLE 406

Query: 414 FNRPQLENSHTFSGV------GPRSSSNPIKIPRNEIQKFLSGTPPTSAKKPTYVDSETQ 467
                LEN +  S V        + +++ I   RN  +  +     T +K  TYVDSETQ
Sbjct: 407 DGNNGLENHYLSSSVPAISYLANQHANDNI---RNTTKLNIPAQNSTGSKNKTYVDSETQ 463

Query: 468 TGDIITSNKSGSRPFAMXXXXXXXXXXXXXXXTGNSLLGRLSRKTIRSPTSD-KGSNPLK 526
           T +          P                  TGNS++ RL  +     T+D   S+ + 
Sbjct: 464 TLE---------EPSLQHTRILPHISTDRTDNTGNSIVSRLGVQLRNVITNDSSASSSID 514

Query: 527 SKSSVGDDLASLLSSPSRNLSFPAQSSKS 555
           +    G+ + S + S   ++S  A + K+
Sbjct: 515 TVQETGNSIKSAIESLKNSVSGMANNVKA 543

>Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa]
           {ON} complement(102096..104201) [2106 nt, 702 aa]
          Length = 701

 Score =  424 bits (1089), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 193/316 (61%), Positives = 247/316 (78%), Gaps = 7/316 (2%)

Query: 1   MNQVPQDCLQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEV----LSPGPIQGSLACLKR 56
           MNQ       P  ++TVGSH  KI++YL SGG+AQ+YS  V     SP     ++ACLKR
Sbjct: 1   MNQDQLPLYVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPAT---NIACLKR 57

Query: 57  VHVPDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGL 116
           V VPDK SLN LRAEVDA+K+L+  ++VVSYIDSHA+K   H G+YEV++LMEYC  G L
Sbjct: 58  VVVPDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSL 117

Query: 117 IDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCD 176
           IDF+N+RL+ RL E E+L IM+ VA G+  MH L P LIHRDIKIEN+LIS +G++KVCD
Sbjct: 118 IDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCD 177

Query: 177 FGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLY 236
           FGSV GVIRPP++  E  Y+QHDI+KNTTAQYR+PEM+DL +   ++EKSDIWALGVFL+
Sbjct: 178 FGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLF 237

Query: 237 KVCYFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVS 296
           K+CY+TTPFEK GE AIL+++FQ+P+YP Y+D LKN+I V+LS  P +RPNICQ++EE+S
Sbjct: 238 KLCYYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELS 297

Query: 297 RIQGVPCPLPNFYLER 312
           R+QG+  P+ NFYL R
Sbjct: 298 RLQGIVPPMKNFYLSR 313

>CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} similar
           to uniprot|P53974 Saccharomyces cerevisiae YNL020c ARK1
           or uniprot|P40494 Saccharomyces cerevisiae YIL095w PRK1
          Length = 622

 Score =  421 bits (1082), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 190/302 (62%), Positives = 238/302 (78%), Gaps = 1/302 (0%)

Query: 10  QPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGPIQGS-LACLKRVHVPDKPSLNTL 68
           +PG  +TVGSH V I++YLTSGG+AQIYS +++      G+ +A LKRV VPDK  LNTL
Sbjct: 10  EPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIVPDKSHLNTL 69

Query: 69  RAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTRL 128
           RAEVDAMK LK H+++VSYIDSHAAKS   DGTYEV+L+MEYC RGGLIDFMN+RLQ RL
Sbjct: 70  RAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDFMNTRLQNRL 129

Query: 129 SEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPK 188
           +E E+L I  H++QG+ AMH L PPLIHRDIKIENVLIS D  +K+CDFGSVSG IRPPK
Sbjct: 130 TETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGSVSGYIRPPK 189

Query: 189 NAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYFTTPFEKV 248
              E  YV+HDI+ +TTAQYRAPEM+DL +   V++KSDIWALGVFLYK+CY+TTPFE+ 
Sbjct: 190 TPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLCYYTTPFEQT 249

Query: 249 GENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRIQGVPCPLPNF 308
           GE  IL    +FP YP Y+D +K LI  ML+++P+ RPNI Q+++ VS++  V CP+PN 
Sbjct: 250 GEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKLLNVNCPIPNI 309

Query: 309 YL 310
           ++
Sbjct: 310 HV 311

>TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {ON}
           Anc_2.284 YNL020C
          Length = 707

 Score =  424 bits (1089), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 204/373 (54%), Positives = 267/373 (71%), Gaps = 11/373 (2%)

Query: 1   MNQVPQDCLQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGP-IQGSLACLKRVHV 59
           M+Q+ +D  + G  L V SHEV I  YLTSGGFAQ+Y+  + S    +   L CLKRV V
Sbjct: 1   MSQIFEDKYKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIV 60

Query: 60  PDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDF 119
           P+K SLN LRAEVDAMK+LK ++++VSYIDSHA +    + +Y V LLMEYC   GL+DF
Sbjct: 61  PNKQSLNILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDF 120

Query: 120 MNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGS 179
           MN RL+ RL E E+LKIM+ V+QG+  MH L PPL+HRDIKIENVL+SGDG+FK+CDFGS
Sbjct: 121 MNLRLKERLKEEEILKIMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGS 180

Query: 180 VSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVC 239
           VSGV+R P ++ EF Y+Q+DILKNTTAQYR+PEM++L    P++EKSDIWALG+ LYK+C
Sbjct: 181 VSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLC 240

Query: 240 YFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRIQ 299
           Y+TTPFE+ G  AI++ KF +P+YPQYTD LKN+I V+LS +P+QRPNICQ+LEE+ RIQ
Sbjct: 241 YYTTPFEEHGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFRIQ 300

Query: 300 GVPCPLPNFYLERMKHGACTPVHHSASQP-ALPLATHQFSTSTPMVTHPQPPANQMSPLP 358
               PLPNFY++R    A + +    +QP  +P+  +    S P+++    P+       
Sbjct: 301 HKSSPLPNFYVQR----AMSSLQMDTTQPHRIPILKYT-QMSKPVISSQSSPSKHCQTFS 355

Query: 359 HG----IQPITSN 367
                 IQP  SN
Sbjct: 356 QKDYPYIQPNLSN 368

>KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.273
           YBR059C
          Length = 913

 Score =  313 bits (803), Expect = 8e-94,   Method: Compositional matrix adjust.
 Identities = 162/320 (50%), Positives = 209/320 (65%), Gaps = 21/320 (6%)

Query: 10  QPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVL----------SPGPIQ----GSLACLK 55
           QPG ++ VGSH V+I+QY+  GGFAQIYS + L          SPG       G LACLK
Sbjct: 19  QPGKVIVVGSHRVEILQYIAEGGFAQIYSVKFLEYANEFDREESPGSKDQLQVGDLACLK 78

Query: 56  RVHVPDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAK------SPRHDGTYEVYLLME 109
           RV V D+  LN LR EV+ MK L G  ++V Y DS+A++      S   +  +EV LLME
Sbjct: 79  RVIVQDQNGLNELRNEVNVMKKLVGAPNIVQYYDSNASRLRNGTDSQPQENKFEVLLLME 138

Query: 110 YCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGD 169
            C    L+D+MN RL T+LSE E+L++M  V+  I  MH L  PLIHRDIKIENVL+   
Sbjct: 139 LCPNKSLLDYMNLRLATKLSEQEILEVMYDVSLAIAQMHYLRKPLIHRDIKIENVLVDQK 198

Query: 170 GDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIW 229
             FK+CDFGS S          +  Y+  +I  +TT QYR+PEMIDLYR LP+DEKSDIW
Sbjct: 199 NRFKLCDFGSTSTCFPMVVTHRDIAYLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIW 258

Query: 230 ALGVFLYKVCYFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNIC 289
           ALG+FLYK+ +FTTPFE+ G+ AIL +KF+FP    Y+ +L NLI VMLSE+P  RPNI 
Sbjct: 259 ALGIFLYKLLFFTTPFERTGQFAILHSKFEFPQN-NYSFKLINLIIVMLSENPNLRPNIY 317

Query: 290 QVLEEVSRIQGVPCPLPNFY 309
           QVL ++ +++ VP P+ + Y
Sbjct: 318 QVLHQICQLKQVPIPIADKY 337

>KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {ON}
           Anc_3.273 YBR059C
          Length = 912

 Score =  312 bits (800), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 161/325 (49%), Positives = 207/325 (63%), Gaps = 27/325 (8%)

Query: 9   LQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLS--------PGPIQ------------ 48
             PG ++ VG H+V+II+YL  GGFAQIYS   +         P   +            
Sbjct: 19  FNPGAVVAVGRHKVEIIKYLAEGGFAQIYSVNFIEYLNEFSNEPDSTEDSNIDEFQQFKL 78

Query: 49  --GSLACLKRVHVPDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGT--YEV 104
             G+LACLKRV VPD+  LN LR EV+ M+ LKG  ++V Y DS+A++  RHDG   +EV
Sbjct: 79  EPGNLACLKRVMVPDENGLNELRNEVNVMRKLKGTPNIVQYYDSNASR--RHDGNPGFEV 136

Query: 105 YLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENV 164
            LLME C    L+D+MN RL T+LSE E+LKIM  V  GI  MH L  PLIHRDIKIENV
Sbjct: 137 LLLMELCPNNSLLDYMNQRLTTKLSEKEILKIMYDVTLGISQMHYLQKPLIHRDIKIENV 196

Query: 165 LISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDE 224
           L+    +FK+CDFGS S       +  E   +  +I  +TT QYR+PEMIDLYR LP+DE
Sbjct: 197 LVDSSNNFKLCDFGSTSACFPIVTSHQEIAVLTQNIYVHTTPQYRSPEMIDLYRNLPIDE 256

Query: 225 KSDIWALGVFLYKVCYFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQ 284
           KSDIWALGVFLYK+ ++TTPFE  G+ AIL +K++ P    Y+ RL NLI +ML+E+P  
Sbjct: 257 KSDIWALGVFLYKLLFYTTPFEMTGQFAILHSKYEIPPN-NYSSRLINLIIIMLAENPNL 315

Query: 285 RPNICQVLEEVSRIQGVPCPLPNFY 309
           RPNI QV+ +V    G+  P+ + Y
Sbjct: 316 RPNIYQVMHQVCITIGIEPPIKDKY 340

>SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some
           similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 858

 Score =  309 bits (792), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 159/312 (50%), Positives = 207/312 (66%), Gaps = 14/312 (4%)

Query: 9   LQPGIILTVGSHEVKIIQYLTSGGFAQIY-------SCEVLSPGP--IQGSLACLKRVHV 59
           L PG ++ VGSH+V+I++YL  GGFA IY       S E+ +P     +G LACLKRV V
Sbjct: 32  LAPGTLIIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACLKRVLV 91

Query: 60  PDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGT--YEVYLLMEYCLRGGLI 117
            D+  LN LR EV+ MK LK   ++V Y DS+A++  R DG+  YEV LLME C    L+
Sbjct: 92  TDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASR--RRDGSPGYEVLLLMELCPNKSLL 149

Query: 118 DFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDF 177
           D+MN RL T+LSE EVLKIM  V + +  MH L  PLIHRDIKIENVL+  + +FK+CDF
Sbjct: 150 DYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKLCDF 209

Query: 178 GSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYK 237
           GS S          +   + ++I  +TT QYRAPEMIDLYR LP+DEKSDIWALG+FLYK
Sbjct: 210 GSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIFLYK 269

Query: 238 VCYFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSR 297
           + ++TTPFE  G+ AIL +K+  P+   Y+ +L NLI +ML+E+P  RPNI QV+ +V  
Sbjct: 270 LLFYTTPFELTGQFAILHSKYDIPA-NNYSSKLINLIIIMLAENPNLRPNIYQVIYQVCA 328

Query: 298 IQGVPCPLPNFY 309
           I  V  P  + Y
Sbjct: 329 IMKVDVPFEDKY 340

>Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON}
           (72364..75669) [3306 nt, 1102 aa]
          Length = 1101

 Score =  310 bits (793), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 157/311 (50%), Positives = 201/311 (64%), Gaps = 16/311 (5%)

Query: 12  GIILTVGSHEVKIIQYLTSGGFAQIYSCEVL----------SPGPIQ-GSLACLKRVHVP 60
           G  + VG+ +V+I++YLT GGFAQIY  + L          S  P++ G LACLKRV V 
Sbjct: 28  GSTVVVGNKKVEIVKYLTEGGFAQIYIVKFLENSNEFDSNNSNIPLKIGDLACLKRVLVQ 87

Query: 61  DKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGT--YEVYLLMEYCLRGGLID 118
           D+  LN +R EV+ MK+LKG  ++V Y DS+A++  R DGT  +EV LLME C    L+D
Sbjct: 88  DENGLNEMRNEVEVMKLLKGAPNIVQYFDSNASR--RKDGTNGFEVLLLMELCPNKSLLD 145

Query: 119 FMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFG 178
           FMN RL T+LSE E+L IM  V   +  MH L PPLIHRDIKIENVL+     FK+ DFG
Sbjct: 146 FMNQRLTTKLSEKEILTIMHDVTLAVAQMHTLSPPLIHRDIKIENVLVDSQNGFKLADFG 205

Query: 179 SVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKV 238
           S S          +   +  DI  +TT QYR+PEMIDLY+ LP+DEKSDIWALG+FLYK+
Sbjct: 206 STSKCFPAVSAHQDIAILSQDIFMHTTPQYRSPEMIDLYKCLPIDEKSDIWALGIFLYKL 265

Query: 239 CYFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRI 298
            ++ TPFE  G+ AIL +K+ FP    Y+ RL NLI +MLSE+P  RPNI QVL E+  I
Sbjct: 266 LFYITPFEMTGQFAILHSKYDFPQ-TNYSSRLINLIIIMLSENPNLRPNIYQVLHEICSI 324

Query: 299 QGVPCPLPNFY 309
            G    + + Y
Sbjct: 325 SGTRLEITDKY 335

>Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)
           [2517 nt, 839 aa]
          Length = 838

 Score =  303 bits (777), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 156/315 (49%), Positives = 204/315 (64%), Gaps = 15/315 (4%)

Query: 7   DCLQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVL------SPGPIQ----GSLACLKR 56
           D   PG I+ VG H+V++++YL  GGFA+IY  + L       P   +    G   CLKR
Sbjct: 27  DSYVPGTIVIVGIHKVEVVKYLAEGGFAKIYVVKFLEYLSTVDPNGKEVLQNGDQLCLKR 86

Query: 57  VHVPDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGT--YEVYLLMEYCLRG 114
           V V D   LN +R EV+ M+ LKG   VV Y DS+A++  R DG   YEV LLME C   
Sbjct: 87  VLVQDDNGLNEMRNEVEVMRKLKGAPCVVQYYDSNASR--RIDGAPGYEVLLLMELCSNN 144

Query: 115 GLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKV 174
            L+D+MN RL T+LSE E+LKIM  V   +  MH L  PLIHRDIKIENVL+    +FK+
Sbjct: 145 SLLDYMNQRLATKLSEDEILKIMFDVTLAVAQMHYLPSPLIHRDIKIENVLVDSKNNFKL 204

Query: 175 CDFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVF 234
           CDFGS S  +    +  +   +  +I  +TT QYR+PEMIDLYR LPV+EKSDIWALGVF
Sbjct: 205 CDFGSTSTCLPIVSSHQDIAILTQNIYVHTTPQYRSPEMIDLYRCLPVNEKSDIWALGVF 264

Query: 235 LYKVCYFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEE 294
           LYK+ ++TTPFE+ G+ AIL +K++FP    Y+ +L NLI VML+E+P  RPNI QVL +
Sbjct: 265 LYKLMFYTTPFERTGQFAILHSKYEFP-LNNYSSKLINLIIVMLAENPNLRPNIYQVLNQ 323

Query: 295 VSRIQGVPCPLPNFY 309
           +  I G+  P+ + Y
Sbjct: 324 ICYISGIKNPMDDAY 338

>TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {ON}
           Anc_3.273 YBR059C
          Length = 1061

 Score =  308 bits (788), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 156/313 (49%), Positives = 202/313 (64%), Gaps = 16/313 (5%)

Query: 12  GIILTVGSHEVKIIQYLTSGGFAQIYSCEVLS--------PG------PIQ-GSLACLKR 56
           G  + VGSH+V++I+Y+  GGFAQIY+ + +         PG      P+Q G +ACLKR
Sbjct: 102 GTPVAVGSHKVEVIKYIAEGGFAQIYTVKFIERLNEFASLPGGNQNQKPLQPGDIACLKR 161

Query: 57  VHVPDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGL 116
           V V D   LN +R EV+ M+ L+G   VV Y DS+A+        YEV LLME+C    L
Sbjct: 162 VLVNDDNGLNEMRNEVNVMQKLQGAPCVVQYYDSNASHRSDSAPGYEVLLLMEFCPNNSL 221

Query: 117 IDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCD 176
           +D+MN RL TRLSE E++KIM     GI  +H L  PLIHRDIKIENVL+  + +FK+CD
Sbjct: 222 LDYMNDRLATRLSEKEIMKIMYDTTLGIAQLHYLKTPLIHRDIKIENVLVDQENNFKLCD 281

Query: 177 FGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLY 236
           FGS S       N  +      +I  NTT QYR+PEMIDLYR  P+DEKSDIWALGVFLY
Sbjct: 282 FGSTSICFPIVTNHRDIAIFTQNIYVNTTPQYRSPEMIDLYRYQPIDEKSDIWALGVFLY 341

Query: 237 KVCYFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVS 296
           K+ +FTTPFE+ G+ AIL +K++FP    Y+ +L NLI +ML+E+P  RPNI QVL+ + 
Sbjct: 342 KLLFFTTPFERTGQFAILHSKYEFPKN-NYSSKLINLIIIMLAENPSVRPNIYQVLQYLC 400

Query: 297 RIQGVPCPLPNFY 309
            I G   PL + Y
Sbjct: 401 SINGWKVPLNDKY 413

>KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa]
           {ON} Anc_3.273 YBR059C
          Length = 1091

 Score =  308 bits (788), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 155/316 (49%), Positives = 208/316 (65%), Gaps = 21/316 (6%)

Query: 12  GIILTVGSHEVKIIQYLTSGGFAQIYSCEV------LSPGPIQ----------GSLACLK 55
           G  + VGSH V+I++YLT GGFAQIY  ++           IQ          G L CLK
Sbjct: 32  GESVAVGSHGVEIVKYLTEGGFAQIYLVKLTEYLNEFDAIDIQNQRQQQELKIGDLVCLK 91

Query: 56  RVHVPDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGG 115
           RV V D+  L+ ++ EV+ MK L+G  +VV Y DS+A ++   +G +EV+LLMEYC    
Sbjct: 92  RVMVYDEAGLSEMKNEVNVMKQLRGKPNVVQYYDSNATRNRGANGGFEVFLLMEYCPNKS 151

Query: 116 LIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVC 175
           L+D+MN RL T+L+E E+L IM  +  G+  +H L  PLIHRDIKIENVL+  +  FK+C
Sbjct: 152 LLDYMNQRLTTKLTESEILNIMYDITLGVSQLHFLDNPLIHRDIKIENVLVDHNNRFKLC 211

Query: 176 DFGSVSGVIRPP--KNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGV 233
           DFGS +  I PP      + + + HDI  +TT QYR+PEMIDL+R LPV+EK+DIWALGV
Sbjct: 212 DFGSTN--ICPPIATTNQDISVLTHDIYVHTTPQYRSPEMIDLFRCLPVNEKADIWALGV 269

Query: 234 FLYKVCYFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLE 293
           FLYK+ ++TTPFE  G+ AIL +K++ P    Y++RL NLI VML+E+P  RPNI QVL 
Sbjct: 270 FLYKLLFYTTPFELTGQFAILHSKYEIPQ-SHYSERLLNLIVVMLAENPNLRPNIYQVLS 328

Query: 294 EVSRIQGVPCPLPNFY 309
           E+  I  V  P+P+ Y
Sbjct: 329 EICSILNVEVPIPDIY 344

>NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]
           {ON} Anc_3.273
          Length = 1095

 Score =  308 bits (788), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 152/314 (48%), Positives = 205/314 (65%), Gaps = 16/314 (5%)

Query: 11  PGIILTVGSHEVKIIQYLTSGGFAQIYSCEV-----------LSPGPIQGSLACLKRVHV 59
           PG  + VG+H+V+II+Y+  GGFAQIY+ +            + P    G +ACLKRV V
Sbjct: 24  PGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDVACLKRVLV 83

Query: 60  PDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDG--TYEVYLLMEYCLRGGLI 117
            D+  LN +R EV+ MK L+G  ++V Y DS+A++  RH+G   +EV LLME C    L+
Sbjct: 84  QDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASR--RHNGFPGFEVLLLMELCPNKSLL 141

Query: 118 DFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDF 177
           D+MN RL T+L+E E+LKIM  V   +  MH L  PL+HRDIKIENVL+    +FK+CDF
Sbjct: 142 DYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNNFKLCDF 201

Query: 178 GSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYK 237
           GS S          +   +  +I  +TT QYR+PEMIDLYR LP+DEKSDIWALG+FLYK
Sbjct: 202 GSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLYK 261

Query: 238 VCYFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSR 297
           + +FTTPFE  G+ AIL +K++FP    Y+ +L NLI +ML+E+P  RPNI QVL  +  
Sbjct: 262 LLFFTTPFELTGQFAILHSKYEFPKN-NYSSKLINLIIIMLAENPNLRPNIYQVLHNICS 320

Query: 298 IQGVPCPLPNFYLE 311
           I G+  P+ + Y E
Sbjct: 321 ISGMKVPIEDQYAE 334

>Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {ON}
           YBR059C (REAL)
          Length = 1107

 Score =  305 bits (781), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 156/313 (49%), Positives = 207/313 (66%), Gaps = 15/313 (4%)

Query: 11  PGIILTVGSHEVKIIQYLTSGGFAQIYSCEVL---------SPGPIQ-GSLACLKRVHVP 60
           PG I+ VG+H+V+I+ YL  GGFAQIY+ + L         +  P++ G +ACLKRV V 
Sbjct: 24  PGKIVCVGTHKVEIVNYLAEGGFAQIYAVKFLEYLNEFDNTASLPLKIGDVACLKRVLVH 83

Query: 61  DKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGT--YEVYLLMEYCLRGGLID 118
           D+  LN +R EV+ MK LKG  +VV Y DS+A++  R DG   +EV LLME C    L+D
Sbjct: 84  DENGLNEMRNEVEVMKKLKGAANVVQYYDSNASR--RRDGVQGFEVLLLMELCPNKSLLD 141

Query: 119 FMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFG 178
           +MN RL T+LSE E++KIM  VA  I  MH L  PLIHRDIKIENVL+  + +FK+ DFG
Sbjct: 142 YMNQRLSTKLSESEIVKIMYDVALSISEMHYLPVPLIHRDIKIENVLVDAENNFKLADFG 201

Query: 179 SVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKV 238
           S S          +   +  +I  +TT QYR+PEMIDLYR LP++EKSDIWALG+FLYK+
Sbjct: 202 STSTSFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKL 261

Query: 239 CYFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRI 298
            +FTTPFE  G+ AIL +K++FP   +Y+ +L NLI +ML+E+P  RPNI QVL  +  I
Sbjct: 262 LFFTTPFEMTGQFAILHSKYEFP-VNKYSSKLINLIIIMLAENPNLRPNIYQVLYHICDI 320

Query: 299 QGVPCPLPNFYLE 311
                P+ + Y E
Sbjct: 321 LNAEVPIEDKYSE 333

>ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa]
           {ON} some similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 1115

 Score =  305 bits (780), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 147/313 (46%), Positives = 203/313 (64%), Gaps = 11/313 (3%)

Query: 7   DCLQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVL---------SPGPIQ-GSLACLKR 56
           D   PG ++ VG+ +V+II ++  GGFAQIYS + +         S  P+Q G +ACLKR
Sbjct: 20  DGYAPGTVVAVGNQQVEIISFIAEGGFAQIYSVKYIKFLGEFNNGSKAPLQPGDIACLKR 79

Query: 57  VHVPDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGL 116
           V VPD+  L+ +R EV+ MK L+G + ++ Y DS+A++       YEV LLME C    L
Sbjct: 80  VLVPDENGLSEMRNEVEVMKQLRGAKAIIQYYDSNASRRTSGQVGYEVLLLMELCPNNSL 139

Query: 117 IDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCD 176
           +D+MN RL TRL+E E+LK+M      I  MH L  PLIHRDIKIENVL+    +FK+CD
Sbjct: 140 LDYMNQRLATRLTEKEILKVMYDTTLAISQMHYLPIPLIHRDIKIENVLVDAQNNFKLCD 199

Query: 177 FGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLY 236
           FGS S          +   +  +I  NTT QYR+PEMIDLYR LP++EKSDIWALG+FLY
Sbjct: 200 FGSTSTCFPLVTTHQDIAILTQNIYVNTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLY 259

Query: 237 KVCYFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVS 296
           K+ +F TPFE  G+ +IL +K++FP+  +Y+ +L NLI +ML+E+P  RPNI QV+  + 
Sbjct: 260 KLLFFITPFEMTGQFSILHSKYEFPAN-KYSSKLINLIIIMLAENPYVRPNIYQVMHHIC 318

Query: 297 RIQGVPCPLPNFY 309
            + G   P+ + Y
Sbjct: 319 SVIGCEVPIEDKY 331

>Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {ON}
           YBR059C (REAL)
          Length = 1090

 Score =  304 bits (779), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 157/313 (50%), Positives = 205/313 (65%), Gaps = 15/313 (4%)

Query: 11  PGIILTVGSHEVKIIQYLTSGGFAQIYSCEVL---------SPGPIQ-GSLACLKRVHVP 60
           PG I+ VG+H+V+I+ YL  GGFAQIY  + L         +  P++ G LACLKRV V 
Sbjct: 24  PGDIVCVGTHKVEIVNYLAEGGFAQIYVVKFLEYLNEFDNAASVPLKIGDLACLKRVLVH 83

Query: 61  DKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGT--YEVYLLMEYCLRGGLID 118
           D+  LN +R EV+ MK LKG  +VV Y DS+A++  R DG   +EV LLME C    L+D
Sbjct: 84  DENGLNEMRNEVEVMKKLKGAANVVQYYDSNASR--RRDGVQGFEVLLLMELCPNKSLLD 141

Query: 119 FMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFG 178
           +MN RL T+L+E E++KIM  VA  I  MH L  PLIHRDIKIENVL+     FK+ DFG
Sbjct: 142 YMNQRLSTKLTETEIVKIMYDVALSISQMHYLPVPLIHRDIKIENVLVDAKDSFKLADFG 201

Query: 179 SVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKV 238
           S S          +   +  +I  +TT QYR+PEMIDLYR LP++EKSDIWALG+FLYK+
Sbjct: 202 STSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKL 261

Query: 239 CYFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRI 298
            +FTTPFE  G+ AIL +K++FP   +Y+ +L NLI +ML+E+P  RPNI QVL  +  I
Sbjct: 262 LFFTTPFEMTGQFAILHSKYEFP-VNKYSSKLINLIIIMLAENPNLRPNIYQVLCHLCDI 320

Query: 299 QGVPCPLPNFYLE 311
             V  P+ + Y E
Sbjct: 321 LNVEVPIEDKYAE 333

>KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} similar
           to uniprot|P38080 Saccharomyces cerevisiae YBR059C AKL1
           Ser-Thr protein kinase
          Length = 901

 Score =  301 bits (770), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 153/313 (48%), Positives = 203/313 (64%), Gaps = 15/313 (4%)

Query: 9   LQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEV------LSPGP----IQGSLACLKRVH 58
           L+ G  + VG+H V+I++YL  GGFA IY  +       L   P      G  ACLKRV 
Sbjct: 29  LKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVKFVEYANELEQAPSITLKVGETACLKRVL 88

Query: 59  VPDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGT--YEVYLLMEYCLRGGL 116
           V D+  LN +R EV  MK L G  ++V Y DSHA++S   DG   +EV LLME C    L
Sbjct: 89  VTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRS--RDGVPGFEVMLLMELCPNNSL 146

Query: 117 IDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCD 176
           +D+MN RL T+LSE E+LKIM  V + +  MH L  PLIHRD+KIENVL+ GD +FK+CD
Sbjct: 147 LDYMNQRLTTKLSEQEILKIMFDVTRALAQMHYLPIPLIHRDVKIENVLVDGDNNFKLCD 206

Query: 177 FGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLY 236
           FGS S  +       E   + ++I  +TT QYR+PEMIDLYR LP+DEKSDIWALG+FLY
Sbjct: 207 FGSTSTCLPVANTHQEIAVLTNNIYIHTTPQYRSPEMIDLYRCLPIDEKSDIWALGIFLY 266

Query: 237 KVCYFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVS 296
           K+ ++TTPFE  G+ AIL +K++FP    Y+ +L NLI +ML+E+P  RPNI Q+++ + 
Sbjct: 267 KLLFYTTPFELTGQFAILHSKYEFP-INNYSSKLINLIIIMLAENPNLRPNIYQIMDNLC 325

Query: 297 RIQGVPCPLPNFY 309
            I  V  P+ + Y
Sbjct: 326 SIMKVENPIEDKY 338

>Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {ON}
           similar to Ashbya gossypii AGR027C
          Length = 894

 Score =  298 bits (764), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 157/313 (50%), Positives = 200/313 (63%), Gaps = 16/313 (5%)

Query: 9   LQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGP---------IQGSLACLKRVHV 59
           L  G IL VG H V+II+YL  GGFA IY    +              +G +ACLKRV V
Sbjct: 28  LTAGSILLVGVHRVEIIEYLAEGGFAHIYKVSFIEYTNELDRHHSVLQRGDIACLKRVQV 87

Query: 60  PDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRH-DGT--YEVYLLMEYCLRGGL 116
            D+  LN LR EV+ MK LKG  +VV Y DS+A+   RH DGT  +EV LLME C  G L
Sbjct: 88  NDENGLNELRNEVEVMKKLKGCGNVVQYYDSNAS---RHTDGTPGFEVLLLMELCSNGSL 144

Query: 117 IDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCD 176
           +D+MN RL T+LSE EVLKIM  + +GI  MH L  PLIHRDIKIENVL+    +FK+CD
Sbjct: 145 LDYMNQRLATKLSEREVLKIMYDITKGISHMHFLRTPLIHRDIKIENVLVDSANNFKLCD 204

Query: 177 FGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLY 236
           FGS S  +       E   + ++I  +TT QYR+PEMIDLYR L ++EKSDIWALG+FLY
Sbjct: 205 FGSTSTCLPAVSTHQEIAMLTNNIYVHTTPQYRSPEMIDLYRCLAINEKSDIWALGIFLY 264

Query: 237 KVCYFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVS 296
           K+ ++TTPFE  G+ AIL +K+  P    ++ +L NLI VML+E+P  RPNI Q+L  + 
Sbjct: 265 KLLFYTTPFELTGQFAILHSKYDIPQN-NFSSKLINLIIVMLAENPYIRPNIYQILYHIC 323

Query: 297 RIQGVPCPLPNFY 309
            I     P+ + Y
Sbjct: 324 SIMECDVPIEDHY 336

>Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {ON}
           YBR059C (REAL)
          Length = 1108

 Score =  302 bits (773), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 153/313 (48%), Positives = 206/313 (65%), Gaps = 15/313 (4%)

Query: 11  PGIILTVGSHEVKIIQYLTSGGFAQIYSCEVL---------SPGPIQ-GSLACLKRVHVP 60
           PG I+ VG+H+V++I YL  GGFAQIY  + +         +  P++ G +ACLKRV V 
Sbjct: 24  PGHIVCVGTHKVEVINYLAEGGFAQIYMVKFVEYLNEFDNAASVPLKIGDVACLKRVLVQ 83

Query: 61  DKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGT--YEVYLLMEYCLRGGLID 118
           D+  LN +R EV+ MK LKG  +VV Y DS+A++  R DG   +EV LLME C    L+D
Sbjct: 84  DENGLNEMRNEVEVMKKLKGAPNVVQYFDSNASR--RRDGVQGFEVLLLMELCPNKSLLD 141

Query: 119 FMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFG 178
           +MN RL T+L+E E++KIM  V   I  MH L  PLIHRDIKIENVL+  + +FK+ DFG
Sbjct: 142 YMNQRLSTKLTESEIVKIMYDVVLSISQMHYLPVPLIHRDIKIENVLVDANNNFKLADFG 201

Query: 179 SVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKV 238
           S S          +   +  +I  +TT QYR+PEMIDLYR LP++EKSDIWALG+FLYK+
Sbjct: 202 STSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKL 261

Query: 239 CYFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRI 298
            +FTTPFE  G+ AIL +K++FP   +Y+ +L NLI +ML+E+P  RPNI QVL  +  I
Sbjct: 262 LFFTTPFEMTGQFAILHSKYEFP-VNKYSSKLINLIIIMLAENPNLRPNIYQVLYHLCEI 320

Query: 299 QGVPCPLPNFYLE 311
             +  P+ + Y E
Sbjct: 321 LNIEVPIEDKYTE 333

>YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON}
           AKL1Ser-Thr protein kinase, member (with Ark1p and
           Prk1p) of the Ark kinase family; involved in endocytosis
           and actin cytoskeleton organization
          Length = 1108

 Score =  302 bits (773), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 154/313 (49%), Positives = 205/313 (65%), Gaps = 15/313 (4%)

Query: 11  PGIILTVGSHEVKIIQYLTSGGFAQIYSCEVL---------SPGPIQ-GSLACLKRVHVP 60
           PG I+ VG+H+V+++ YL  GGFAQIY  + L         +  P++ G +ACLKRV V 
Sbjct: 24  PGHIVCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGDVACLKRVLVQ 83

Query: 61  DKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGT--YEVYLLMEYCLRGGLID 118
           D+  LN +R EV+ MK LKG  ++V Y DS+A++  R DG   +EV LLME C    L+D
Sbjct: 84  DENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASR--RRDGVQGFEVLLLMELCPNKSLLD 141

Query: 119 FMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFG 178
           +MN RL T+L+E E++KIM  VA  I  MH L   LIHRDIKIENVL+    +FK+ DFG
Sbjct: 142 YMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKNNFKLADFG 201

Query: 179 SVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKV 238
           S S          +   +  +I  +TT QYR+PEMIDLYR LP++EKSDIWALGVFLYK+
Sbjct: 202 STSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGVFLYKL 261

Query: 239 CYFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRI 298
            +FTTPFE  G+ AIL +K++FP   +Y+ +L NLI +ML+E+P  RPNI QVL  +  I
Sbjct: 262 LFFTTPFEMTGQFAILHSKYEFP-VNKYSSKLINLIIIMLAENPNLRPNIYQVLYHLCEI 320

Query: 299 QGVPCPLPNFYLE 311
             V  P+ + Y E
Sbjct: 321 LNVEVPIEDKYAE 333

>CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa]
           {ON} similar to uniprot|P38080 Saccharomyces cerevisiae
           YBR059c AKL1 Ark-family Kinase-Like protein
          Length = 1027

 Score =  300 bits (768), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 152/311 (48%), Positives = 206/311 (66%), Gaps = 16/311 (5%)

Query: 12  GIILTVGSHEVKIIQYLTSGGFAQIYSCEVL----------SPGPIQ-GSLACLKRVHVP 60
           G +++VG+H V+I+ YL  GGFAQIY  + +          S   I  G +ACLKRV V 
Sbjct: 23  GQMISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVGDIACLKRVIVN 82

Query: 61  DKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGT--YEVYLLMEYCLRGGLID 118
           D+  LN +R EV+ MK LK   ++V Y DS+A++  R DG   +EV LLME C    L+D
Sbjct: 83  DEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASR--RTDGKPGFEVLLLMELCPNKSLLD 140

Query: 119 FMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFG 178
           +MN RL+T+LSE E+LKIM  V+ GI  MH L  PLIHRDIKIENVL+  + +FK+CD G
Sbjct: 141 YMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMG 200

Query: 179 SVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKV 238
           S S    P  +  +   +  +I  +TT QYRAPEMIDLYR LP++EKSDIWALG+FLYK+
Sbjct: 201 STSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKL 260

Query: 239 CYFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRI 298
            ++TTPFE  G+ AIL +K+ FP   +Y+ ++ NLI +ML+E+P  RPNI QV+  +  I
Sbjct: 261 LFYTTPFEITGQMAILHSKYDFPPN-KYSSKIINLIIIMLAENPNLRPNIFQVVYHICSI 319

Query: 299 QGVPCPLPNFY 309
             +P P+ + Y
Sbjct: 320 MNLPVPIEDRY 330

>TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3.273
           YBR059C
          Length = 1049

 Score =  300 bits (767), Expect = 9e-88,   Method: Compositional matrix adjust.
 Identities = 151/311 (48%), Positives = 202/311 (64%), Gaps = 15/311 (4%)

Query: 11  PGIILTVGSHEVKIIQYLTSGGFAQIYSCEVL---------SPGPIQ-GSLACLKRVHVP 60
           PG ++ VG+H V+++ YL  GGFAQIY  + L         S  P++ G +ACLKRV V 
Sbjct: 24  PGAVVAVGTHRVEVVNYLAEGGFAQIYVVKFLEYLNEFENKSKVPMKVGDVACLKRVLVQ 83

Query: 61  DKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGT--YEVYLLMEYCLRGGLID 118
           D+  L+ +R EV+ MK L G +++V Y DS+A +  RH+G   +EV LLME C    L+D
Sbjct: 84  DENGLSEMRNEVEVMKQLMGAQNIVQYYDSNACR--RHNGNAGFEVLLLMELCPNKSLLD 141

Query: 119 FMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFG 178
           +MN RL T+L+E E+LKIM  V+  +  MH L  PLIHRDIKIENVL+     FK+CDFG
Sbjct: 142 YMNQRLATKLTEKEILKIMYDVSLAVSQMHYLKNPLIHRDIKIENVLVDAQNSFKLCDFG 201

Query: 179 SVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKV 238
           S S          E   +  +I  +TT QYR PEMIDLYR LP++EKSDIWALG+FLYK+
Sbjct: 202 STSQCFPVVTTHQEIAILTQNIYVHTTPQYRCPEMIDLYRCLPINEKSDIWALGIFLYKL 261

Query: 239 CYFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRI 298
            +F TPFE  G+ AIL +K++FP    Y+ +L NLI +ML+E+P  RPNI QVL  +  +
Sbjct: 262 LFFITPFEMTGQFAILHSKYEFPPN-HYSSQLINLIIIMLAENPFVRPNIYQVLNHICTM 320

Query: 299 QGVPCPLPNFY 309
            GV  P+ + Y
Sbjct: 321 IGVEVPIEDKY 331

>NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON}
           Anc_3.273
          Length = 1157

 Score =  300 bits (769), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 151/325 (46%), Positives = 206/325 (63%), Gaps = 30/325 (9%)

Query: 12  GIILTVGSHEVKIIQYLTSGGFAQIYSCEVL----------------------SPGPI-- 47
           G  + VGSH+V+II+Y+  GGFAQIY+ + +                      +P P+  
Sbjct: 27  GTQVAVGSHKVEIIKYIAEGGFAQIYAVKYVESLNEFEDSNTDENAHLSGDRQAPNPMIL 86

Query: 48  -QGSLACLKRVHVPDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGT--YEV 104
             G +ACLKRV V D+  LN +R EV+ MK LKG  +VV Y DS+A++  RH+G   +EV
Sbjct: 87  KLGDIACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNVVQYFDSNASR--RHNGASGFEV 144

Query: 105 YLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENV 164
            LLME C    L+D+MN RL T+L+E E+LKIM  +   +  MH L  PL+HRDIKIENV
Sbjct: 145 LLLMELCPNKSLLDYMNQRLTTKLTEHEILKIMYDITFAVSHMHYLKIPLLHRDIKIENV 204

Query: 165 LISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDE 224
           L+    +FK+CDFGS S  +       +   +  +I  +TT QYR+PEMIDLYR LP+DE
Sbjct: 205 LVDAQNNFKLCDFGSTSTRLPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPIDE 264

Query: 225 KSDIWALGVFLYKVCYFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQ 284
           KSDIWALG+FLYK+ +F TPFE  G+ AIL +K++FP    Y+ +L NLI +ML+E+P  
Sbjct: 265 KSDIWALGIFLYKLLFFITPFEMTGQFAILHSKYEFPKN-NYSSKLINLIIIMLAENPNL 323

Query: 285 RPNICQVLEEVSRIQGVPCPLPNFY 309
           RPNI QVL+ +  +  V  P+ + Y
Sbjct: 324 RPNIYQVLDNICSMMNVEVPIEDIY 348

>KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some
           similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 814

 Score =  293 bits (751), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 146/312 (46%), Positives = 199/312 (63%), Gaps = 12/312 (3%)

Query: 9   LQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVL-----------SPGPIQGSLACLKRV 57
           L P   + VG+H  +I+++L  GGFA IY  + L           S     G +ACLKRV
Sbjct: 29  LSPNTQVVVGTHRCEILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRV 88

Query: 58  HVPDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLI 117
            VPD+  LN LR EV+ MK L+G  ++V Y DS+A++ P     +E+ LLME C +  L+
Sbjct: 89  IVPDENGLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLL 148

Query: 118 DFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDF 177
           D+MN++L T+L+E E+LKIM  V+  I  MH L  PLIHRDIKIENVL+  D +FK+CDF
Sbjct: 149 DYMNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDF 208

Query: 178 GSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYK 237
           GS S          +   + ++I  +TT QYR+PEMIDLYR LP++EKSDIWALG+FLYK
Sbjct: 209 GSTSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYK 268

Query: 238 VCYFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSR 297
           + ++TTPFE  G+ AIL +K++ P    Y+ +L NLI +ML+E+P  RPNI QV+  V  
Sbjct: 269 LLFYTTPFELTGQFAILHSKYEIPQN-GYSSKLINLIIIMLAENPSLRPNIYQVMHHVCS 327

Query: 298 IQGVPCPLPNFY 309
           I     P  + Y
Sbjct: 328 ILKCDVPFTDKY 339

>Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059C
           (AKL1) - Serine-threonine protein kinase [contig 32]
           FULL
          Length = 935

 Score =  295 bits (754), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 149/311 (47%), Positives = 200/311 (64%), Gaps = 11/311 (3%)

Query: 9   LQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPG-------PIQ---GSLACLKRVH 58
           L+ G  + VG+H V+I++YL  GGFA IY    +           I+   G LACLKRV 
Sbjct: 71  LKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLACLKRVL 130

Query: 59  VPDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLID 118
           V D+  LN +R EV  MK L G  ++V Y DSHA+++      +EV LLME C    L+D
Sbjct: 131 VTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPNNSLLD 190

Query: 119 FMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFG 178
           +MN RL T+LSE E+LKIM  V + +  MH L  PLIHRD+KIENVL+  + +FK+CDFG
Sbjct: 191 YMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFKLCDFG 250

Query: 179 SVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKV 238
           S S          E   + ++I  +TT QYR+PEMIDLYR LP++EKSDIWALG+FLYK+
Sbjct: 251 STSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKL 310

Query: 239 CYFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRI 298
            ++TTPFE  G+ AIL +K++FP    Y+ +L NLI +ML+E+P  RPNI QV++ +  I
Sbjct: 311 LFYTTPFELTGQFAILHSKYEFP-VNNYSSKLINLIIIMLAENPNLRPNIYQVMDNLCSI 369

Query: 299 QGVPCPLPNFY 309
             V  PL + Y
Sbjct: 370 LKVKNPLEDKY 380

>KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}
           Anc_3.273 YBR059C
          Length = 949

 Score =  293 bits (749), Expect = 9e-86,   Method: Compositional matrix adjust.
 Identities = 148/319 (46%), Positives = 203/319 (63%), Gaps = 19/319 (5%)

Query: 9   LQPGIILTVGSHEVKIIQYLTSGGFAQIYSC---EVLSPGPIQ---------------GS 50
            + G  L VG+H+V+I+ YLT GGFAQIY     EVL+    +               G 
Sbjct: 31  FEKGQNLAVGTHKVEIVDYLTEGGFAQIYVVKFIEVLNEFDNEDNGSNVRISNYSLKLGD 90

Query: 51  LACLKRVHVPDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEY 110
           +ACLKRV V D+  LN +R EV+ MK L+G  ++V Y DS+A +S   +  YEV LLME 
Sbjct: 91  VACLKRVLVYDEVGLNEMRNEVNVMKKLRGCPNIVQYYDSNATRSHNGNPGYEVLLLMEL 150

Query: 111 CLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDG 170
           C    L+++MN RL T+LSE EVLKIM  V  G+  MH L  PLIHRDIKIENVL+  + 
Sbjct: 151 CSNNSLLNYMNQRLATQLSEKEVLKIMYDVTSGVAQMHYLKTPLIHRDIKIENVLVDSNN 210

Query: 171 DFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWA 230
           +FK+CDFGS +          +   +  ++  +TT QYR+PEMIDLYR LP++EKSDIWA
Sbjct: 211 NFKLCDFGSATTCPPVATTHQDIALLGQNVYVHTTPQYRSPEMIDLYRYLPINEKSDIWA 270

Query: 231 LGVFLYKVCYFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQ 290
           LGVFLYK+ ++TTPFE  G+ A+L +KF  P+  +Y+ ++ NL+ +MLSE+   RPNI Q
Sbjct: 271 LGVFLYKLLFYTTPFETTGQFAMLHSKFDIPA-NKYSSKIINLVIIMLSENLNLRPNIYQ 329

Query: 291 VLEEVSRIQGVPCPLPNFY 309
           V+  + ++  V  P+ + Y
Sbjct: 330 VMHYICQLIQVDTPILDIY 348

>CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa]
           {ON} some similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059c AKL1 Ark-family Kinase-Like protein
          Length = 991

 Score =  293 bits (749), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 155/357 (43%), Positives = 216/357 (60%), Gaps = 25/357 (7%)

Query: 12  GIILTVGSHEVKIIQYLTSGGFAQIYSCEVLS-------------PGPIQ-GSLACLKRV 57
           G ++TVGSH V+++ YL  GGFAQIY  + +                P++ GS ACLKRV
Sbjct: 99  GKVVTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKPGSPACLKRV 158

Query: 58  HVPDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGT----YEVYLLMEYCLR 113
            V D+  LN +R+EV+ MK L+G  ++V Y DS+A++   + G     +EV LLME C  
Sbjct: 159 LVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPN 218

Query: 114 GGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFK 173
             L+D+MN RL T+L+E E+ KIM  +   +  MH L  PLIHRDIKIENVL+  + +FK
Sbjct: 219 KSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNNFK 278

Query: 174 VCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGV 233
           +CDFGS S       +  +   +  D+  +TT QYR+PEMIDL++ +P++EKSDIWALGV
Sbjct: 279 LCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIWALGV 338

Query: 234 FLYKVCYFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLE 293
           FLYK+ +FTTPFE+ G+ A+L +KF+FP    Y+ +L NLI VML+E+P  RPNI QVL 
Sbjct: 339 FLYKLLFFTTPFERTGQFAMLHSKFEFPPN-SYSSKLINLIIVMLAENPSLRPNIYQVLY 397

Query: 294 EVSRIQGVPCPLPNFYLERMKHG-----ACTPVHHSASQPALPLATHQFSTSTPMVT 345
            +S +     P P    ++   G       T     + Q  L L+T Q   + P  T
Sbjct: 398 YLSEVTNREVP-PTVLSDKYGQGPYNFEKYTRFQKESQQVQLQLSTLQAKINDPNST 453

>TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {ON}
           Anc_3.273 YBR059C
          Length = 1361

 Score =  295 bits (755), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 145/314 (46%), Positives = 201/314 (64%), Gaps = 17/314 (5%)

Query: 10  QPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLS------------PGPIQGSLACLKRV 57
           +PG +++VG+H+VKI  YL  GGFAQIY  + +                  G +ACLKRV
Sbjct: 36  KPGKLISVGAHQVKIEDYLAEGGFAQIYKVKFIDYLNEFENKKDQLNSLKSGDIACLKRV 95

Query: 58  HVPDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGT--YEVYLLMEYCLRGG 115
            V D+  LN +R EV+ MK+L+G  ++V Y DS+A +  R+DG   YE+ LLME C    
Sbjct: 96  LVNDENGLNEMRNEVEVMKLLQGCPNIVQYYDSNALR--RNDGLNGYEILLLMELCPNNS 153

Query: 116 LIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVC 175
           L+D+MN RL+T+L+E E++KIM      +  MH L  PLIH+DIK+EN+L+  + +FK+C
Sbjct: 154 LLDYMNQRLKTKLNETEIVKIMYDTTLAVSQMHYLDKPLIHKDIKVENILVDSNNNFKLC 213

Query: 176 DFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFL 235
           DFGS S       + ++   +  +I  +TT QYR+PEMIDLYR LP++E SDIWALGVFL
Sbjct: 214 DFGSTSPCYEIVTSHHDIAVLTQNIYMHTTPQYRSPEMIDLYRCLPINETSDIWALGVFL 273

Query: 236 YKVCYFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEV 295
           YK+ +F TPFE+ G+ +IL AKF  P    Y  +L NLI +MLSE+   RPNI QV+ E+
Sbjct: 274 YKLLFFITPFERTGQFSILHAKFDIP-VNNYHPKLINLIIIMLSENLNLRPNIYQVMYEI 332

Query: 296 SRIQGVPCPLPNFY 309
             I   P P+ + Y
Sbjct: 333 CSITNTPLPIEDKY 346

>TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {ON}
           Anc_3.273 YBR059C
          Length = 788

 Score =  287 bits (734), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 148/317 (46%), Positives = 200/317 (63%), Gaps = 15/317 (4%)

Query: 5   PQDCLQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVL------SPGPIQ----GSLACL 54
           P D   PG I+ VG H+V+II+YL  GGFA+IY  + L          IQ    G L CL
Sbjct: 95  PIDTYVPGHIVEVGIHKVEIIKYLAEGGFAKIYVAKFLQYIKQIDINKIQVLQPGDLICL 154

Query: 55  KRVHVPDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGT--YEVYLLMEYCL 112
           KRV V D   LN +R EV  MK L G  ++V   DS+A++  R DG   YEV LLME C 
Sbjct: 155 KRVLVTDDNGLNEMRNEVSVMKKLIGAPNIVQLYDSNASR--RTDGIAGYEVLLLMELCS 212

Query: 113 RGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDF 172
              L+D+MN RL  +L+E E+LKIM  V   +  MH L  PLIHRDIKIENVL+    +F
Sbjct: 213 NKSLLDYMNQRLAVKLTEPEILKIMFDVTLAVAQMHYLPIPLIHRDIKIENVLVDSQNNF 272

Query: 173 KVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALG 232
           K+CDFGS S  +       +   +  ++  +TT QYR+PEMID+YR + ++EKSDIWALG
Sbjct: 273 KLCDFGSTSTCMPIATTHRDMAALTQNLYVHTTPQYRSPEMIDVYRCIHINEKSDIWALG 332

Query: 233 VFLYKVCYFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVL 292
           +FLYK+ ++ TPFE+ G+ AIL +K++FP +  Y+ +L NLI +ML+E+P  RPNI QVL
Sbjct: 333 IFLYKLLFYITPFERTGQFAILHSKYEFPQH-SYSMKLINLIIIMLAENPNLRPNIYQVL 391

Query: 293 EEVSRIQGVPCPLPNFY 309
             + +I  +  P+ + Y
Sbjct: 392 AYICKIINIKTPIDDIY 408

>AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR059C
           (AKL1)
          Length = 961

 Score =  289 bits (740), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 145/318 (45%), Positives = 198/318 (62%), Gaps = 18/318 (5%)

Query: 5   PQDCLQPGIILTVGSHEVKIIQYLTSGGFAQIYSC-------------EVLSPGPIQGSL 51
           P + LQ G  + VG H+V++I+YL  GGFA IY                +L PG      
Sbjct: 25  PLEMLQAGSTVLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPG----DT 80

Query: 52  ACLKRVHVPDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYC 111
            CLKRV V D+  LN LR EV+ MK L+   ++V Y DS+A++       YEV LLME C
Sbjct: 81  VCLKRVRVSDENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELC 140

Query: 112 LRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGD 171
             G L+D+MN RL T+LSE EVLKIM  +  G+  MH    PLIHRDIKIENVL+  D +
Sbjct: 141 PNGSLLDYMNQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNN 200

Query: 172 FKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWAL 231
           FK+CDFGS S  +    +  E   + ++I  +TT QYR+PEMIDLYR LP++EKSDIWAL
Sbjct: 201 FKLCDFGSTSPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWAL 260

Query: 232 GVFLYKVCYFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQV 291
           G+FLYK+ ++TTPFE  G+ AIL +K++ P    ++ +L NL+ +ML+E+P  RPN+ QV
Sbjct: 261 GIFLYKLLFYTTPFELTGQFAILHSKYEIPRN-SFSSKLINLVIIMLAENPYLRPNVYQV 319

Query: 292 LEEVSRIQGVPCPLPNFY 309
           +  +  +      + + Y
Sbjct: 320 MYHICSMMECEVKIDDLY 337

>TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3.273
           YBR059C
          Length = 1054

 Score =  290 bits (743), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 144/312 (46%), Positives = 193/312 (61%), Gaps = 32/312 (10%)

Query: 12  GIILTVGSHEVKIIQYLTSGGFAQIYSCEVL----------------SPGPIQGSLACLK 55
           G ILTVG   ++I++YLT GGFAQIY+   +                S     G +ACLK
Sbjct: 43  GTILTVGIRRIEILKYLTEGGFAQIYTVRFIEYLNEFDNDDAENDNNSRNLKIGDVACLK 102

Query: 56  RVHVPDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGT-------------- 101
           RV VPD+  L+ +R EVD MK L    ++V Y DS+A+K   +                 
Sbjct: 103 RVLVPDENGLSEMRNEVDVMKKLVNCPNIVQYYDSNASKIKDNSNIDTTNNNDNNKNTDL 162

Query: 102 -YEVYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIK 160
            +E+ LLMEYC    L+DFMN RL T+L+E E+LK M+ +   ++ MH L  PLIHRDIK
Sbjct: 163 GFEILLLMEYCPNKSLLDFMNQRLTTKLTENEILKAMTDITTAVLQMHYLAQPLIHRDIK 222

Query: 161 IENVLISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRAL 220
           IENVL+  + +FK+ DFGS + +  P     +   +  DI  NTT QYR+PEMIDLY+ L
Sbjct: 223 IENVLVDSNNNFKLADFGSTTKIQPPITTHQDIAILNKDIYMNTTPQYRSPEMIDLYKCL 282

Query: 221 PVDEKSDIWALGVFLYKVCYFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSE 280
           P+DEKSDIWALGV LYK+ ++TTPFE  G+ AIL +K++FP+   Y+ +  NLI +ML+E
Sbjct: 283 PIDEKSDIWALGVLLYKLLFYTTPFELTGQFAILHSKYEFPA-NNYSSKFINLIIIMLAE 341

Query: 281 HPVQRPNICQVL 292
           +P  RPNI QVL
Sbjct: 342 NPNLRPNIFQVL 353

>Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236C -
           Hypothetical ORF [contig 165] FULL
          Length = 346

 Score =  100 bits (249), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 83/339 (24%), Positives = 146/339 (43%), Gaps = 66/339 (19%)

Query: 14  ILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGPIQGSLACLKRVHVPDKPSLNTLRAEVD 73
            +++   + +I + L  GG + +Y  E       +G L  LK+   P      ++ +   
Sbjct: 18  FVSINGRKYRIQKLLGEGGLSFVYLVE-----SKEGELFALKKTRCP----FGSIGSISP 68

Query: 74  AMKMLKGHR-----HVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQ--T 126
           AMK +  ++     ++   +DS   +    DG+  VY+L+ Y  +G L D +N  L   T
Sbjct: 69  AMKEVANYQRFSSPYIAQIVDSQVVQ--EKDGSKTVYVLLPYFAKGSLQDLINRHLLDCT 126

Query: 127 RLSEFEVLKIMSHVAQGIMAMHALVP---------------------------------- 152
           ++SE ++L++   +A+G++ +H   P                                  
Sbjct: 127 QMSELDILRMALGIARGLLCIHEANPNHETDVAYSIVSAPYAEDSSLLNDLELDTFGESQ 186

Query: 153 -PLIHRDIKIENVLISGDGDFKVCDFGSVSGV---IRPPKNAYEFNYVQHDILKNTTAQY 208
               HRD+K  N++IS +    + D GS S     I   +    F     D   N T  Y
Sbjct: 187 QSYAHRDVKPSNIMISPEDLPVISDLGSCSRARIDINSRQALLRFQEWSSD---NCTLSY 243

Query: 209 RAPEMIDLYRALPVDEKSDIWALGVFLYKVCYFTTPFEKVGE-------NAILQAKFQFP 261
            APE++D+     + EK DIW+ G  +Y +C+  +PFE+  +        AI   K+  P
Sbjct: 244 AAPEILDVKLNSVITEKCDIWSFGCTMYSMCFGISPFEREEQISGASVTYAITTGKYTVP 303

Query: 262 SYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRIQG 300
               Y+  L  LI   LS +P QRP++ +++  +  +QG
Sbjct: 304 RGTSYSSSLIELIGKCLSVNPEQRPSVNELIALLMELQG 342

>Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {ON}
           YPL236C (REAL)
          Length = 364

 Score = 97.4 bits (241), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 88/337 (26%), Positives = 144/337 (42%), Gaps = 62/337 (18%)

Query: 15  LTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGPIQGS------LACLKRVHVPDKPSLNTL 68
           + V     KI + L  GG + +Y  ++L    I  +      L  LK++  P+  S++  
Sbjct: 23  IRVNDKRYKIQRLLGEGGLSFVYLVQLLKGSLIMENGVAAPELYALKKIICPNVESISNG 82

Query: 69  RAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQ--T 126
             E++  K  +   +V+  IDS   +    DG+  +Y+++ +   G L D +N RL   T
Sbjct: 83  MREIENYKRFQSP-YVIQSIDSQVMQ--EKDGSKSIYIILPFYTLGSLQDSINRRLLEGT 139

Query: 127 RLSEFEVLKIMSHVAQGIMAMH--------------------------ALV---PPL--- 154
            +SE E ++IM  V +G++ +H                          A +    PL   
Sbjct: 140 FISEAECVRIMLGVIRGLLCLHDPASRQDNTNSRTTVDTVSMTYSDETAFLLEDTPLEMD 199

Query: 155 ------------IHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILK 202
                        HRDI   N+L S DG   + D GS S       N  +   +Q  +  
Sbjct: 200 MLSSNLGASIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIGNRNQLRELQEWVND 259

Query: 203 NTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYFTTPFEKVGE-------NAILQ 255
           N T  Y APE++ L     +D K DIW+LG   Y + +  +PFE+  +        AI  
Sbjct: 260 NCTLPYTAPELLGLKLNQTLDCKVDIWSLGCTFYTLMFGISPFEREEQIHGASITYAINT 319

Query: 256 AKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVL 292
            K+ FP   ++++ L ++I   +   PVQRP   Q+L
Sbjct: 320 GKYSFPRNSRFSEGLLSVIKKCIQVDPVQRPTTSQLL 356

>KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON} 
          Length = 668

 Score = 99.8 bits (247), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 65/243 (26%), Positives = 123/243 (50%), Gaps = 40/243 (16%)

Query: 67  TLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQT 126
           T+  E++  K++ GH++++S ID         D T  +Y+++E C  G L D +  R + 
Sbjct: 95  TILKEIEIHKLVNGHKNIISMIDHFEI-----DAT--MYMVLELCGAGSLYDII-CRSKR 146

Query: 127 RLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRP 186
            L E+E  ++M  +   +  +H     ++H D+K+ N+LI    + ++CDFG        
Sbjct: 147 SLREWEAKRLMIQLCGAVDWIHE--KNIVHADLKLSNILIDSSNNLQLCDFGH------- 197

Query: 187 PKNAYEFNYVQHDILKNT-----TAQYRAPEMIDLY-----RALPVDEKSDIWALGVFLY 236
                  ++V  DI  N+     T  Y +PE+I  +     + L   ++SDIW++G+ LY
Sbjct: 198 -------SFVSTDIDNNSINKFGTPNYLSPEIISNFILSDKKDLYFPKESDIWSIGIVLY 250

Query: 237 KVCYFTTPFEKVG-----ENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQV 291
            + +  TPFE        EN I++ K+ F    + ++++K LI  +L   P++R  I ++
Sbjct: 251 AMIFDKTPFEATTLRSTYEN-IVECKYGFVENKRVSNKVKKLIQNILKIQPLERKTIVEI 309

Query: 292 LEE 294
           + +
Sbjct: 310 VSD 312

>SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {ON}
           similar to uniprot|Q7LGU7 Saccharomyces cerevisiae
           YPL236C Hypothetical ORF
          Length = 364

 Score = 96.3 bits (238), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 88/358 (24%), Positives = 149/358 (41%), Gaps = 74/358 (20%)

Query: 8   CLQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGPIQGSLACLKRVHVPDKPSLNT 67
           C +   +L  G H   I + L  GGF+ +Y    L        L  LK++H P       
Sbjct: 15  CGRNSSVLINGQH-YAIQRLLGEGGFSFVY----LVQSRENNDLFALKKIHCP----FGN 65

Query: 68  LRAEVDAMKMLKGHRHVVSYIDSHAAKSP---RHDGTYEVYLLMEYCLRGGLIDFMNSRL 124
           + +  +AM+ +  ++   S   +H   S      DG+  V++L+ Y   G L+D +N+ L
Sbjct: 66  IESVSEAMREVNSYKKFRSPYITHCVSSQVLQEQDGSKTVFILLPYFPTGSLLDKINTHL 125

Query: 125 --QTRLSEFEVLKIMSHVAQGIMAMH-------------ALVPPLIHRD----------- 158
              T +SE E+++I+  VA+G+  MH             ++   L +RD           
Sbjct: 126 LDGTTISEEEIVRILVSVARGLRTMHNPAGQEDSIEDQTSVNTDLQYRDTVSMTYNEDLR 185

Query: 159 -----------------------------IKIENVLISGDGDFKVCDFGSVSGVIRPPKN 189
                                        IK  N++ S DG   +CD GS S       +
Sbjct: 186 LLNDSLELDVLSGNTSSFMASTTAYSHKDIKPANIMFSSDGLPVICDLGSCSRAHVDISS 245

Query: 190 AYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYFTTPFEKVG 249
             +    Q    ++ T  +R+PE++++     +DEK DIW+LG  LY +C+  +PFE+  
Sbjct: 246 RSQLVEFQEWCNEHCTLPFRSPELLNVTLNSKIDEKVDIWSLGCTLYCMCFGISPFEREE 305

Query: 250 E-------NAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRIQG 300
           +        AI   KF  P    Y+  L  +I   +     +RP+I ++L  +  +QG
Sbjct: 306 QLSGASMTYAIATGKFSIPPNTNYSPELIKIIKDCIEVDSKKRPSIDELLARLQDLQG 363

>Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}
           YPL236C (REAL)
          Length = 364

 Score = 94.7 bits (234), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 81/331 (24%), Positives = 138/331 (41%), Gaps = 62/331 (18%)

Query: 15  LTVGSHEVKIIQYLTSGGFAQIYSCEVL------SPGPIQGSLACLKRVHVPDKPSLNTL 68
           + V     KI + L  GG + +Y  ++L              L  LK++  P   +++  
Sbjct: 23  IRVNDRRYKIQRLLGEGGMSFVYLVQLLKGSLSMENSAATAELYALKKIICPSVENISNG 82

Query: 69  RAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQ--T 126
             E++  K  +   +V+  IDS   +    DG+  +Y+++ Y   G L D +N RL   T
Sbjct: 83  MREIENYKRFQSP-YVIQSIDSQVMQ--EKDGSKTIYIILPYYSLGSLQDSINRRLLEGT 139

Query: 127 RLSEFEVLKIMSHVAQGIMAMH-------------------------------------- 148
            +SE E ++IM  V +G++ +H                                      
Sbjct: 140 FISEAECVRIMLGVTRGLLCLHDPASRQDNVTTRTTVDTISMTYSDETAMLLEDTPLEMD 199

Query: 149 ------ALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILK 202
                 A +    HRDI   N+L S DG   + D GS S       N  + + +Q  +  
Sbjct: 200 MLSSSSAGLIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIGNRNQLSELQEWVND 259

Query: 203 NTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYFTTPFEKVGE-------NAILQ 255
           N T  Y APE+++L     +  K DIW++G   Y + +  +PFE+  +        AI  
Sbjct: 260 NCTLPYTAPELLNLKLNQALSCKVDIWSMGCTFYTLMFGISPFEREEQIHGASLTYAINT 319

Query: 256 AKFQFPSYPQYTDRLKNLISVMLSEHPVQRP 286
            K+ FP   ++++RL ++I   +   P+QRP
Sbjct: 320 GKYSFPRNSRFSERLLDVIKRCIQVDPIQRP 350

>TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON}
           Anc_6.262 YPL236C
          Length = 372

 Score = 94.7 bits (234), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 84/348 (24%), Positives = 149/348 (42%), Gaps = 66/348 (18%)

Query: 15  LTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGPIQGS--------LACLKRVHVP--DKPS 64
           +++      I + L  G  + +Y  + L      GS        L  LKR+  P  +  S
Sbjct: 26  VSINGRRYTIRRLLGEGTLSFVYLVQRLGSKTATGSISLGNAPELYALKRIRCPFGNIES 85

Query: 65  LNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRL 124
           ++    EVD  K  +   ++++ +DS   +    DG+  + +L+ Y   G L D +N  L
Sbjct: 86  ISAAMKEVDNYKRFQSP-YIITLVDSQVVQ--EKDGSKTLCILLPYFPLGSLQDMVNRNL 142

Query: 125 Q--TRLSEFEVLKIMSHVAQGIMAMH-------------------------ALV---PPL 154
              T +SE E ++IM  +A+G+  +H                         A +    PL
Sbjct: 143 LKGTFVSEAECIRIMIGIARGLRCLHDPSARETSDAETMRDTVSLSYSDEAAFLLDDTPL 202

Query: 155 ----------------IHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQH 198
                           +HRDI++ N+L S +G   V D GS           ++ N +Q 
Sbjct: 203 ELDVLSSHNTVNTRSYVHRDIRLANILFSSEGLPVVSDLGSCCKADITVSTKHQLNELQD 262

Query: 199 DILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYFTTPFEKVGE-------N 251
            +  N +  Y APE++++     +D K+DIW++G   Y + +  +PFE+  +        
Sbjct: 263 WVTANCSFPYTAPELLNVKLNSTIDCKADIWSVGCTCYAMLFGMSPFERELQVSGASLTY 322

Query: 252 AILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRIQ 299
           AI   K+ FP   +Y++ L  +I   L   P  RP+I ++L+ +  +Q
Sbjct: 323 AIGCGKYTFPKQTRYSESLLAVIKSCLQVDPTARPDINELLDTLQDLQ 370

>KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {ON}
           similar to uniprot|Q7LGU7 Saccharomyces cerevisiae
           YPL236C Hypothetical ORF
          Length = 346

 Score = 94.0 bits (232), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 82/336 (24%), Positives = 144/336 (42%), Gaps = 55/336 (16%)

Query: 10  QPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGPIQGSLACLKRVHVP--DKPSLNT 67
           QP  + +V  H   I + L  GGF+ +Y  E    G     L  LK++  P     S++ 
Sbjct: 15  QPSYV-SVNGHRYHIKRLLGEGGFSFVYLVESRENG-----LMALKKIRCPFGSIGSISP 68

Query: 68  LRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQ-- 125
              EVD  +  K   ++   IDS   +    DG+  VY+L+ Y  +G L D +N  L   
Sbjct: 69  AMKEVDNYQKFKS-PYIAQIIDSQVVQ--ERDGSKTVYILLPYFSKGSLQDEINRHLLDC 125

Query: 126 TRLSEFEVLKIMSHVAQGIMAMHALVPP-------------------------------- 153
           T++ E EV+++   VA+G++ +H   P                                 
Sbjct: 126 TQVPELEVVRLALGVARGLLCIHDAAPADESDVTYSIVSAPYAEDSSLLNDLELDTFGES 185

Query: 154 ---LIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRA 210
                H DIK  N++IS +G   + D GS S       +       Q    ++ T  + A
Sbjct: 186 HQAYAHHDIKPSNIMISSEGMPVISDLGSCSRACVEINSRQALLQFQEWRSEHCTLTFMA 245

Query: 211 PEMIDLYRALPVDEKSDIWALGVFLYKVCYFTTPFEKVGE-------NAILQAKFQFPSY 263
           PE++D+     + EK D+W+ G  +Y +C+  +PFE+  +        ++   K+  PS 
Sbjct: 246 PEILDVKLNSVITEKCDVWSFGCTIYTMCFGISPFEREEQISGASVTYSLTTGKYSIPSG 305

Query: 264 PQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRIQ 299
             Y+  L +++   L+  P  RP++ +++  +  +Q
Sbjct: 306 TNYSSGLIDVVKKCLNVDPDGRPSVDELISLLMDLQ 341

>ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakly
            similar to uniprot|P31374 Saccharomyces cerevisiae
            YAL017W PSK1 One of two (see also PSK2) PAS domain
            containing S/T protein kinases coordinately regulates
            protein synthesis and carbohydrate metabolism and storage
            in response to a unknown metabolite that reflects
            nutritional status
          Length = 1262

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 70/233 (30%), Positives = 110/233 (47%), Gaps = 33/233 (14%)

Query: 65   LNTLRAEVDAMKMLKGH--RHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRG--GLIDFM 120
            L T+ +E+  M  L  H   ++++ ID               Y  +E  + G  G ID  
Sbjct: 1049 LGTIPSEIQIMAALNKHPDGNILTLIDFFEDDD---------YYYIETPVHGETGCIDLF 1099

Query: 121  N-SRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGS 179
            +   L+T ++E+E   I   V   I  +H+    ++HRDIK ENV++   G  K+ DFGS
Sbjct: 1100 DLIELKTNMTEYEAKLIFRQVVSAIRHLHS--QGIVHRDIKDENVVVDSKGFVKLIDFGS 1157

Query: 180  VSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEK-SDIWALGVFLYKV 238
             + V   P + +             T  Y APE++      P D K  DIWA+GV LY +
Sbjct: 1158 AAYVKSGPFDVFV-----------GTIDYAAPEVL---SGEPFDGKPQDIWAIGVLLYTI 1203

Query: 239  CYFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQV 291
             +   PF  + E  IL+   +F      ++   NLI ++L+++P QRP I +V
Sbjct: 1204 VFKENPFYNIDE--ILEVNLKFHGTKGVSEECINLIKMILNKNPSQRPTIDEV 1254

>YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON}
           ENV7Protein proposed to be involved in vacuolar
           functions; mutant shows defect in CPY processing; has
           sequence similarity with the human serine/threonine
           protein kinase STK16
          Length = 364

 Score = 92.0 bits (227), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 82/331 (24%), Positives = 142/331 (42%), Gaps = 62/331 (18%)

Query: 15  LTVGSHEVKIIQYLTSGGFAQIYSCE------VLSPGPIQGSLACLKRVHVPDKPSLNTL 68
           + V     +I + L  GG + +Y  +      ++  G     L  LK++  P   S++  
Sbjct: 23  IRVNDKRYRIQRLLGEGGMSFVYLVQLSKNSLIIDNGIATPELYALKKIICPSVESISNG 82

Query: 69  RAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQ--T 126
             E++  K  +   +V+  IDS   +    DG+  +Y+++ Y   G L D +N RL   T
Sbjct: 83  MREIENYKRFQSP-YVIKSIDSQVMQ--EKDGSKTIYIVLPYYSLGSLQDSINRRLLEGT 139

Query: 127 RLSEFEVLKIMSHVAQGIMAMH--------------------------ALV---PPL--- 154
            +SE E ++IM  V +G++ +H                          A++    PL   
Sbjct: 140 FVSEAECVRIMLGVTRGLLCLHDPASRQDNATSRVNVDAVSMTYSDETAMLLEDTPLEMD 199

Query: 155 ------------IHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILK 202
                        HRDI   N+L S DG   + D GS S      +N ++ + +Q  +  
Sbjct: 200 MLSSNSAGSIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIENRHQLSELQEWVND 259

Query: 203 NTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYFTTPFEKVGE-------NAILQ 255
           N T  Y  PE+++L     +  K DIW+LG   Y + +  +PFE+  +        AI  
Sbjct: 260 NCTLPYTPPELLNLKLNQVLSSKVDIWSLGCTFYTLMFGISPFEREEQIHGASLTYAINT 319

Query: 256 AKFQFPSYPQYTDRLKNLISVMLSEHPVQRP 286
            K+ FP   ++++ L ++I   +   P+QRP
Sbjct: 320 GKYSFPRNSRFSEGLLSVIKKCIQVDPIQRP 350

>NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1411

 Score = 94.0 bits (232), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 76/287 (26%), Positives = 125/287 (43%), Gaps = 49/287 (17%)

Query: 24   IIQYLTSGGFAQIYSCEVLSPGPIQGSLACLKRV---------HVPDKPSLNTLRAEVDA 74
            I+Q +  G + ++  C        +  + C+K +          V D+  L T+ +E+  
Sbjct: 1153 ILQKMGEGAYGKVNLC----IHKKEKYIVCIKMIFKERILVDTWVRDR-KLGTIPSEIQI 1207

Query: 75   MKML--KGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRG--GLIDFMN-SRLQTRLS 129
            M  L  K H +++  +D     +         Y  +E  + G  G ID  +    +T ++
Sbjct: 1208 MATLNKKPHENILRLLDFFEDDN---------YYYIETPIHGETGCIDLFDLIEFKTNMT 1258

Query: 130  EFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKN 189
            EFE   I   V  GI  +H     ++HRDIK ENV++   G  K+ DFGS + V   P +
Sbjct: 1259 EFEAKLIFKQVVSGIKHLHH--QGIVHRDIKDENVIVDSKGLVKIIDFGSAAYVKSGPFD 1316

Query: 190  AYEFNYVQHDILKNTTAQYRAPEMI--DLYRALPVDEKSDIWALGVFLYKVCYFTTPFEK 247
             +             T  Y APE++  + Y   P     DIWALG+ LY + +   PF  
Sbjct: 1317 VFV-----------GTIDYAAPEVLSGEPYEGKP----QDIWALGILLYTIVFKENPFYN 1361

Query: 248  VGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEE 294
            + E  IL+   +F S  + T+    LI  +L      RP I ++ ++
Sbjct: 1362 IDE--ILEGDLKFDSNTEVTEDCMELIKKVLIRQVRNRPAIDEIFDD 1406

>ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} similar
           to uniprot|Q7LGU7 Saccharomyces cerevisiae YPL236C
           Hypothetical ORF
          Length = 369

 Score = 90.9 bits (224), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 87/334 (26%), Positives = 141/334 (42%), Gaps = 63/334 (18%)

Query: 15  LTVGSHEVKIIQYLTSGGFAQIYSCE----VLSPGPIQGSLACLKRVHVP--DKPSLNTL 68
           L++      I + L    F+ IY  +    V +    + +L  LKR+  P  +  S++  
Sbjct: 26  LSINGRRYSIKKLLGESNFSFIYLVQQIGSVTASSTPRTNLYALKRIRCPFGNIESISGA 85

Query: 69  RAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRL--QT 126
             EVD  K  +   +++  +DS  A+  + DG+  VY+L+ Y   G L D  +  L   T
Sbjct: 86  MKEVDNYKRFQSP-YIIHLVDSQVAQ--QRDGSKTVYILLPYFPLGSLQDSTSRNLLNGT 142

Query: 127 RLSEFEVLKIMSHVAQGIMAMH--------------------------ALV---PPL--- 154
            +SE E ++I+  +A+G+  +H                          A +    PL   
Sbjct: 143 FISEAECIRIVIGIARGLRCLHDPSARSQDAEQQQEHDAVSMSYSDEAAFLLEDTPLELD 202

Query: 155 -------------IHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDIL 201
                         HRDIK  N+L S DG   + + GS S          +   +Q  + 
Sbjct: 203 ILSSANTINSNFYAHRDIKPSNILFSSDGLPVISNLGSCSKADLSINTGMQLTELQAWVS 262

Query: 202 KNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYFTTPFEKVGE-------NAIL 254
            + T  Y APE++ +     VD K DIW+LG   Y + +  +PFE+  +        AI 
Sbjct: 263 DHCTVAYTAPELLHITLNRSVDTKVDIWSLGCTCYFMLFGISPFEREEQISGASLKYAIG 322

Query: 255 QAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNI 288
              F FPS  +Y++ L  LI+  L  +P  RP+I
Sbjct: 323 TGNFSFPSQDRYSEGLLKLITKCLQVNPAARPDI 356

>NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {ON}
           Anc_6.31
          Length = 750

 Score = 92.4 bits (228), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 73/292 (25%), Positives = 134/292 (45%), Gaps = 28/292 (9%)

Query: 8   CLQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGPIQGSLACLKRVHVPDKPSLNT 67
           C  P  ++     + +   +L  GGFA+ +  +  S G I  +   + ++ +  + +   
Sbjct: 81  CKTPPSLIKTRGRDYRREHFLGEGGFARCFQIKDES-GKIFAA-KTVAKISIKSEKTKRK 138

Query: 68  LRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTR 127
           L +E+   K +K H ++V +ID     +        VY+L+E C  G L+D +  R    
Sbjct: 139 LLSEIQIHKSMK-HSNIVQFIDCFEDDA-------NVYILLEICPNGSLMDLLKKR--KS 188

Query: 128 LSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPP 187
           L+E EV    + +   I  +H+    +IHRD+K+ N+    D + KV DFG  + +    
Sbjct: 189 LTEPEVRFFTTQICGAIKYLHS--RRIIHRDLKLGNIFFDKDYNLKVGDFGLAAVLANDR 246

Query: 188 KNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYFTTPFEK 247
           +  Y             T  Y APE++ + +      + DIW++GV +Y +     PF+ 
Sbjct: 247 ERKYTV---------CGTPNYIAPEVL-MGKHSGHSFEVDIWSIGVMIYALLVGKPPFQA 296

Query: 248 VGENAILQ----AKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEV 295
              N I +     K+ +P     +   + LI  +LS +P+QRP I  ++++V
Sbjct: 297 KDVNVIYERIKLCKYGYPKDKYVSKEAEILIHDILSLNPLQRPTIIDIIDDV 348

>TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {ON}
           Anc_6.31 YMR001C
          Length = 798

 Score = 91.7 bits (226), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 77/288 (26%), Positives = 128/288 (44%), Gaps = 38/288 (13%)

Query: 28  LTSGGFAQIYSCEVLSPGPIQGSLACLKRVHVPDKPSLNTLRAEVDAMKMLKGHR----- 82
           L  GGFA+ +  +      +  S AC     +  K S+ T R +   +  ++ H+     
Sbjct: 99  LGEGGFARCFHIK----DDVGISFAC----KIVSKKSIKTERTKFKLLSEIQIHQNLRYS 150

Query: 83  HVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQ 142
           H+V ++D         +    VY+L+E C  G L+D +  R    L+E EV  + + V  
Sbjct: 151 HIVKFMDCF-------EDELNVYILLELCPNGSLMDLLKKR--KILTEAEVKFMTTQVCG 201

Query: 143 GIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILK 202
            I  MH+    +IHRD+K+ NV    + + K+ DFG  + +    +  Y           
Sbjct: 202 AINYMHS--NNIIHRDLKLGNVFFDKNFNIKIGDFGLAATLSNVSEKKYTM--------- 250

Query: 203 NTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYFTTPFEKVGENAILQ----AKF 258
             T  Y APE+I L + +    ++DIW+LG+ +Y +     PF+      I +     ++
Sbjct: 251 CGTPNYIAPEVI-LSKQIGHSFEADIWSLGIMIYAMVLGKPPFQAKDVTTIYEKIKLCQY 309

Query: 259 QFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRIQGVPCPLP 306
           +FP     T+ +K LI  +L   P QRP I  +L+        P  LP
Sbjct: 310 EFPPDKYITNDVKVLIQDLLVLDPSQRPRIMDILKYNWFKHSFPPKLP 357

>Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON}
           (41658..43772) [2115 nt, 705 aa]
          Length = 704

 Score = 91.3 bits (225), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 75/273 (27%), Positives = 130/273 (47%), Gaps = 28/273 (10%)

Query: 27  YLTSGGFAQIYSCEVLSPGPIQGSLACLKRVHVPDKPSLNTLRAEVDAMKMLKGHRHVVS 86
           +L  GGFA+ +  +  S G I  +   + ++ +  + +   L +E+   K +K H++VV 
Sbjct: 87  FLGEGGFARCFQIKDDS-GKIFAA-KTVAKLSIKSEKTRKKLLSEIQIHKSMK-HQNVVQ 143

Query: 87  YIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMA 146
           +ID         D T  VY+L+E C  G L+D +  R    L+E EV    + +   I  
Sbjct: 144 FIDCF------EDDT-NVYILLEICPNGSLMDLLKKR--KLLTEPEVRFFTTQICGAIKY 194

Query: 147 MHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTA 206
           MH+    +IHRD+K+ N+    + + K+ DFG  + +    +  Y             T 
Sbjct: 195 MHS--RRVIHRDLKLGNIFFDRNYNLKIGDFGLAAVLANDRERKYTVC---------GTP 243

Query: 207 QYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYFTTPFEKVGENAILQ----AKFQFPS 262
            Y APE++ + +      + DIW++GV LY +     PF+    N I +      F FP 
Sbjct: 244 NYIAPEVL-MGKHSGHSYEVDIWSIGVMLYALLIGKPPFQSKDVNTIYERIKCCDFSFPK 302

Query: 263 YPQYTDRLKNLISVMLSEHPVQRPNICQVLEEV 295
               ++  K LI  +LS  P++RP+I ++++ V
Sbjct: 303 EKHISNEAKVLIQDLLSLDPLERPSISEIMDYV 335

>Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C
           (REAL)
          Length = 364

 Score = 89.0 bits (219), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 82/331 (24%), Positives = 142/331 (42%), Gaps = 62/331 (18%)

Query: 15  LTVGSHEVKIIQYLTSGGFAQIYSCEVL------SPGPIQGSLACLKRVHVPDKPSLNTL 68
           + V     KI + L  GG + +Y  ++L        G I   +  LK++  P   S++  
Sbjct: 23  IRVNDKRYKIQRLLGEGGMSFVYLVQLLKNSLIMENGIITPEMYALKKIICPSVESISNG 82

Query: 69  RAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQ--T 126
             E++  K  +   +V+  IDS   +    +G+  +Y+++ Y   G L D +N RL   T
Sbjct: 83  MREIENYKRFQSP-YVIQSIDSQVTQ--EKNGSKIIYIILPYYSLGSLQDSINRRLLEGT 139

Query: 127 RLSEFEVLKIMSHVAQGIMAMH--------------------------ALV---PPL--- 154
            +SE E ++IM  V +G++ +H                          A++    PL   
Sbjct: 140 FISEAECVRIMLGVTRGLLCLHDPASRQDNITPRVNVDAVSMTYSDETAMLLEDTPLEMD 199

Query: 155 ------------IHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILK 202
                        HRDI   N+L S +G   + D GS S       +  + + +Q  +  
Sbjct: 200 VLSSGSAGSIAYAHRDITPSNILYSSEGLPVIADLGSCSQADIRIGSRNQLSELQEWVND 259

Query: 203 NTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYFTTPFEKVGE-------NAILQ 255
           N T  Y APE+++L     +  K DIW++G   Y + +  +PFE+  +        AI  
Sbjct: 260 NCTLPYTAPELLNLKLNQILSCKVDIWSMGCTFYTLMFGISPFEREEQIHGASITYAINT 319

Query: 256 AKFQFPSYPQYTDRLKNLISVMLSEHPVQRP 286
            K+ FP   ++++ L N+I   +   P+QRP
Sbjct: 320 GKYSFPRNSRFSEALLNVIKKCIQVDPIQRP 350

>KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8.279
           YLR096W
          Length = 1095

 Score = 91.3 bits (225), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 65/213 (30%), Positives = 107/213 (50%), Gaps = 24/213 (11%)

Query: 105 YLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENV 164
           Y+L EY   G L+D++       L E    K    VA  +  +HA    ++HRD+KIEN+
Sbjct: 201 YMLFEYVSGGQLLDYIIQ--HGSLREHHARKFARGVASALQYLHA--NNIVHRDLKIENI 256

Query: 165 LISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALP-VD 223
           +IS  G+ K+ DFG +S V    K  + F           +  + APE++   +A P + 
Sbjct: 257 MISTSGEIKIIDFG-LSNVFDTRKQLHTF---------CGSLYFAAPELL---KANPYIG 303

Query: 224 EKSDIWALGVFLYKVCYFTTPFEK----VGENAILQAKFQFPSYPQYTDRLKNLISVMLS 279
            + DIW+ GV LY +     PF+     V    I Q K ++P++   +  + +L+S ML 
Sbjct: 304 PEVDIWSFGVVLYVLVCGKVPFDDENSSVLHEKIKQGKVEYPNH--LSIEVISLLSKMLV 361

Query: 280 EHPVQRPNICQVLEEVSRIQGVPCPLPNFYLER 312
             P++R N+ +V+E    I+G   P P++  +R
Sbjct: 362 VDPLKRANLTKVIEHPWMIRGYDFPPPSYLPKR 394

>CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa]
           {ON} highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication
          Length = 746

 Score = 90.5 bits (223), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 71/274 (25%), Positives = 130/274 (47%), Gaps = 28/274 (10%)

Query: 26  QYLTSGGFAQIYSCEVLSPGPIQGSLACLKRVHVPDKPSLNTLRAEVDAMKMLKGHRHVV 85
           Q+L  GGFA+ +  +  S G I  +   + ++ +  + +   L +E+   K +  H ++V
Sbjct: 85  QFLGEGGFARCFQIKDDS-GKIFAA-KTVAKISIKSEKTRKKLLSEIQIHKSM-SHTNIV 141

Query: 86  SYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIM 145
            +ID         +    VY+L+E C  G L++ +  R    ++E EV   M+ +  GI 
Sbjct: 142 QFIDCF-------EDNVNVYILLEICPNGSLMELIKKR--KTITEPEVRFFMTQICGGIQ 192

Query: 146 AMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTT 205
            MH+    +IHRD+K+ N+      + K+ DFG  + +    +  +             T
Sbjct: 193 YMHS--NRVIHRDLKLGNIFFDEHYNLKIGDFGLAAVLANDRERKFTI---------CGT 241

Query: 206 AQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYFTTPFEKVGENAIL----QAKFQFP 261
             Y APE++ + +      + DIW++GV LY +     PF+    N I     Q  F +P
Sbjct: 242 PNYIAPEVL-MGKHSGHSYEVDIWSIGVMLYALLIGKPPFQAKDVNTIYERIKQRNFAYP 300

Query: 262 SYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEV 295
              + +   K LI  +LS +P++RP+I ++++ V
Sbjct: 301 KDKKISQDAKYLIDDILSLNPMERPSIQEIMDYV 334

>TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_7.86
            YAL017W
          Length = 1262

 Score = 90.9 bits (224), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 65/236 (27%), Positives = 109/236 (46%), Gaps = 35/236 (14%)

Query: 65   LNTLRAEVDAMKMLK--GHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRG--GLIDFM 120
            L T+ +E+  M  L    +++++S +D               Y  +E  + G  G ID  
Sbjct: 1049 LGTIPSEIQIMSTLNKTSNKNILSILDFFEDDD---------YYYVEQPVHGKTGCIDLF 1099

Query: 121  N-SRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGS 179
            +    +T ++EFE   I   +  GI  +H     ++HRDIK ENV++   G  K+ DFGS
Sbjct: 1100 DLIEFKTNMTEFEAKLIFKQIISGISHLHE--SGIVHRDIKDENVIVDAKGFVKLIDFGS 1157

Query: 180  VSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMI--DLYRALPVDEKSDIWALGVFLYK 237
             + V   P + +             T  Y +PE++  + Y   P     DIWALG+ LY 
Sbjct: 1158 AAYVKNGPFDVFV-----------GTIDYASPEVLRGEKYEGKP----QDIWALGILLYT 1202

Query: 238  VCYFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLE 293
            + +   PF  + E  IL+   +FP     +    +LI ++L+   ++RP+I  + E
Sbjct: 1203 IVFKENPFYNIDE--ILEGDMKFPETENISANCIDLIKLILNRSALERPSITDISE 1256

>Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON}
           (44906..47596) [2691 nt, 897 aa]
          Length = 896

 Score = 90.5 bits (223), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 64/203 (31%), Positives = 97/203 (47%), Gaps = 39/203 (19%)

Query: 103 EVYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIE 162
           +V++++EYC    L D++ S+   R+S  E  +I + +   +   H+L    +HRD+K+E
Sbjct: 104 KVWMVIEYCPNKELYDYLLSK--KRISLDESARIFAQIVGAVYYAHSL--SCVHRDLKLE 159

Query: 163 NVLISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNT-------TAQYRAPEMID 215
           N+L+  D + K+ DFG                    D  KNT       T  Y APE+  
Sbjct: 160 NILLDKDNNAKLTDFG-----------------FTRDFSKNTQLETICGTTVYMAPEL-- 200

Query: 216 LYRALPVDEKSDIWALGVFLYKVCYFTTPFE----KVGENAILQAKFQFPSYPQ--YTDR 269
           L R      K DIWALG+ LY +   T PF+    K  E  I+ A    P Y    + D 
Sbjct: 201 LRREKYDGYKIDIWALGILLYTIINGTMPFDEDDPKKTELKIISAS---PDYDNKYFNDD 257

Query: 270 LKNLISVMLSEHPVQRPNICQVL 292
             +L++ +LS+ P  RP I Q+L
Sbjct: 258 SIDLVNRLLSKDPSMRPTIEQIL 280

>KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017W PSK1 One
            of two (see also PSK2) PAS domain containing S/T protein
            kinases coordinately regulates protein synthesis and
            carbohydrate metabolism and storage in response to a
            unknown metabolite that reflects nutritional status
          Length = 1229

 Score = 90.5 bits (223), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 78/285 (27%), Positives = 126/285 (44%), Gaps = 45/285 (15%)

Query: 24   IIQYLTSGGFAQIYSCEVLSPGPIQGSLACLKRVH---------VPDKPSLNTLRAEVDA 74
            ++Q +  G + ++  C           +  +KR++         V D+ +L T+ +E+  
Sbjct: 971  VLQKMGEGAYGKVDLC----MHKKDKYIVVIKRIYKERILVDTWVRDR-TLGTIPSEIQI 1025

Query: 75   MKML--KGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMN-SRLQTRLSEF 131
            M  L  K H +++  +D         D  Y  YL  E     G ID  +   L+T ++EF
Sbjct: 1026 MVTLNRKPHENILRILDFF------EDDDY-YYLETEMHGETGSIDLFDLIELKTNMTEF 1078

Query: 132  EVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKNAY 191
            E   +   VA GI  +H     ++HRDIK ENV++   G  K+ DFGS + V   P + +
Sbjct: 1079 EAKLLFKQVASGIKHLHD--NGIVHRDIKDENVIVDNKGFVKLIDFGSAAYVKSGPFDVF 1136

Query: 192  EFNYVQHDILKNTTAQYRAPEMI--DLYRALPVDEKSDIWALGVFLYKVCYFTTPFEKVG 249
                         T  Y APE++  + Y   P     DIWA+GV LY + Y   PF  + 
Sbjct: 1137 V-----------GTIDYAAPEVLGGEPYEGKP----QDIWAIGVLLYTIIYKENPFYNID 1181

Query: 250  ENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEE 294
            E  IL    +  S  + +     LI  +L+    +RP I  ++E+
Sbjct: 1182 E--ILDGDLRIQSTHEVSAECVALIRKILNRSVSKRPTIDDIMED 1224

>KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7.86
            YAL017W
          Length = 1440

 Score = 90.5 bits (223), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 67/237 (28%), Positives = 106/237 (44%), Gaps = 35/237 (14%)

Query: 65   LNTLRAEVDAMKMLKG--HRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRG--GLIDFM 120
            L T+ +E+  M  L    H +++  +D               Y  +E  + G  G ID  
Sbjct: 1227 LGTIPSEIQIMATLNKQPHENILRLLDFFEDDD---------YYYIETPIHGETGCIDLF 1277

Query: 121  N-SRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGS 179
            +   L+  ++E EV  I   +  GI  +H     +IHRDIK ENV++   G  K+ DFGS
Sbjct: 1278 DLIELKNNMTEMEVKLIFKQIVSGIKHLHD--QAIIHRDIKDENVIVDATGFVKLIDFGS 1335

Query: 180  VSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMI--DLYRALPVDEKSDIWALGVFLYK 237
             + V   P + +             T  Y APE++  D Y   P     DIWA+G+ LY 
Sbjct: 1336 AAHVKSGPFDVFV-----------GTIDYAAPEVLSGDPYEGKP----QDIWAIGILLYT 1380

Query: 238  VCYFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEE 294
            + +   PF  + E  IL+ +  F      +   K LIS++L+ +  +RP I  +  +
Sbjct: 1381 IVFKENPFYNIDE--ILEGELTFSESSDVSAECKALISMILNRNVQKRPTIDDIYND 1435

>KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7.86
            YAL017W
          Length = 1055

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 77/281 (27%), Positives = 123/281 (43%), Gaps = 41/281 (14%)

Query: 24   IIQYLTSGGFAQIYSCE-------VLSPGPIQGSLACLKRVHVPDKPSLNTLRAEVDAMK 76
            ++Q L  G +  ++ C        V+    I+  +  L    V D+    T+ +E+  M 
Sbjct: 797  VLQKLGDGAYGHVHLCMNKKTKHLVIIKAIIKERI--LIDTWVRDR-EFGTIPSEIYIMS 853

Query: 77   MLKGHRH--VVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMN-SRLQTRLSEFEV 133
                H H  +   +D         D  Y  Y+ +E     G ID  +   L+T ++EFE 
Sbjct: 854  KFNAHPHDNITQIMDFF------EDDDY-YYIELESHGETGSIDLFDLIELKTNMTEFEA 906

Query: 134  LKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKNAYEF 193
              I   +  GI  +H     ++HRDIK ENV++  +G  K+ DFGS +     P   +  
Sbjct: 907  KLIFKQIVSGIKYLHD--QGIVHRDIKDENVIVDSNGFVKLIDFGSAAYTKTGPFEVFV- 963

Query: 194  NYVQHDILKNTTAQYRAPEMI--DLYRALPVDEKSDIWALGVFLYKVCYFTTPFEKVGEN 251
                       T  Y APE++  + Y+  P     DIWALGV LY + Y   PF  V E 
Sbjct: 964  ----------GTIDYAAPEILGGNPYKGKP----QDIWALGVLLYTLIYKENPFYNVDE- 1008

Query: 252  AILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVL 292
             IL+ + +F      T    +LI  +L++    RP+I +++
Sbjct: 1009 -ILEGQLRFDGTCNVTQDCIDLIRWILTKSVNDRPSIDEIV 1048

>Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045W -
            Hypothetical ORF [contig 47] FULL
          Length = 1213

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 68/234 (29%), Positives = 109/234 (46%), Gaps = 35/234 (14%)

Query: 65   LNTLRAEVDAMKML--KGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRG--GLIDFM 120
            L T+ +E+  M  L  K H +++  +D               Y  +E  + G  G ID  
Sbjct: 1000 LGTIPSEIQIMATLNAKPHENILMLLDFFEDDD---------YYYIETAVHGTSGSIDLF 1050

Query: 121  N-SRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGS 179
            +   ++T ++E E + I   +A GI  +H     ++HRDIK ENV++  +G  K+ DFGS
Sbjct: 1051 DLIEMKTDMTEHEAMLIFKQIASGIKNLHD--NGIVHRDIKDENVIVDCNGFVKIVDFGS 1108

Query: 180  VSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMI--DLYRALPVDEKSDIWALGVFLYK 237
             + V   P + +             T  Y APE++  + Y   P     DIWA+GV LY 
Sbjct: 1109 AAYVKSGPFDVFV-----------GTIDYAAPEVLGGEPYEGKP----QDIWAIGVLLYT 1153

Query: 238  VCYFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQV 291
            + Y   PF  + E  IL A  +  S  + +D    LI  +L+    +RP+I ++
Sbjct: 1154 IIYKENPFYNIDE--ILDADLRVNSSERISDDCIALIRKILNRSVSKRPSIDEI 1205

>Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON}
           (51805..54024) [2220 nt, 740 aa]
          Length = 739

 Score = 88.6 bits (218), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 68/270 (25%), Positives = 127/270 (47%), Gaps = 27/270 (10%)

Query: 27  YLTSGGFAQIYSCEVLSPGPIQGSLACLKRVHVPDKPSLNTLRAEVDAMKMLKGHRHVVS 86
           +L  GGFA+ +  +    G +  +   + ++ +  + + N L +E+   K ++ H+++V 
Sbjct: 103 FLGEGGFARCFQMKD-DDGKVFAA-KTVAKISIKSEKARNKLLSEIQIHKNMR-HQNIVH 159

Query: 87  YIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMA 146
           +ID         +    VY+L+E C  G L+D +  R    L+E EV    + +   +  
Sbjct: 160 FIDCF-------EDDINVYILLEICPNGSLMDLLKRR--KILTEPEVRFFTTQICGALDH 210

Query: 147 MHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTA 206
           MH+    +IHRD+K+ N+    D + K+ DFG  + +    +  Y             T 
Sbjct: 211 MHS--RNIIHRDLKLGNIFFDKDFNLKIGDFGLAAIINNENERKYTI---------CGTP 259

Query: 207 QYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYFTTPFEKVGENAIL----QAKFQFPS 262
            Y APE+I   + +    + DIW+LGV ++ +     PF+    + I        + FP+
Sbjct: 260 NYIAPEVIMGGKQIGHSFEVDIWSLGVMIFAMITGKPPFQAKEVSTIYDRIKHCNYSFPT 319

Query: 263 YPQYTDRLKNLISVMLSEHPVQRPNICQVL 292
               +  +K LI  +LS +P++RP I ++L
Sbjct: 320 DKYVSKDVKKLIQDILSMNPMERPTIQEIL 349

>KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {ON}
           Anc_6.31 YMR001C
          Length = 711

 Score = 88.6 bits (218), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 72/273 (26%), Positives = 130/273 (47%), Gaps = 28/273 (10%)

Query: 27  YLTSGGFAQIYSCEVLSPGPIQGSLACLKRVHVPDKPSLNTLRAEVDAMKMLKGHRHVVS 86
           +L  GGFA+ +  +  S G I  +   + ++ +  + +   L +E+   K ++ H +VV 
Sbjct: 96  FLGEGGFARCFQIKDES-GKIFAA-KTVAKISIKSEKTRKKLLSEIQIHKSMR-HFNVVQ 152

Query: 87  YIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMA 146
           +ID         D T  VY+L+E C  G L++ +  R    ++E EV   M+ +   I  
Sbjct: 153 FIDCF------EDDT-NVYILLEICPNGSLMELLKKR--RTVTEPEVRYFMTQICGAIKY 203

Query: 147 MHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTA 206
           MH+    +IHRD+K+ N+    + + K+ DFG  + +    +  Y             T 
Sbjct: 204 MHS--RRVIHRDLKLGNIFFDKNYNLKIGDFGLAAVLANDRERKYTVC---------GTP 252

Query: 207 QYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYFTTPFEKVGENAILQA----KFQFPS 262
            Y APE++ + +      + DIW++GV +Y +     PF+    N I +      F FP 
Sbjct: 253 NYIAPEVL-MGKHSGHSYEVDIWSIGVMIYALLIGKPPFQSKDVNMIYERIKNRDFAFPK 311

Query: 263 YPQYTDRLKNLISVMLSEHPVQRPNICQVLEEV 295
               ++  K LI  +LS  P++RP+I ++++ V
Sbjct: 312 DKYISNEAKTLIHDILSTDPLERPSIEEIIDYV 344

>Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 88.2 bits (217), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 75/286 (26%), Positives = 130/286 (45%), Gaps = 28/286 (9%)

Query: 26  QYLTSGGFAQIYSCEVLSPGPIQGSLACLKRVHVPDKPSLNTLRAEVDAMKMLKGHRHVV 85
            +L  GGFA+ +  +  S G I  +   + +  +  + +   L +E+   K +  H ++V
Sbjct: 86  HFLGEGGFARCFQIKDDS-GDIFAA-KTVAKASIKSEKTRKKLLSEIQIHKSM-AHPNIV 142

Query: 86  SYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIM 145
            +ID     S        VY+L+E C  G L++ +  R    LSE EV    + +   I 
Sbjct: 143 QFIDCFEDDS-------NVYILLEICPNGSLMELLKRR--KVLSEPEVRFFTTQICGAIK 193

Query: 146 AMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTT 205
            MH+    +IHRD+K+ N+    + + K+ DFG  + +    +  Y             T
Sbjct: 194 YMHS--RRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKYTIC---------GT 242

Query: 206 AQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYFTTPFEKVGENAILQA----KFQFP 261
             Y APE++ + +      + DIW+LGV LY +     PF+    N I +      F FP
Sbjct: 243 PNYIAPEVL-MGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDFSFP 301

Query: 262 SYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRIQGVPCPLPN 307
                +D  K LI  +LS  P++RP++ ++++ V      P  +P+
Sbjct: 302 KDKPISDEGKILIRDILSLDPIERPSLTEIMDYVWFRGTFPPSIPS 347

>TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1237

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 66/238 (27%), Positives = 111/238 (46%), Gaps = 35/238 (14%)

Query: 65   LNTLRAEVDAMKMLKGH--RHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRG--GLIDFM 120
            L T+ +E+  M +L  H   +++  +D               Y  +E  + G  G ID  
Sbjct: 1024 LGTIPSEIQIMAVLNKHPDENILRLLDFFEDDD---------YYYIETPVHGETGSIDLF 1074

Query: 121  N-SRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGS 179
            +   L+T ++EFE   I   V  GI  +H     ++HRDIK ENV++   G  K+ DFGS
Sbjct: 1075 DLIELKTNMTEFEAKLIFKQVISGIKHLHE--QGIVHRDIKDENVIVDSKGFVKLIDFGS 1132

Query: 180  VSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMI--DLYRALPVDEKSDIWALGVFLYK 237
             + V   P + +             T  Y APE++  + Y   P     DIWA+G+ LY 
Sbjct: 1133 AAYVKSGPFDVFV-----------GTIDYAAPEVLGGEPYEGKP----QDIWAVGILLYT 1177

Query: 238  VCYFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEV 295
            + +   PF  + E  I++   +F    + ++   NLI  +L+++  +RP I  + ++V
Sbjct: 1178 IVFKENPFYNIDE--IMEGTLKFSIGSEVSEECVNLIKKILNKNAPKRPTIQDIYDDV 1233

>NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31
          Length = 726

 Score = 88.2 bits (217), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 74/292 (25%), Positives = 135/292 (46%), Gaps = 28/292 (9%)

Query: 8   CLQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGPIQGSLACLKRVHVPDKPSLNT 67
           C  P  ++     + +   +L  GGFA+ +  +  S G I  +   + ++ +  + +   
Sbjct: 78  CKTPPSLIKTRGRDYRRGHFLGEGGFARCFQIKDES-GKIFAA-KTVAKISIKTEKTKKK 135

Query: 68  LRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTR 127
           L +E+   K +K H ++V ++D         D T  VY+L+E C  G L+D M  R    
Sbjct: 136 LLSEIQIHKSMK-HPNIVHFVDCF------EDDT-NVYILLEICSNGSLMDLMKKR--KT 185

Query: 128 LSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPP 187
           L+E EV    + +   +  MH+    +IHRD+K+ N+    D + KV DFG  + +    
Sbjct: 186 LTEPEVRFFTTQICGAVKYMHS--RRVIHRDLKLGNIFFDKDYNLKVGDFGLAAVLANNR 243

Query: 188 KNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYFTTPFEK 247
           +  Y             T  Y APE++ + +      + DIW++GV +Y +     PF+ 
Sbjct: 244 ERKYTV---------CGTPNYIAPEVL-MGKHAGHSFEVDIWSIGVMIYALLVGKPPFQA 293

Query: 248 VGENAILQ----AKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEV 295
              N I       ++ +P     +   K LI+ +L   PV+RP+I +++++V
Sbjct: 294 KDVNVIYDRIKACQYGYPKDKYVSSEAKTLIADILCVDPVERPSIREIIDDV 345

>TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.31
           YMR001C
          Length = 722

 Score = 87.8 bits (216), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 70/273 (25%), Positives = 129/273 (47%), Gaps = 28/273 (10%)

Query: 27  YLTSGGFAQIYSCEVLSPGPIQGSLACLKRVHVPDKPSLNTLRAEVDAMKMLKGHRHVVS 86
           +L  GGFA+ +  +  S G I  +   + ++ +  + +   L +E+   K ++ H ++V 
Sbjct: 106 FLGEGGFARCFQIKDDS-GKIFAA-KTVAKLSIKTEKTRKKLLSEIQIHKSMR-HANIVQ 162

Query: 87  YIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMA 146
           +ID    ++        VY+L+E C  G L++ +  R    L+E EV    + +  GI  
Sbjct: 163 FIDCFEDET-------NVYILLEICPNGSLMELLKKR--KTLTEPEVRFFTTQICGGIKY 213

Query: 147 MHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTA 206
           MH+    +IHRD+K+ N+    + + K+ DFG  + +    +  Y             T 
Sbjct: 214 MHS--RRVIHRDLKLGNIFFDKNYNLKIGDFGLAAVLANDRERKYTVC---------GTP 262

Query: 207 QYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYFTTPFEKVGENAILQ----AKFQFPS 262
            Y APE++ + +      + DIW++GV +Y +     PF+    N I +      F FP 
Sbjct: 263 NYIAPEVL-MGKHSGHSYEVDIWSIGVMIYALLIGKPPFQAKDVNTIYERIKCCDFVFPK 321

Query: 263 YPQYTDRLKNLISVMLSEHPVQRPNICQVLEEV 295
               +   + L+  +LS  P++RP+I +VL+ V
Sbjct: 322 EKYISSEARILVQDLLSLDPLERPSIMEVLDYV 354

>ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1204

 Score = 87.8 bits (216), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 63/214 (29%), Positives = 104/214 (48%), Gaps = 24/214 (11%)

Query: 105 YLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENV 164
           Y+L EY   G L+D++       L E    K    +A  +  +HA    ++HRD+KIEN+
Sbjct: 240 YMLFEYVSGGQLLDYIIQ--HGSLREHHARKFARGIASALQYLHA--NNIVHRDLKIENI 295

Query: 165 LISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALP-VD 223
           +IS  G+ K+ DFG +S +  P    + F           +  + APE++   +A P V 
Sbjct: 296 MISTSGEIKIIDFG-LSNMFDPRTQLHTF---------CGSLYFAAPELL---KASPYVG 342

Query: 224 EKSDIWALGVFLYKVCYFTTPFEK----VGENAILQAKFQFPSYPQYTDRLKNLISVMLS 279
            + D+W+ GV LY +     PF+     V    I Q K  +P +   +  + +L+S ML 
Sbjct: 343 PEVDVWSFGVVLYVLVCGKVPFDDENSSVLHEKIKQGKVDYPQH--LSIEVISLLSKMLV 400

Query: 280 EHPVQRPNICQVLEEVSRIQGVPCPLPNFYLERM 313
             P +R ++ QV+E    I+G   P P++   R+
Sbjct: 401 VDPRKRASLKQVVEHHWMIRGYDFPAPSYVPNRI 434

>SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 884

 Score = 87.8 bits (216), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 60/200 (30%), Positives = 99/200 (49%), Gaps = 33/200 (16%)

Query: 103 EVYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIE 162
           +V++ +EYC    L +++   +Q R+S  E  K+ + +   +   H+L    +HRD+K+E
Sbjct: 102 KVWMALEYCPGKELYEYL--LMQHRISLEESGKLFAQIVSAVYYAHSL--QCVHRDLKLE 157

Query: 163 NVLISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNT--TAQYRAPEMIDL--YR 218
           N+L+   G  K+ DFG            +        +L+    T  Y APE+I+   Y 
Sbjct: 158 NILLDKKGRAKITDFG------------FTRECATKTMLETVCGTTVYMAPELIERKSYD 205

Query: 219 ALPVDEKSDIWALGVFLYKVCYFTTPFEKVGENAILQAKFQ-FPSYPQYTDRL-----KN 272
              +    DIW+LGV LY + + T PF++  E    + K++     P Y D +     K+
Sbjct: 206 GFKI----DIWSLGVILYTMIHGTMPFDEEDE---TKTKWKIINEEPFYNDDVVSKDAKD 258

Query: 273 LISVMLSEHPVQRPNICQVL 292
           LIS +L + P QRP + QVL
Sbjct: 259 LISQLLCKDPSQRPQLSQVL 278

>Skud_16.340 Chr16 (631100..632266) [1167 bp, 388 aa] {ON} YPR054W
           (REAL)
          Length = 388

 Score = 85.5 bits (210), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 67/221 (30%), Positives = 106/221 (47%), Gaps = 27/221 (12%)

Query: 23  KIIQYLTSGGFAQIYSCEVLSPGPIQGSLACLKRVHVPDKPSL--NTLRAEVDAMKMLKG 80
           +IIQ+L  G +  + S +     P    +A  K  ++ +K  L    +R E+  M   KG
Sbjct: 39  EIIQFLGKGAYGTVCSVKFKGQNP-PAKIAVKKISNIFNKEILLKRAIR-ELKFMNFFKG 96

Query: 81  HRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHV 140
           H+++V+ ID     S  +DG Y    L++Y     L   ++S +Q  LSEF +   +  +
Sbjct: 97  HKNIVNLIDLEIVSSSPYDGLYCYQELIDY----DLAKVIHSSVQ--LSEFHIKYFLYQI 150

Query: 141 AQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGV------IRPPKNAYEFN 194
             G+  +H+    +IHRD+K  N+L + +G  K+CDFG   G+        P    +  N
Sbjct: 151 LCGLKYIHS--ADVIHRDLKPGNILCTLNGCLKICDFGLARGIHAEFFQCNPSVQPHITN 208

Query: 195 YVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFL 235
           YV        T  YRAPE+  L    P ++  DIWA+G  L
Sbjct: 209 YV-------ATRWYRAPEL--LLSNQPYNKSIDIWAVGCIL 240

>Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 86.7 bits (213), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 73/286 (25%), Positives = 130/286 (45%), Gaps = 28/286 (9%)

Query: 26  QYLTSGGFAQIYSCEVLSPGPIQGSLACLKRVHVPDKPSLNTLRAEVDAMKMLKGHRHVV 85
            +L  GGFA+ +  +  S G I  +   + +  +  + +   L +E+   K +  H ++V
Sbjct: 86  HFLGEGGFARCFQIKDDS-GEIFAA-KTVAKASIKSEKTRKKLLSEIQIHKSM-AHPNIV 142

Query: 86  SYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIM 145
            ++D     S        VY+L+E C  G L++ +  R    L+E EV    + +   I 
Sbjct: 143 QFVDCFEDDS-------NVYILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQICGAIK 193

Query: 146 AMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTT 205
            MH+    +IHRD+K+ N+    + + K+ DFG  + +    +  Y             T
Sbjct: 194 YMHS--RRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKYTIC---------GT 242

Query: 206 AQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYFTTPFEKVGENAILQA----KFQFP 261
             Y APE++ + +      + DIW+LGV LY +     PF+    N I +      F FP
Sbjct: 243 PNYIAPEVL-MGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDFSFP 301

Query: 262 SYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRIQGVPCPLPN 307
                +D  K LI  +LS  P++RP++ ++++ V      P  +P+
Sbjct: 302 KDKPISDEGKILIRDILSLDPIERPSLTEIMDYVWFRGTFPPSIPS 347

>Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON}
            (57057..60950) [3894 nt, 1298 aa]
          Length = 1297

 Score = 87.0 bits (214), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 65/239 (27%), Positives = 110/239 (46%), Gaps = 45/239 (18%)

Query: 65   LNTLRAEVDAMKMLKGHRH-----VVSYI---DSHAAKSPRH--DGTYEVYLLMEYCLRG 114
            L T+ +E+  M  L  H H     ++ +    D +  ++P H   G  +++ L+E+    
Sbjct: 1084 LGTILSEIQIMSTLNKHPHDNILRLLDFFEDDDYYYIETPMHGETGCIDLFDLIEF---- 1139

Query: 115  GLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKV 174
                      +T +SE E   I   V   I  +H     ++HRDIK ENV++   G  K+
Sbjct: 1140 ----------KTNMSEVETKLIFMQVVSSIKFLHD--QGIVHRDIKDENVIVDSQGFIKL 1187

Query: 175  CDFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMI--DLYRALPVDEKSDIWALG 232
             DFGS + V   P + +             T  Y APE++  + Y   P     DIWA+G
Sbjct: 1188 IDFGSAAYVKSGPFDVFV-----------GTIDYAAPEVLGGEPYVGKP----QDIWAIG 1232

Query: 233  VFLYKVCYFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQV 291
            + LY + +   PF  + E  IL+A+ +F +     +   +LI  +L+ +P +RP I ++
Sbjct: 1233 ILLYTIIFKENPFYNIDE--ILEAELKFNTSTGACEDCVDLIKRILTRNPTKRPTIDEI 1289

>Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 86.7 bits (213), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 74/285 (25%), Positives = 129/285 (45%), Gaps = 28/285 (9%)

Query: 26  QYLTSGGFAQIYSCEVLSPGPIQGSLACLKRVHVPDKPSLNTLRAEVDAMKMLKGHRHVV 85
            +L  GGFA+ +  +  S G I  +   + +  +  + +   L +E+   K +  H ++V
Sbjct: 86  HFLGEGGFARCFQIKDDS-GEIFAA-KTVAKASIKSEKTRKKLLSEIQIHKSM-SHPNIV 142

Query: 86  SYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIM 145
            +ID     S        VY+L+E C  G L++ +  R    L+E EV    + +   I 
Sbjct: 143 QFIDCFEDDS-------NVYILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQICGAIK 193

Query: 146 AMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTT 205
            MH+    +IHRD+K+ N+    + + K+ DFG  + +    +  Y             T
Sbjct: 194 YMHS--RRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKYTIC---------GT 242

Query: 206 AQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYFTTPFEKVGENAILQA----KFQFP 261
             Y APE++ + +      + DIW+LGV LY +     PF+    N I +      F FP
Sbjct: 243 PNYIAPEVL-MGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDFSFP 301

Query: 262 SYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRIQGVPCPLP 306
                +D  K LI  +LS  P++RP++ ++++ V      P  +P
Sbjct: 302 KDKPISDEGKILIRDILSLDPIERPSLTEIMDYVWFRGTFPPSIP 346

>YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON}
           CDC5Polo-like kinase with multiple functions in mitosis
           and cytokinesis through substrate phosphorylation, also
           functions in adaptation to DNA damage during meiosis;
           has similarity to Xenopus Plx1 and S. pombe Plo1p;
           possible Cdc28p substrate
          Length = 705

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 74/286 (25%), Positives = 130/286 (45%), Gaps = 28/286 (9%)

Query: 26  QYLTSGGFAQIYSCEVLSPGPIQGSLACLKRVHVPDKPSLNTLRAEVDAMKMLKGHRHVV 85
            +L  GGFA+ +  +  S G I  +   + +  +  + +   L +E+   K +  H ++V
Sbjct: 86  HFLGEGGFARCFQIKDDS-GEIFAA-KTVAKASIKSEKTRKKLLSEIQIHKSM-SHPNIV 142

Query: 86  SYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIM 145
            +ID     S        VY+L+E C  G L++ +  R    L+E EV    + +   I 
Sbjct: 143 QFIDCFEDDS-------NVYILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQICGAIK 193

Query: 146 AMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTT 205
            MH+    +IHRD+K+ N+    + + K+ DFG  + +    +  Y             T
Sbjct: 194 YMHS--RRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKYTI---------CGT 242

Query: 206 AQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYFTTPFEKVGENAILQ----AKFQFP 261
             Y APE++ + +      + DIW+LGV LY +     PF+    N I +      F FP
Sbjct: 243 PNYIAPEVL-MGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDFSFP 301

Query: 262 SYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRIQGVPCPLPN 307
                +D  K LI  +LS  P++RP++ ++++ V      P  +P+
Sbjct: 302 RDKPISDEGKILIRDILSLDPIERPSLTEIMDYVWFRGTFPPSIPS 347

>ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR001C (CDC5)
          Length = 708

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 72/279 (25%), Positives = 127/279 (45%), Gaps = 40/279 (14%)

Query: 27  YLTSGGFAQIYSCEVLSPGPIQGSLACLKRVHVPDKPSLNTLRAEVDAMKMLKGHRHVVS 86
           +L  GGFA+ +  +  S G +  +   + ++ +  + +   L +E+   K +K H ++V 
Sbjct: 78  FLGEGGFARCFQMKDDS-GKVFAA-KTVAKISIKSEKTRKKLLSEIQIHKSMK-HPNIVQ 134

Query: 87  YIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMA 146
           + D         D T  VY+L+E C  G L+D +  R Q  L+E EV    + +   I  
Sbjct: 135 FTDCF------EDDT-NVYILLEICPNGSLMDLLKQRKQ--LTEPEVRFFTTQIVGAIKY 185

Query: 147 MHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKNAYEF----NYVQHDIL- 201
           MH+    +IHRD+K+ N+      + K+ DFG  + +    +  Y      NY+  ++L 
Sbjct: 186 MHS--RRIIHRDLKLGNIFFDKHFNLKIGDFGLAAVLANDRERKYTICGTPNYIAPEVLT 243

Query: 202 -KNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYFTTPFEKVGENAILQ----A 256
            K+T   +                  DIW++GV +Y +     PF+    N I +     
Sbjct: 244 GKHTGHSFEV----------------DIWSIGVMIYALLIGKPPFQAKEVNTIYERIKVC 287

Query: 257 KFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEV 295
            F FP     +   K LI  +LS  P++RP++ +++E V
Sbjct: 288 DFSFPKDKPISSEAKVLIKDILSLDPLERPSLAEIMEYV 326

>CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} similar
           to uniprot|Q12236 Saccharomyces cerevisiae YOL100w PKH2
          Length = 1076

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 72/285 (25%), Positives = 127/285 (44%), Gaps = 25/285 (8%)

Query: 14  ILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGPIQGSLACLKRVHVPDKPSLNTLRAEVD 73
           I+  G  + K  + +  G ++ +        G  + ++  L + ++  +  +  +  E +
Sbjct: 174 IIRKGIKDFKFGEMVGDGAYSTVMLATAKDSGK-KYAVKVLNKEYLIKQKKVKYVNIEKN 232

Query: 74  AMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTRLSEFEV 133
           A++ L   R +V    +   +S        +Y L+EY   G  +  M  +    LSE   
Sbjct: 233 ALQRLNNSRGIVKLFFTFQDES-------SLYFLLEYAPNGDFLSVM--KKYGSLSEDCT 283

Query: 134 LKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKNAY-- 191
               + +  GI  +H+    +IHRDIK EN+L+  D   K+ DFG+    I  PKN    
Sbjct: 284 RYYSAQIIDGIKYLHS--KGIIHRDIKPENILLDKDMKVKITDFGTAK--ILEPKNEDED 339

Query: 192 --EFNYVQHDILKNTTAQYRAPEMI-DLYRALPVDEKSDIWALGVFLYKVCYFTTPFEKV 248
             EFN +        TA+Y +PE++ D Y    VD + DIWA G  ++++     PF+  
Sbjct: 340 NPEFNLLTRSKSFVGTAEYVSPELLNDSY----VDARCDIWAFGCMVFQMIAGKPPFKAT 395

Query: 249 GENAILQA--KFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQV 291
            E    Q   K Q+     +   +++L+  +L + P QR  I Q+
Sbjct: 396 NEYLTFQKVMKVQYAFTAGFPVVVRDLVKRILLKVPEQRLTIPQI 440

>TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON}
           Anc_6.31 YMR001C
          Length = 707

 Score = 85.9 bits (211), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 74/279 (26%), Positives = 127/279 (45%), Gaps = 40/279 (14%)

Query: 27  YLTSGGFAQIYSCEVLSPGPIQGSLACLKRVHVPDKPSLNTLRAEVDAMKMLKGHRHVVS 86
           +L  GGFA+ +     S G I  +   + ++ +  + +   L +E+   K +K + ++V 
Sbjct: 88  FLGEGGFARCFQFNDDS-GKIFAA-KTVAKLSIKSEKTRRKLLSEIQIHKSMK-NVNIVQ 144

Query: 87  YIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMA 146
           +ID         D T  VY+L+E C  G L+D +  R    L+E EV    + +   I  
Sbjct: 145 FIDCF------EDDT-NVYILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQICGAIKY 195

Query: 147 MHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKNAYEF----NYVQHDIL- 201
           MH+    +IHRD+K+ N+    D + K+ DFG  + +    +  Y      NY+  ++L 
Sbjct: 196 MHS--RRVIHRDLKLGNIFFDKDYNLKIGDFGLAAVLANDRERKYTVCGTPNYIAPEVLM 253

Query: 202 -KNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYFTTPFEKVGENAILQ----A 256
            K+T   Y                  DIW++GV LY +     PF+    N I +     
Sbjct: 254 GKHTGHSYEV----------------DIWSIGVMLYALLIGKPPFQSKDVNTIYERIKCC 297

Query: 257 KFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEV 295
            F FP     +   K LI  +LS  P++RP++ ++++ V
Sbjct: 298 DFTFPKDKYISPEAKILIQDLLSLDPLERPSVDEIIDYV 336

>NCAS0G01210 Chr7 complement(215860..216963) [1104 bp, 367 aa] {ON}
           Anc_6.262 YPL236C
          Length = 367

 Score = 84.0 bits (206), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 81/352 (23%), Positives = 151/352 (42%), Gaps = 61/352 (17%)

Query: 8   CLQPGI--ILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGP--IQGSLACLKRVHVP--D 61
           CL  G   I+++ + + KI + L     +  Y    L   P    G L  LKR++ P  D
Sbjct: 14  CLSSGTNSIISINARDYKIEKLLQDENLSYSYLVRTLDSEPPFENGPLFVLKRIYCPFGD 73

Query: 62  KPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMN 121
             S++    E+   K   G+ H++S +D    +  ++DG+ ++ +L  +   G + D +N
Sbjct: 74  IESVSAAMNEISYYKKFAGNSHIISCLDYQLHQ--KYDGSKQIDVLFPFYHYGSVQDDIN 131

Query: 122 -------SRLQTRLSEFEVLKIMSHVAQGIMAMH-------------ALV-----PPLIH 156
                  + L T + E + +KIM  + +G++ +H             A++      PL+ 
Sbjct: 132 RHLLSSSTALGTVIPEKDCIKIMIGLCRGLLPLHDPKLREQGSPDDMAIMSYSENAPLLL 191

Query: 157 RDIKIEN--------------------VLISGDGDFKVCDFGSVSGVIRPPKNAYEFNYV 196
            D+ +E                     +L+S  G+  + D  S            + N  
Sbjct: 192 NDLPMELSKDNENENVCFAYYNLRPDLILLSEQGNAIIADLQSCFRTNITISTEIQLNRF 251

Query: 197 QHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYFTTPFEK-------VG 249
           Q  I ++ T Q+ APE++ L     +  K DIW+LG  LY + +  +PFE+       V 
Sbjct: 252 QQWIEEHCTLQFSAPELLTLKMGDKITAKVDIWSLGCVLYSMMFGISPFEREEQLNGGVV 311

Query: 250 ENAILQAKFQFP-SYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRIQG 300
           +  I   K+  P +   Y+  + ++++  L   P +RP++  +L  +  IQG
Sbjct: 312 KYCIKMGKYSIPDTKGTYSQEIIDILNTCLKVDPSERPSLNGILNNLQEIQG 363

>NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {ON}
            Anc_7.86
          Length = 1382

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 72/287 (25%), Positives = 125/287 (43%), Gaps = 49/287 (17%)

Query: 24   IIQYLTSGGFAQIYSCEVLSPGPIQGSLACLKRVH---------VPDKPSLNTLRAEVDA 74
            I+Q +  G + ++  C       ++  +  +K +          V D+  L T+ +E+  
Sbjct: 1124 ILQKMGEGAYGKVNMC----IHKVKKYIVVIKMIFKERILVDTWVRDR-QLGTIPSEIQI 1178

Query: 75   MKML--KGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRG--GLIDFMN-SRLQTRLS 129
            M  L  K H +++S +D               Y  +E  + G  G ID  +    +T ++
Sbjct: 1179 MATLNKKPHDNILSLLDFFEDDD---------YYYIETPVHGETGCIDLFDLIEFKTNMT 1229

Query: 130  EFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKN 189
            EFE   I   +  GI  +H     ++HRDIK ENV++   G  K+ DFGS + V   P +
Sbjct: 1230 EFEAKLIFKQIVSGIKHLHD--QGIVHRDIKDENVIVDSKGCVKIIDFGSAAYVKSGPFD 1287

Query: 190  AYEFNYVQHDILKNTTAQYRAPEMI--DLYRALPVDEKSDIWALGVFLYKVCYFTTPFEK 247
             +             T  Y APE++  + Y   P     DIWA+G+ LY + +   PF  
Sbjct: 1288 VFV-----------GTIDYAAPEVLSGEPYEGKP----QDIWAIGILLYTIVFKENPFYN 1332

Query: 248  VGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEE 294
            + E  IL+ + +F +    ++    LI  +L     +RP I ++  +
Sbjct: 1333 IDE--ILEGELKFNNSNDISEDCIELIKKILIRSVPKRPLIEEIFND 1377

>KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 878

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 66/235 (28%), Positives = 109/235 (46%), Gaps = 37/235 (15%)

Query: 68  LRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTR 127
           ++ EV  +  LK   ++  Y  S+   +       E++++MEYC  G L   +      +
Sbjct: 62  VQKEVQFLSSLKQVPNITHYYGSYLNNT-------ELWVIMEYCAGGSLRTLLRP---GK 111

Query: 128 LSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPP 187
           + E  +  IM  +   +M +H     +IHRDIK  NVLI+ DG  K+CDFG  + +    
Sbjct: 112 IGEQYIGVIMRELLIALMHIHK--DGVIHRDIKAANVLITNDGHIKLCDFGVAAQL---- 165

Query: 188 KNAYEFNYVQHDILKNTTA---QYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYFTTP 244
                    Q  I + T A    + APE+I     +  D K DIW+LG+  Y++     P
Sbjct: 166 --------SQTKIRRQTMAGTPYWMAPEVI--MEGVYYDTKVDIWSLGITAYEIATGNPP 215

Query: 245 FEKVGENAILQAKFQFPSYP------QYTDRLKNLISVMLSEHPVQRPNICQVLE 293
           +  V   A+   +    S P      Q++  LK  I++ L E P +RP+  ++L+
Sbjct: 216 YCDV--EALRAMQLITKSKPPRLEGRQHSSALKEFIALCLDEDPKERPSAEELLK 268

>Suva_16.382 Chr16 (673009..674205) [1197 bp, 398 aa] {ON} YPR054W
           (REAL)
          Length = 398

 Score = 84.0 bits (206), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 65/217 (29%), Positives = 102/217 (47%), Gaps = 16/217 (7%)

Query: 23  KIIQYLTSGGFAQIYSCEVLSPGPIQGSLACLKRVHVPDKPSLNTLRA--EVDAMKMLKG 80
           +IIQ+L  G +  +  C V   G    +   +K++       +   RA  E+  M   KG
Sbjct: 47  EIIQFLGKGAYGTV--CSVKFKGQTPPAKIAVKKISNIFNKEILLKRAIRELKFMNFFKG 104

Query: 81  HRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHV 140
           H+++V+ ID     S  +DG Y    L++Y     L   ++S +Q  LSEF +   +  +
Sbjct: 105 HKNIVNLIDLEIVSSSPYDGLYCYQELIDY----DLAKVIHSSVQ--LSEFHIKYFLYQI 158

Query: 141 AQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDI 200
             G+  +H+    +IHRD+K  N+L + +G  K+CDFG   G+          N      
Sbjct: 159 LCGLKYIHS--ADVIHRDLKPGNILCTLNGCLKICDFGLARGIHTEFFQCQTTNSAVQPH 216

Query: 201 LKNTTA--QYRAPEMIDLYRALPVDEKSDIWALGVFL 235
           + N  A   YRAPE+  L    P D+  DIWA+G  L
Sbjct: 217 ITNYVATRWYRAPEL--LLSNQPYDKAIDIWAVGCIL 251

>TBLA0E02290 Chr5 complement(563483..567385) [3903 bp, 1300 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1300

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 69/237 (29%), Positives = 107/237 (45%), Gaps = 35/237 (14%)

Query: 65   LNTLRAEVDAMKML--KGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRG--GLIDFM 120
            L T+ +E+  M  L  K H +++  ID             + Y  +E  + G  G ID  
Sbjct: 1086 LGTIPSEIQIMYTLNRKPHDNILRMIDFFED---------DQYYYLETPVHGESGCIDLF 1136

Query: 121  N-SRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGS 179
            +    +T ++E E   I   VA G+  +H+L   ++HRDIK ENV+I   G  K+ DFGS
Sbjct: 1137 DLIEFRTDMTEDEAKLIFKQVASGLQHLHSL--GIVHRDIKDENVIIDSKGYVKIIDFGS 1194

Query: 180  VSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMI--DLYRALPVDEKSDIWALGVFLYK 237
             + V   P + +             T  Y APE++  + Y   P     DIWALG+ LY 
Sbjct: 1195 AAYVKNGPFDVFV-----------GTIDYAAPEVLAGNPYEGKP----QDIWALGILLYT 1239

Query: 238  VCYFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEE 294
            + +   PF  + E  I++    F +          LI  ML +   +RP+I +V  +
Sbjct: 1240 IIFKENPFYNIDE--IIEGNVNFDNEASVNPVCVQLIKKMLIKTVPKRPDINEVFSD 1294

>Skud_1.44 Chr1 (95573..99643) [4071 bp, 1356 aa] {ON} YAL017W (REAL)
          Length = 1356

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 66/234 (28%), Positives = 104/234 (44%), Gaps = 35/234 (14%)

Query: 65   LNTLRAEVDAMKML--KGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRG--GLIDFM 120
            L T+ +E+  M  L  K H +++  +D               Y  +E  + G  G ID  
Sbjct: 1143 LGTIPSEIQIMATLNKKPHENILRLLDFFEDDD---------YYYIETPVHGETGCIDLF 1193

Query: 121  N-SRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGS 179
            +    +T ++EFE   I   V  GI  +H     ++HRDIK ENV++   G  K+ DFGS
Sbjct: 1194 DLIEFKTNMTEFEAKLIFKQVVAGIKHLHD--QGIVHRDIKDENVIVDSKGFVKIIDFGS 1251

Query: 180  VSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMI--DLYRALPVDEKSDIWALGVFLYK 237
             + V   P + +             T  Y APE++  + Y   P     DIWA+G+ LY 
Sbjct: 1252 AAYVKSGPFDVFV-----------GTIDYAAPEVLGGNPYEGQP----QDIWAIGILLYT 1296

Query: 238  VCYFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQV 291
            V +   PF  + E  IL+   +F +  + ++    LI  +L+     RP I  +
Sbjct: 1297 VVFKENPFYNIDE--ILEGDLKFNNAEEVSEDCIELIKSILNRRVPNRPTIDDI 1348

>Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON}
           similar to Ashbya gossypii ACL006W
          Length = 740

 Score = 85.1 bits (209), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 71/279 (25%), Positives = 127/279 (45%), Gaps = 40/279 (14%)

Query: 27  YLTSGGFAQIYSCEVLSPGPIQGSLACLKRVHVPDKPSLNTLRAEVDAMKMLKGHRHVVS 86
           +L  GGFA+ +  +  S G I  +   + ++ +  + +   L +E+   K ++ H ++V 
Sbjct: 78  FLGEGGFARCFQMKDDS-GKIFAA-KTVAKISIKSEKTRKKLLSEIQIHKSMR-HPNIVQ 134

Query: 87  YIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMA 146
           + D         D T  VY+L+E C  G L+D +  R Q  L+E EV    + +   I  
Sbjct: 135 FTDCF------EDDT-NVYILLEICPNGSLMDLLKQRKQ--LTEPEVRFFTTQIVGAIKY 185

Query: 147 MHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKNAYEF----NYVQHDIL- 201
           MH+    +IHRD+K+ N+      + K+ DFG  + +    +  Y      NY+  ++L 
Sbjct: 186 MHS--RRIIHRDLKLGNIFFDKHFNLKIGDFGLAAVLANDRERKYTICGTPNYIAPEVLT 243

Query: 202 -KNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYFTTPFEKVGENAILQ----A 256
            K+T   +                  D+W++GV +Y +     PF+    N I +     
Sbjct: 244 GKHTGHSFEV----------------DVWSIGVMIYALLIGKPPFQAKEVNTIYERIKVC 287

Query: 257 KFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEV 295
            F FP     +   K LI  +LS  P++RP++ +++E V
Sbjct: 288 DFNFPRDKPISSEAKVLIKDILSLDPLERPSLTEIMEYV 326

>KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24
           YDR523C
          Length = 543

 Score = 84.7 bits (208), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 61/202 (30%), Positives = 104/202 (51%), Gaps = 16/202 (7%)

Query: 102 YEVYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKI 161
           Y ++++MEYC  G   D + +  +  L+E +V  ++  V  G+  +HA     IHRDIK 
Sbjct: 85  YLMWIVMEYCGGGSARDLIKTCYREGLAENKVAFVVKSVLLGLQYLHA--QHKIHRDIKA 142

Query: 162 ENVLISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALP 221
            N+L++  G  KV DFG VS  +R    A  F           T  + APE++ +   + 
Sbjct: 143 ANILLTDSGLVKVADFG-VSAEMRSTMKAKTF---------VGTPYWMAPEVV-MNEGMG 191

Query: 222 VDEKSDIWALGVFLYKVCYFTTPFEKVGENAILQA--KFQFPS-YPQYTDRLKNLISVML 278
            +EKSDIW+LG+  Y++     P  K     +++   K + P  +  YT+ +K+ I+  L
Sbjct: 192 YNEKSDIWSLGITTYELLKGVPPLAKYDAIRVMRNIPKRKPPKLHGAYTNLVKHFIATCL 251

Query: 279 SEHPVQRPNICQVLEEVSRIQG 300
            + P +RP+  ++LE    ++G
Sbjct: 252 IKDPEKRPSASELLEHDFMVKG 273

>Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {ON}
           YPL150W - Hypothetical ORF [contig 67] FULL
          Length = 848

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 58/201 (28%), Positives = 101/201 (50%), Gaps = 35/201 (17%)

Query: 104 VYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIEN 163
           V++ +EYC    L +++ ++    L E    ++ S +   +   H++    +HRD+K+EN
Sbjct: 103 VWMALEYCPGKELYEYLLAKKHIPLEE--CSELFSQIVGAVYYAHSM--KCVHRDLKLEN 158

Query: 164 VLISGDGDFKVCDFG-----SVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYR 218
           +L+   G  K+ DFG     +  G++              + +  TT  Y APE+I+  R
Sbjct: 159 ILLDKKGHAKLTDFGFTRECATKGIL--------------ETICGTTV-YMAPELIE--R 201

Query: 219 ALPVDEKSDIWALGVFLYKVCYFTTPFEKVGENAILQAKFQFPSY-PQYTDRL-----KN 272
                 K D W+LG+ LY + + T PF++V E   ++ K++   Y P Y +       K 
Sbjct: 202 KPYEGYKIDTWSLGIILYTMIHGTMPFDEVDE---VKTKYKIVHYNPTYDNDYIDSNGKE 258

Query: 273 LISVMLSEHPVQRPNICQVLE 293
           LIS +L + P QRP++ QVL+
Sbjct: 259 LISQLLEKDPNQRPSLTQVLQ 279

>Smik_16.296 Chr16 (542962..544128) [1167 bp, 388 aa] {ON} YPR054W
           (REAL)
          Length = 388

 Score = 83.2 bits (204), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 68/225 (30%), Positives = 107/225 (47%), Gaps = 35/225 (15%)

Query: 23  KIIQYLTSGGFAQIYSCEVLSPGPIQGSLACLKRVHVPDKPSL--NTLRAEVDAMKMLKG 80
           +IIQ+L  G +  + S +     P    +A  K  ++ +K  L    +R E+  M   KG
Sbjct: 39  EIIQFLGKGAYGTVCSVKFKGQNP-PAKIAVKKISNIFNKEILLKRAIR-ELKFMNFFKG 96

Query: 81  HRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHV 140
           H+++V+ ID     S  +DG Y    L++Y     L   ++S +Q  LSEF +   +  +
Sbjct: 97  HKNIVNLIDLEIVTSSPYDGLYCYQELIDY----DLAKVIHSSVQ--LSEFHIKYFLYQI 150

Query: 141 AQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGV----------IRPPKNA 190
             G+  +H+    +IHRD+K  N+L + +G  K+CDFG   G+          I+P    
Sbjct: 151 LCGLKYIHS--ADVIHRDLKPGNILCTLNGCLKICDFGLARGIHAGFFQCHSTIQPHIT- 207

Query: 191 YEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFL 235
              NYV        T  YRAPE+  L    P ++  DIWA+G  L
Sbjct: 208 ---NYV-------ATRWYRAPEL--LLSNQPYNKSVDIWAVGCIL 240

>YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One of two
            (see also PSK2) PAS domain containing S/T protein
            kinases; coordinately regulates protein synthesis and
            carbohydrate metabolism and storage in response to a
            unknown metabolite that reflects nutritional status
          Length = 1356

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 66/234 (28%), Positives = 105/234 (44%), Gaps = 35/234 (14%)

Query: 65   LNTLRAEVDAMKML--KGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRG--GLIDFM 120
            L T+ +E+  M  L  K H +++  +D               Y  +E  + G  G ID  
Sbjct: 1143 LGTIPSEIQIMATLNKKPHENILRLLDFFEDDD---------YYYIETPVHGETGCIDLF 1193

Query: 121  N-SRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGS 179
            +    +T ++EFE   I   V  GI  +H     ++HRDIK ENV++   G  K+ DFGS
Sbjct: 1194 DLIEFKTNMTEFEAKLIFKQVVAGIKHLHD--QGIVHRDIKDENVIVDSKGFVKIIDFGS 1251

Query: 180  VSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMI--DLYRALPVDEKSDIWALGVFLYK 237
             + V   P + +             T  Y APE++  + Y   P     DIWA+G+ LY 
Sbjct: 1252 AAYVKSGPFDVFV-----------GTIDYAAPEVLGGNPYEGQP----QDIWAIGILLYT 1296

Query: 238  VCYFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQV 291
            V +   PF  + E  IL+   +F +  + ++    LI  +L+    +RP I  +
Sbjct: 1297 VVFKENPFYNIDE--ILEGDLKFNNAEEVSEDCIELIKSILNRCVPKRPTIDDI 1348

>KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {ON}
           Anc_6.31 YMR001C
          Length = 713

 Score = 84.7 bits (208), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 71/274 (25%), Positives = 126/274 (45%), Gaps = 28/274 (10%)

Query: 26  QYLTSGGFAQIYSCEVLSPGPIQGSLACLKRVHVPDKPSLNTLRAEVDAMKMLKGHRHVV 85
            +L  GGFA+ +     S G I  +   + ++ +  + +   L +E+   K +K H ++V
Sbjct: 99  HFLGEGGFARCFQIRDDS-GKIFAA-KTVAKISIKSEKTRKKLLSEIQIHKSMK-HVNIV 155

Query: 86  SYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIM 145
            +ID         D T  VY+L+E C  G L+D +  R    L+E EV    + +   I 
Sbjct: 156 QFIDCF------EDDT-NVYILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQICGAIK 206

Query: 146 AMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTT 205
            MH+    +IHRD+K+ N+      + K+ DFG  + +    +  Y             T
Sbjct: 207 YMHS--RKVIHRDLKLGNIFFDRKYNLKIGDFGLAATLANDRERKYTV---------CGT 255

Query: 206 AQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYFTTPFEKVGENAILQ----AKFQFP 261
             Y APE++ + +      + DIW++GV +Y +     PF+    N I +      F FP
Sbjct: 256 PNYIAPEVL-MGKHSGHSYEVDIWSIGVMIYALIIGRPPFQSKDVNTIYERIKCRDFSFP 314

Query: 262 SYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEV 295
                +   K LI  +LS  P++RP++ ++++ +
Sbjct: 315 KDKLISSEAKILIQDILSLDPLERPSVNEIMDYI 348

>CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150w
          Length = 893

 Score = 84.7 bits (208), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 59/198 (29%), Positives = 98/198 (49%), Gaps = 29/198 (14%)

Query: 103 EVYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIE 162
           +V++ +EYC    L D + S+  +RL   E  ++ + +   +   H L    +HRD+K+E
Sbjct: 107 KVWMALEYCPGKELYDHLLSK--SRLPTLECAELFAQITGAVHYAHTL--NCVHRDLKLE 162

Query: 163 NVLISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNT--TAQYRAPEMIDLYRAL 220
           NVL+  +G+ K+ DFG            +    +   +L+    T  Y APEMI   +  
Sbjct: 163 NVLLDKNGNAKLTDFG------------FTRESMTKAVLETVCGTTVYMAPEMI---QHK 207

Query: 221 PVDE-KSDIWALGVFLYKVCYFTTPFEKVGENAILQAKFQFPSYPQYTDRL-----KNLI 274
           P D  K DIW+LGV LY +     PF++  ++ +L  +      P   +R+     +NLI
Sbjct: 208 PYDGFKVDIWSLGVILYTLLCGCLPFDE--DDDLLTKQKIINDTPVIDERITIPEAQNLI 265

Query: 275 SVMLSEHPVQRPNICQVL 292
             +LS+ P +RPN   +L
Sbjct: 266 EQLLSKDPTERPNTSAIL 283

>KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} similar
           to uniprot|P32562 Saccharomyces cerevisiae YMR001C
          Length = 708

 Score = 84.3 bits (207), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 73/291 (25%), Positives = 129/291 (44%), Gaps = 40/291 (13%)

Query: 26  QYLTSGGFAQIYSCEVLSPGPIQGSLACLKRVHVPDKPSLNTLRAEVDAMKMLKGHRHVV 85
            +L  GGFA+ +  +    G +  +   + ++ +  + +   L +E+   K +K H ++V
Sbjct: 94  HFLGEGGFARCFQMKD-DKGKVFAA-KTVAKLSIKSEKTRRKLLSEIQIHKSMK-HPNIV 150

Query: 86  SYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIM 145
            + D         D T  VY+L+E C  G +++ +  R    L+E EV   M  +   I 
Sbjct: 151 QFTDCF------EDDT-NVYILLEICPNGSVMELLRQR--KHLTEPEVRFCMIQIIGAIR 201

Query: 146 AMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKNAYEF----NYVQHDIL 201
            MH+    +IHRD+K+ N+    + + K+ DFG  + +    +  Y      NY+  ++L
Sbjct: 202 YMHS--RRVIHRDLKLGNIFFDKEYNLKIGDFGLAAVLANDKERKYTICGTPNYIAPEVL 259

Query: 202 --KNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYFTTPFEKVGENAILQA--- 256
             K+T   Y                  DIW++GV LY + +   PF+      I +    
Sbjct: 260 TGKHTGHSYEV----------------DIWSIGVMLYALLFGKPPFQAKEVETIYERIKC 303

Query: 257 -KFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRIQGVPCPLP 306
             F FP+    +   KNLIS +L  +P  RP++ ++ + V      P  LP
Sbjct: 304 RDFIFPADKPVSSDAKNLISHLLQLNPAARPSLYEITDNVWFRNTFPSRLP 354

>Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W
           (REAL)
          Length = 1065

 Score = 84.7 bits (208), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 61/214 (28%), Positives = 105/214 (49%), Gaps = 24/214 (11%)

Query: 105 YLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENV 164
           Y+L EY   G L+D++      R  E +  K    +A  +M +HA    ++HRD+KIEN+
Sbjct: 218 YMLFEYVSGGQLLDYIIQHGSIR--EHQAKKFARGIASALMYLHA--NNIVHRDLKIENI 273

Query: 165 LISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALP-VD 223
           +IS   + K+ DFG +S +    K  Y F           +  + APE++   +A P   
Sbjct: 274 MISDSSEIKIIDFG-LSNLYDSRKQLYTF---------CGSLYFAAPELL---KANPYTG 320

Query: 224 EKSDIWALGVFLYKVCYFTTPFEK----VGENAILQAKFQFPSYPQYTDRLKNLISVMLS 279
            + D+W+ GV L+ +     PF+     V    I Q K ++P +   +  + +L+S ML 
Sbjct: 321 PEVDVWSFGVVLFVLVCGKVPFDDENSSVLHEKIKQGKVEYPQH--LSIEVISLLSKMLV 378

Query: 280 EHPVQRPNICQVLEEVSRIQGVPCPLPNFYLERM 313
             P +R  + QV+E    ++G   P P++  +R+
Sbjct: 379 VDPKRRATLKQVVEHHWMVRGFSGPPPSYLPKRI 412

>CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON}
           similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096w KIN2 ser/thr protein kinase
          Length = 1192

 Score = 84.7 bits (208), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 62/214 (28%), Positives = 103/214 (48%), Gaps = 24/214 (11%)

Query: 105 YLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENV 164
           Y+L EY   G L+D++       L E    K    VA  +  +HA    ++HRD+KIEN+
Sbjct: 208 YMLFEYVAGGQLLDYIIQ--HGSLREHHARKFARGVASALQYLHA--NNIVHRDLKIENI 263

Query: 165 LISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALP-VD 223
           +IS  G+ K+ DFG +S V    K  + F           +  + APE++   +A P   
Sbjct: 264 MISNSGEIKIIDFG-LSNVYDTRKQLHTF---------CGSLYFAAPELL---KAHPYTG 310

Query: 224 EKSDIWALGVFLYKVCYFTTPFEK----VGENAILQAKFQFPSYPQYTDRLKNLISVMLS 279
            + D+W+ GV LY +     PF+     V    I + K ++P +   +  + +L+S ML 
Sbjct: 311 PEVDVWSFGVVLYVLVCGKVPFDDENSSVLHEKIKRGKVEYPQH--LSIEVMSLLSKMLV 368

Query: 280 EHPVQRPNICQVLEEVSRIQGVPCPLPNFYLERM 313
             P +R ++ QV+E     +G   P P++   R+
Sbjct: 369 VDPSRRASLKQVVEHPWMTKGYDTPAPSYVPNRI 402

>ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 774

 Score = 84.3 bits (207), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 72/277 (25%), Positives = 130/277 (46%), Gaps = 34/277 (12%)

Query: 26  QYLTSGGFAQIYSCEVLSPGPIQGSLACLK---RVHVPDKPSLNTLRAEVDAMKMLKGHR 82
            +L  GGFA+ +     S     G L   K   ++ +  + +   L +E+   K +K H+
Sbjct: 149 HFLGEGGFARCFQIRDDS-----GKLFAAKTVAKLSIKTEKTRKKLLSEIQIHKSMK-HQ 202

Query: 83  HVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQ 142
           ++V +ID         D T  VY+L+E C  G L++ +  R Q  L+E EV    + +  
Sbjct: 203 NIVQFIDCF------EDDT-NVYILLEICPNGSLMELLKKRKQ--LTEPEVRFFTTQICG 253

Query: 143 GIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILK 202
            I  MH+    +IHRD+K+ N+    + + K+ DFG ++ V+   +        +     
Sbjct: 254 AIKYMHS--RRVIHRDLKLGNIFFDRNYNLKIGDFG-LAAVLANDR--------ERKFTV 302

Query: 203 NTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYFTTPFEKVGENAILQ----AKF 258
             T  Y APE++ + +      + D+W++GV +Y +     PF+    N I +      F
Sbjct: 303 CGTPNYIAPEVL-MGKHSGHSYEVDVWSIGVMVYALLVGKPPFQAKDVNTIYERIKCCDF 361

Query: 259 QFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEV 295
            FP     +   K L+  +LS  P++RP+I ++++ V
Sbjct: 362 IFPKEKPISHEAKVLVQDLLSLDPLERPSISEIMDYV 398

>YPR054W Chr16 (666280..667446) [1167 bp, 388 aa] {ON}  SMK1Middle
           sporulation-specific mitogen-activated protein kinase
           (MAPK) required for production of the outer spore wall
           layers; negatively regulates activity of the glucan
           synthase subunit Gsc2p
          Length = 388

 Score = 82.4 bits (202), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 66/225 (29%), Positives = 104/225 (46%), Gaps = 35/225 (15%)

Query: 23  KIIQYLTSGGFAQIYSCEVLSPGPIQGSLACLKRVHVPDKPSLNTLRA--EVDAMKMLKG 80
           +IIQ+L  G +  +  C V   G    +   +K++       +   RA  E+  M   KG
Sbjct: 39  EIIQFLGKGAYGTV--CSVKFKGRSPAARIAVKKISNIFNKEILLKRAIRELKFMNFFKG 96

Query: 81  HRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHV 140
           H+++V+ ID     S  +DG Y    L++Y     L   ++S +Q  LSEF +   +  +
Sbjct: 97  HKNIVNLIDLEIVTSSPYDGLYCYQELIDY----DLAKVIHSSVQ--LSEFHIKYFLYQI 150

Query: 141 AQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGV----------IRPPKNA 190
             G+  +H+    +IHRD+K  N+L + +G  K+CDFG   G+          ++P    
Sbjct: 151 LCGLKYIHS--ADVIHRDLKPGNILCTLNGCLKICDFGLARGIHAGFFKCHSTVQPHIT- 207

Query: 191 YEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFL 235
              NYV        T  YRAPE+  L    P  +  DIWA+G  L
Sbjct: 208 ---NYV-------ATRWYRAPEL--LLSNQPYSKSVDIWAVGCIL 240

>Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {ON}
           YHR102W (KIC1) - PAK/Ste20 kinase family [contig 128]
           FULL
          Length = 865

 Score = 84.0 bits (206), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 59/200 (29%), Positives = 97/200 (48%), Gaps = 30/200 (15%)

Query: 103 EVYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIE 162
           +++++MEYC  G L   +      ++ E  +  IM  +   +M +H     +IHRDIK  
Sbjct: 90  KLWVIMEYCAGGSLRTLLRP---GKIGEQYIGVIMRELLTALMHIHK--DGVIHRDIKAA 144

Query: 163 NVLISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTA---QYRAPEMIDLYRA 219
           NVLI+ DG  K+CDFG  + +             Q  I + T A    + APE+I     
Sbjct: 145 NVLITNDGHIKLCDFGVAAQL------------SQTKIRRQTMAGTPYWMAPEVI--MEG 190

Query: 220 LPVDEKSDIWALGVFLYKVCYFTTPFEKVGENAILQAKFQFPSYP------QYTDRLKNL 273
           +  D K DIW+LG+  Y++     P+ +V   A+   +    S P      Q++  LK +
Sbjct: 191 VYYDTKVDIWSLGITAYEIATGNPPYCEV--EALRAMQLITKSKPPRLEGRQHSSALKEI 248

Query: 274 ISVMLSEHPVQRPNICQVLE 293
           I++ L E P +RP+   +L+
Sbjct: 249 IALCLDEDPKERPSAEDLLK 268

>TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8.279
           YLR096W
          Length = 1126

 Score = 84.3 bits (207), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 61/214 (28%), Positives = 104/214 (48%), Gaps = 24/214 (11%)

Query: 105 YLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENV 164
           Y+L EY   G L+D++       L E    K    +A  +  +HA    ++HRD+KIEN+
Sbjct: 178 YMLFEYVSGGQLLDYIIQ--HGSLREHHARKFTRGIASALQYLHA--NNIVHRDLKIENI 233

Query: 165 LISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALP-VD 223
           +IS  G+ K+ DFG +S +    K  + F           +  + APE++   +A P   
Sbjct: 234 MISTSGEIKIIDFG-LSNLFDKSKQLHTF---------CGSLYFAAPELL---KASPYTG 280

Query: 224 EKSDIWALGVFLYKVCYFTTPFEK----VGENAILQAKFQFPSYPQYTDRLKNLISVMLS 279
            + D+W+ GV LY +     PF+     V    I Q K ++P +   +  + +L+S ML 
Sbjct: 281 PEVDVWSFGVVLYVLVCGKVPFDDENSSVLHEKIKQGKVEYPQH--LSIEVISLLSKMLV 338

Query: 280 EHPVQRPNICQVLEEVSRIQGVPCPLPNFYLERM 313
             P +R ++ QV+E    ++G   P P++   R+
Sbjct: 339 VDPHRRASLKQVVEHHWMVRGYDGPPPSYVPNRI 372

>NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON} 
          Length = 1210

 Score = 84.0 bits (206), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 62/214 (28%), Positives = 104/214 (48%), Gaps = 24/214 (11%)

Query: 105 YLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENV 164
           Y+L EY   G L+D++       L E    K    +A  +  +HA    ++HRD+KIEN+
Sbjct: 262 YMLFEYVSGGQLLDYIIQ--HGSLREHHARKFARGIASALEYIHANN--IVHRDLKIENI 317

Query: 165 LISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALP-VD 223
           +IS  G+ K+ DFG +S V    K  + F           +  + APE++   +A P   
Sbjct: 318 MISTSGEIKIIDFG-LSNVFDRKKQLHTF---------CGSLYFAAPELL---KAHPYTG 364

Query: 224 EKSDIWALGVFLYKVCYFTTPFEK----VGENAILQAKFQFPSYPQYTDRLKNLISVMLS 279
            + D+W+ GV LY +     PF+     V    I Q K  +P++   +  + +L+S ML 
Sbjct: 365 PEVDVWSFGVVLYVLVCGKVPFDDENSSVLHEKIKQGKVDYPNH--LSIEVISLLSKMLV 422

Query: 280 EHPVQRPNICQVLEEVSRIQGVPCPLPNFYLERM 313
             P++R ++ QV+E     +G   P P++   R+
Sbjct: 423 VDPLRRASLKQVVEHPWMTRGYDYPPPSYVPRRI 456

>KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017W PSK1 One
            of two (see also PSK2) PAS domain containing S/T protein
            kinases coordinately regulates protein synthesis and
            carbohydrate metabolism and storage in response to a
            unknown metabolite that reflects nutritional status
          Length = 1223

 Score = 84.0 bits (206), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 73/283 (25%), Positives = 125/283 (44%), Gaps = 41/283 (14%)

Query: 21   EVKIIQYLTSGGFAQIYSC-----EVLSPGPIQGSLACLKRVHVPDKPSLNTLRAEVDAM 75
            E +++Q +  G + ++  C       +    +      L    V D+  L T+ +E+  M
Sbjct: 962  EFEVLQKMGEGAYGKVDLCLHKKDRYIVVIKLIFKERILVDTWVRDR-KLGTIPSEIQIM 1020

Query: 76   KML--KGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRG--GLIDFMN-SRLQTRLSE 130
              L  K H +++  +D             + Y  +E  + G  G +D  +   L+T ++E
Sbjct: 1021 ATLNTKPHENILMLLDFFED---------DEYYYIETPIHGTSGSVDLFDLIELKTDMTE 1071

Query: 131  FEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKNA 190
             E   I   +  GI  +H     ++HRDIK ENV++  +G  K+ DFGS + V   P + 
Sbjct: 1072 HEAKLIFKQIVSGIKHLHD--NGIVHRDIKDENVIVDSNGFVKIIDFGSAAYVKSGPFDV 1129

Query: 191  YEFNYVQHDILKNTTAQYRAPEMI--DLYRALPVDEKSDIWALGVFLYKVCYFTTPFEKV 248
            +             T  Y APE++  + Y   P     DIWA+GV LY + +   PF  +
Sbjct: 1130 FV-----------GTIDYAAPEVLGGEPYEGKP----QDIWAIGVLLYTIIFKENPFYNI 1174

Query: 249  GENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQV 291
             E  IL A  +  S  + +D    LI  +L+    +RP+I ++
Sbjct: 1175 DE--ILDADLRVDSNHRVSDECIALIRKILNRPISKRPSISKI 1215

>KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1381

 Score = 84.0 bits (206), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 68/292 (23%), Positives = 128/292 (43%), Gaps = 59/292 (20%)

Query: 24   IIQYLTSGGFAQIYSCEVLSPGPIQGSLACLKRVH---------VPDKPSLNTLRAEVDA 74
            I+Q +  G + ++  C       ++  +  +K +          V D+  L T+ +E+  
Sbjct: 1123 ILQKMGEGAYGKVNLC----MHKMKKYIVVIKMIFKERILVDTWVRDR-KLGTIPSEIQI 1177

Query: 75   MKML--KGHRHVVSYID------SHAAKSPRH--DGTYEVYLLMEYCLRGGLIDFMNSRL 124
            M  L  K H +++  +D       +  ++P H   G+ +++ L+E+              
Sbjct: 1178 MATLNKKPHENILRLLDFFEDDEYYYIETPVHGETGSIDLFDLIEFT------------- 1224

Query: 125  QTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVI 184
             + ++EFE+  +   V  G+  +H     ++HRDIK EN+++   G  K+ DFGS + V 
Sbjct: 1225 -SNMTEFEIKLLFKQVVSGVKHLHD--QGIVHRDIKDENIIVDNKGFIKIIDFGSAAYVK 1281

Query: 185  RPPKNAYEFNYVQHDILKNTTAQYRAPEMI--DLYRALPVDEKSDIWALGVFLYKVCYFT 242
              P + +             T  Y APE++  + Y   P     DIWALG+ LY + +  
Sbjct: 1282 SGPFDVFV-----------GTIDYAAPEVLGGNPYEGKP----QDIWALGILLYTIVFKE 1326

Query: 243  TPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEE 294
             PF  + E  IL+   +F      +     LI ++L+ +  +RP I  +  +
Sbjct: 1327 NPFYNIDE--ILEGDLKFNDPENISQDCIELIKLILNRNVFKRPTIDDIYND 1376

>Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150W
           (REAL)
          Length = 918

 Score = 84.0 bits (206), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 59/202 (29%), Positives = 103/202 (50%), Gaps = 37/202 (18%)

Query: 103 EVYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIE 162
           +V++ +EYC    L D + S    R+S  E  ++ + ++  +   H++    +HRD+K+E
Sbjct: 106 KVWMALEYCPGKELYDHLLS--LHRISLLECAELFAQISGAVYYAHSM--HCVHRDLKLE 161

Query: 163 NVLISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNT------TAQYRAPEMIDL 216
           N+L+  +G+ K+ DFG                + +  + K T      T  Y APE+I+ 
Sbjct: 162 NILLDKNGNAKLTDFG----------------FTRECMTKTTLETVCGTTVYMAPELIE- 204

Query: 217 YRALPVDEKSDIWALGVFLYKVCYFTTPFEKVGENAILQAKFQF----PSYPQYT--DRL 270
            R      K DIW+LGV LY +   + PF+   E   ++ K++     P+Y      D  
Sbjct: 205 -RRTYDGFKIDIWSLGVILYTLITGSLPFDDDDE---VKTKWKIVNEEPNYDSTLIPDDA 260

Query: 271 KNLISVMLSEHPVQRPNICQVL 292
           K+LIS +L+++P +RP++ QVL
Sbjct: 261 KDLISRLLAKNPKERPSLPQVL 282

>CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017w FUN31 or
            uniprot|Q08217 Saccharomyces cerevisiae YOL045w
          Length = 1206

 Score = 84.0 bits (206), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 55/183 (30%), Positives = 90/183 (49%), Gaps = 20/183 (10%)

Query: 115  GLIDFMNS-RLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFK 173
            G +D  +    ++ ++EFE   I   +  GI  +H     ++HRDIK ENV++   G  K
Sbjct: 1038 GSVDLFDIIEFKSNMTEFEAKLIFKQIVSGIKHLHD--QGIVHRDIKDENVIVDSKGFVK 1095

Query: 174  VCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKS-DIWALG 232
            + DFGS + V   P + +             T  Y APE++      P + KS DIWA+G
Sbjct: 1096 LIDFGSAAYVKSGPFDVFV-----------GTIDYAAPEVLG---GNPYEGKSQDIWAIG 1141

Query: 233  VFLYKVCYFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVL 292
            + LY + Y   PF  + E  IL+ + +F      +   K LI+ +L+    +RP I ++ 
Sbjct: 1142 ILLYTLIYKENPFYNIDE--ILEGELRFNDSADVSQECKALITKILNRCVRKRPTIDEIC 1199

Query: 293  EEV 295
            ++V
Sbjct: 1200 QDV 1202

>KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1142

 Score = 84.0 bits (206), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 60/214 (28%), Positives = 102/214 (47%), Gaps = 24/214 (11%)

Query: 105 YLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENV 164
           Y+L EY   G L+D++       L E    K    +A  +  +H  +  ++HRD+KIEN+
Sbjct: 284 YMLFEYVSGGQLLDYIIQ--HGSLRERSARKFARGIASALQYLH--LNNIVHRDLKIENI 339

Query: 165 LISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALP-VD 223
           +IS  G+ K+ DFG +S +  P K  + F           +  + APE++   +A P   
Sbjct: 340 MISTSGEIKIIDFG-LSNMFNPKKQLHTF---------CGSLYFAAPELL---KACPYTG 386

Query: 224 EKSDIWALGVFLYKVCYFTTPFEK----VGENAILQAKFQFPSYPQYTDRLKNLISVMLS 279
            + D+W+ GV LY +     PF+     V    I Q K ++P +   +  + +L+S ML 
Sbjct: 387 PEVDVWSFGVVLYVLVCGKVPFDDENSSVLHEKIKQGKVEYPQH--LSIEVISLLSKMLV 444

Query: 280 EHPVQRPNICQVLEEVSRIQGVPCPLPNFYLERM 313
             P +R  + QV+      +G   P P++   R+
Sbjct: 445 VDPSKRATLKQVVNHQWMQRGYDFPAPSYIPHRV 478

>Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {ON}
           YDR122W (KIN1) - Serine/threonine protein kinase [contig
           174] PARTIAL
          Length = 858

 Score = 83.6 bits (205), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 59/214 (27%), Positives = 103/214 (48%), Gaps = 24/214 (11%)

Query: 105 YLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENV 164
           Y+L EY   G L+D++       L E    K    +A  +  +H  +  ++HRD+KIEN+
Sbjct: 9   YMLFEYVSGGQLLDYIIQ--HGSLRERSARKFARGIASALQYLH--MNNIVHRDLKIENI 64

Query: 165 LISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALP-VD 223
           +IS  G+ K+ DFG +S +  P K  + F           +  + APE++   +A P   
Sbjct: 65  MISTSGEIKIIDFG-LSNMYNPKKQLHTF---------CGSLYFAAPELL---KACPYTG 111

Query: 224 EKSDIWALGVFLYKVCYFTTPFEK----VGENAILQAKFQFPSYPQYTDRLKNLISVMLS 279
            + D+W+ GV L+ +     PF+     V    I Q K ++P +   +  + +L+S ML 
Sbjct: 112 PEVDVWSFGVVLFVLVCGKVPFDDENSSVLHEKIKQGKVEYPQH--LSIEVISLLSKMLV 169

Query: 280 EHPVQRPNICQVLEEVSRIQGVPCPLPNFYLERM 313
             P +R ++ QV+      +G   P P++   R+
Sbjct: 170 VDPTKRASLKQVVNHQWMQRGYDFPAPSYIPHRV 203

>Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W
           (REAL)
          Length = 1066

 Score = 83.6 bits (205), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 60/214 (28%), Positives = 105/214 (49%), Gaps = 24/214 (11%)

Query: 105 YLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENV 164
           Y+L EY   G L+D++      R  E +  K    +A  +M +HA    ++HRD+KIEN+
Sbjct: 218 YMLFEYVSGGQLLDYIIQHGSIR--EHQARKFARGIASALMYLHA--NNIVHRDLKIENI 273

Query: 165 LISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALP-VD 223
           +IS   + K+ DFG +S +    K  + F           +  + APE++   +A P   
Sbjct: 274 MISDSSEIKIIDFG-LSNLYDSRKQLHTF---------CGSLYFAAPELL---KAHPYTG 320

Query: 224 EKSDIWALGVFLYKVCYFTTPFEK----VGENAILQAKFQFPSYPQYTDRLKNLISVMLS 279
            + D+W+ GV L+ +     PF+     V    I Q K ++P +   +  + +L+S ML 
Sbjct: 321 PEVDVWSFGVVLFVLVCGKVPFDDENSSVLHEKIKQGKVEYPQH--LSIEVISLLSKMLV 378

Query: 280 EHPVQRPNICQVLEEVSRIQGVPCPLPNFYLERM 313
             P +R  + QV+E    ++G   P P++  +R+
Sbjct: 379 VDPKRRATLKQVVEHHWMVRGFNAPPPSYLPKRV 412

>SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1062

 Score = 83.6 bits (205), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 62/216 (28%), Positives = 105/216 (48%), Gaps = 28/216 (12%)

Query: 105 YLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENV 164
           Y+L EY   G L+D++       L E    K    +A  +  +H  +  ++HRD+KIEN+
Sbjct: 179 YMLFEYVSGGQLLDYIIQ--HGSLRERHARKFARGIASALQYLH--MNNIVHRDLKIENI 234

Query: 165 LISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALP-VD 223
           +IS  G+ K+ DFG +S +  P K  + F           +  + APE++   +A P + 
Sbjct: 235 MISTSGEIKIIDFG-LSNMYDPKKQLHTF---------CGSLYFAAPELL---KAHPYIG 281

Query: 224 EKSDIWALGVFLYKVCYFTTPFEKVGENA------ILQAKFQFPSYPQYTDRLKNLISVM 277
            + D+W+ GV LY +     PF+   ENA      I Q K ++P +   +  + +L+S M
Sbjct: 282 PEVDVWSFGVVLYVLVCGKVPFD--DENASVLHEKIKQGKVEYPQH--LSIEVISLLSKM 337

Query: 278 LSEHPVQRPNICQVLEEVSRIQGVPCPLPNFYLERM 313
           L   P +R  + QV+      +G   P P++   R+
Sbjct: 338 LVVDPSKRATLKQVVSHQWMQRGYDFPAPSYLPYRV 373

>Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON}
           similar to Ashbya gossypii AGR058W
          Length = 1145

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 61/211 (28%), Positives = 103/211 (48%), Gaps = 28/211 (13%)

Query: 105 YLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENV 164
           Y+L EY   G L+D++       L E    K    +A  +  +H  +  ++HRD+KIEN+
Sbjct: 217 YMLFEYVSGGQLLDYIIQ--HGSLRERHARKFARGIASALQYLH--MNNIVHRDLKIENI 272

Query: 165 LISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALP-VD 223
           +IS  G+ ++ DFG +S +  P K  + F           +  + APE++   +A P   
Sbjct: 273 MISSSGEIRIIDFG-LSNLYDPKKQLHTF---------CGSLYFAAPELL---KAHPYTG 319

Query: 224 EKSDIWALGVFLYKVCYFTTPFEKVGENA------ILQAKFQFPSYPQYTDRLKNLISVM 277
            + DIW+ GV LY +     PF+   ENA      I Q K ++P +   +  + +L+S M
Sbjct: 320 PEVDIWSFGVVLYVLVCGKVPFDD--ENASVLHEKIKQGKVEYPQH--LSIDVISLLSKM 375

Query: 278 LSEHPVQRPNICQVLEEVSRIQGVPCPLPNF 308
           L   P++R  + QV+      +G   P P++
Sbjct: 376 LVVDPLKRATLKQVVNHQWMQKGYDFPPPSY 406

>CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa] {ON}
            similar to uniprot|Q01389 Saccharomyces cerevisiae
            YJL095w BCK1
          Length = 1447

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 75/288 (26%), Positives = 125/288 (43%), Gaps = 50/288 (17%)

Query: 26   QYLTSGGFAQIYSCEVLSPGPIQGSLACLKRVHVPD--------KPSLNTLRAEVDAMKM 77
            + +  G F  +Y    LS     G +  +K+V VP         K  +  L++EV  +K 
Sbjct: 1155 EMIGKGSFGAVY----LSLNITTGEMMAVKQVEVPKYGTQNELVKDMVEALKSEVATLKD 1210

Query: 78   LKGHRHVVSYIDSHAAKSPRHDGTYEVY-LLMEYCLRGGLIDFMNSRLQTRLSEFEVLKI 136
            L  H ++V Y+ S    +        +Y L +EY   G +   +  RL  R  E  +  +
Sbjct: 1211 L-DHLNIVQYLGSEIRGN--------IYSLFLEYVAGGSVGSLI--RLYGRFDEKLIRHL 1259

Query: 137  MSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKNAYEFNYV 196
             + V  G+  +H+    ++HRD+K +N+L+  DG  K+ DF    G+ +  KN Y     
Sbjct: 1260 NTQVLSGLKYLHS--KGILHRDMKADNLLLDEDGICKISDF----GISKKSKNIYS---- 1309

Query: 197  QHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYFTTPFEKVGENAILQA 256
              D+    T  + APEM+D  +      K DIW+LG  + ++     P+  +    ++ A
Sbjct: 1310 NSDMTMRGTVFWMAPEMVDTKQGYSA--KVDIWSLGCVVLEMFAGKRPWSNL---EVVAA 1364

Query: 257  KFQF------PSYPQYTDRL-----KNLISVMLSEHPVQRPNICQVLE 293
             FQ       P  P  T +L     K+ +S      P +RP    +LE
Sbjct: 1365 MFQIGKSKSAPPIPDDTIQLISSKGKDFLSKCFEIDPEKRPTADDLLE 1412

>TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}
           Anc_6.31 YMR001C
          Length = 787

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 70/292 (23%), Positives = 132/292 (45%), Gaps = 28/292 (9%)

Query: 8   CLQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGPIQGSLACLKRVHVPDKPSLNT 67
           C  P  ++     + +  Q+L  GGFA+ +  +  S G I  +   + ++ +  + +   
Sbjct: 128 CKTPPSLIKTRGRDYRRGQFLGEGGFARCFQIKDES-GKIFAA-KTVAKISIKTEKTRRK 185

Query: 68  LRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTR 127
           L +E+   K +K H+++V ++D         +    VY+L+  C  G L++ +  R    
Sbjct: 186 LLSEIQIHKSMK-HQNIVQFVDCF-------EDHINVYILLGMCPNGSLMELLKKR--KI 235

Query: 128 LSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPP 187
           L+E EV      +   I  MH+    +IHRD+K+ N+    + + K+ DFG  + +    
Sbjct: 236 LTEPEVRFFTVQICGAIKYMHS--RRVIHRDLKLGNIFFDENYNLKIGDFGLAAVLANDR 293

Query: 188 KNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYFTTPFEK 247
           +  Y             T  Y APE++ L +      + DIW++GV ++ +     PF+ 
Sbjct: 294 ERKYTVC---------GTPNYIAPEVL-LGKHSGHSYEVDIWSIGVMIFALLIGKPPFQA 343

Query: 248 VGENAIL----QAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEV 295
              N I      +++ FP     +   K LI  +L   P+ RP+I +++E V
Sbjct: 344 KDVNTIYSRIKNSEYTFPINKSISQEAKTLIQDILINDPIARPSINEIMEYV 395

>Smik_1.50 Chr1 (103132..107205) [4074 bp, 1357 aa] {ON} YAL017W
            (REAL)
          Length = 1357

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 66/234 (28%), Positives = 104/234 (44%), Gaps = 35/234 (14%)

Query: 65   LNTLRAEVDAMKML--KGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRG--GLIDFM 120
            L T+ +E+  M  L  K H +++  +D               Y  +E  + G  G ID  
Sbjct: 1144 LGTIPSEIQIMATLNKKPHENILRLLDFFEDDD---------YYYIETPVHGETGCIDLF 1194

Query: 121  N-SRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGS 179
            +    +T ++EFE   I   V  GI  +H     ++HRDIK ENV++   G  K+ DFGS
Sbjct: 1195 DLIEFKTNMTEFEAKLIFKQVVAGIKHLHD--QGIVHRDIKDENVIVDSKGFVKIIDFGS 1252

Query: 180  VSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMI--DLYRALPVDEKSDIWALGVFLYK 237
             + V   P + +             T  Y APE++  + Y   P     DIWA+G+ LY 
Sbjct: 1253 AAYVKSGPFDVFV-----------GTIDYAAPEVLGGNPYEGQP----QDIWAIGILLYT 1297

Query: 238  VCYFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQV 291
            V +   PF  + E  IL+   +F +    ++    LI  +L+    +RP I  +
Sbjct: 1298 VVFKENPFYNIDE--ILEGDLKFNNAEGVSEDCIELIKSILNRCVPKRPTIDDI 1349

>Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W
           (REAL)
          Length = 1089

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 60/214 (28%), Positives = 105/214 (49%), Gaps = 24/214 (11%)

Query: 105 YLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENV 164
           Y+L EY   G L+D++      R  E +  K    +A  +M +HA    ++HRD+KIEN+
Sbjct: 231 YMLFEYVSGGQLLDYIIQHGSIR--EHQARKFARGIASALMYLHA--NNIVHRDLKIENI 286

Query: 165 LISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALP-VD 223
           +IS   + K+ DFG +S +    K  + F           +  + APE++   +A P   
Sbjct: 287 MISDSSEIKIIDFG-LSNLYDSRKQLHTF---------CGSLYFAAPELL---KANPYTG 333

Query: 224 EKSDIWALGVFLYKVCYFTTPFEK----VGENAILQAKFQFPSYPQYTDRLKNLISVMLS 279
            + D+W+ GV L+ +     PF+     V    I Q K ++P +   +  + +L+S ML 
Sbjct: 334 PEVDVWSFGVVLFVLVCGKVPFDDENSSVLHEKIKQGKVEYPQH--LSIEVISLLSKMLV 391

Query: 280 EHPVQRPNICQVLEEVSRIQGVPCPLPNFYLERM 313
             P +R  + QV+E    ++G   P P++  +R+
Sbjct: 392 VDPKRRATLKQVVEHHWMVRGFDGPPPSYLPKRI 425

>YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}
            BCK1Mitogen-activated protein (MAP) kinase kinase kinase
            acting in the protein kinase C signaling pathway, which
            controls cell integrity; upon activation by Pkc1p
            phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1478

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 71/287 (24%), Positives = 126/287 (43%), Gaps = 50/287 (17%)

Query: 26   QYLTSGGFAQIYSCEVLSPGPIQGSLACLKRVHVPDKPSLN--------TLRAEVDAMKM 77
            + +  G F  +Y C  ++     G +  +K+V VP   S N         LR+EV  +K 
Sbjct: 1179 EMIGKGSFGAVYLCLNVT----TGEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKD 1234

Query: 78   LKGHRHVVSYIDSHAAKSPRHDGTYEVY-LLMEYCLRGGLIDFMNSRLQTRLSEFEVLKI 136
            L  H ++V Y+          +    +Y L +EY   G +   +  R+  R  E  +  +
Sbjct: 1235 L-DHLNIVQYLG--------FENKNNIYSLFLEYVAGGSVGSLI--RMYGRFDEPLIKHL 1283

Query: 137  MSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKNAYEFNYV 196
             + V +G+  +H+    ++HRD+K +N+L+  DG  K+ DF    G+ R  K+ Y     
Sbjct: 1284 TTQVLKGLAYLHS--KGILHRDMKADNLLLDQDGICKISDF----GISRKSKDIYS---- 1333

Query: 197  QHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYFTTPFEKVGENAILQA 256
              D+    T  + APEM+D  +      K DIW+LG  + ++     P+  +    ++ A
Sbjct: 1334 NSDMTMRGTVFWMAPEMVDTKQGYSA--KVDIWSLGCIVLEMFAGKRPWSNL---EVVAA 1388

Query: 257  KFQF------PSYPQYTDRL-----KNLISVMLSEHPVQRPNICQVL 292
             F+       P  P+ T  L     +N +      +P +RP   ++L
Sbjct: 1389 MFKIGKSKSAPPIPEDTLPLISQIGRNFLDACFEINPEKRPTANELL 1435

>Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL095W
            (REAL)
          Length = 1481

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 70/287 (24%), Positives = 126/287 (43%), Gaps = 50/287 (17%)

Query: 26   QYLTSGGFAQIYSCEVLSPGPIQGSLACLKRVHVPDKPSLN--------TLRAEVDAMKM 77
            + +  G F  +Y C  ++     G +  +K+V VP   S N         LR+EV  +K 
Sbjct: 1182 EMIGKGSFGAVYLCLNVT----TGEMMAVKQVEVPKYSSQNEAILGTVEALRSEVSTLKD 1237

Query: 78   LKGHRHVVSYIDSHAAKSPRHDGTYEVY-LLMEYCLRGGLIDFMNSRLQTRLSEFEVLKI 136
            L  H ++V Y+          +    +Y L +EY   G +   +  R+  R  E  +  +
Sbjct: 1238 L-DHLNIVQYLG--------FENKNNIYSLFLEYVAGGSVGSLI--RMYGRFDESLIRHL 1286

Query: 137  MSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKNAYEFNYV 196
             + V +G+  +H+    ++HRD+K +N+L+  DG  K+ DF    G+ R  K+ Y     
Sbjct: 1287 TTQVLKGLAYLHS--KGILHRDMKADNLLLDQDGICKISDF----GISRKSKDIYS---- 1336

Query: 197  QHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYFTTPFEKVGENAILQA 256
              D+    T  + APEM+D  +      K DIW+LG  + ++     P+  +    ++ A
Sbjct: 1337 NSDMTMRGTVFWMAPEMVDTKQGYSA--KVDIWSLGCIVLEMFAGKRPWSNL---EVVAA 1391

Query: 257  KFQF------PSYPQYTDRL-----KNLISVMLSEHPVQRPNICQVL 292
             F+       P  P+ T  L     ++ +      +P +RP   ++L
Sbjct: 1392 MFKIGKSKSAPPIPEDTLPLISQVGRSFLDACFEINPEERPTATELL 1438

>KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON} 
          Length = 649

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 67/261 (25%), Positives = 117/261 (44%), Gaps = 43/261 (16%)

Query: 55  KRVHVPDKPSLNTLRAEVDAMKML--KGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCL 112
           K+VH P+K +   +  E++  K++    H H+V+  D+             +Y++++YC 
Sbjct: 70  KKVHCPNKENKRKIIKELEIYKVICRSHHNHIVALRDAFQWGKESC-----IYMILDYCS 124

Query: 113 RGGLIDFMNSRLQTR--LSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDG 170
              L     S LQ R  L+E E  ++M  +  GI  +H  +  +IH D+K+ N+L     
Sbjct: 125 NNSL----QSILQYRGSLNEVECKELMIQLCGGIYWLH--LNNVIHGDLKLSNILFDEGQ 178

Query: 171 DFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYR--------ALPV 222
             K+CDFGS       P+   E            T  Y APE +  ++         L +
Sbjct: 179 QLKICDFGSSFIATSSPRGPGEI---------MGTPYYLAPETVYTHKNINKSGMAILLI 229

Query: 223 DEKSDIWALGVFLYKVCYFTTPFEK-------VGENAILQ----AKFQFPSYPQYTDRLK 271
               DIW++G+ LY + Y   PF K       V  + ++Q       +FP+        +
Sbjct: 230 SFPIDIWSMGIVLYSLLYGINPFIKSVDELHNVSLDELMQRITSGVIEFPTNKAVGAGAQ 289

Query: 272 NLISVMLSEHPVQRPNICQVL 292
            LI  MLS++P++R  + +++
Sbjct: 290 QLILKMLSQNPLERITLVEIV 310

>AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR096W (KIN2) and
           YDR122W (KIN1)
          Length = 1071

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 61/211 (28%), Positives = 102/211 (48%), Gaps = 28/211 (13%)

Query: 105 YLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENV 164
           Y+L EY   G L+D++       L E    K    +A  +  +H  +  ++HRD+KIEN+
Sbjct: 156 YMLFEYVSGGQLLDYIIQ--HGSLRERHARKFARGIASALQYLH--LNNIVHRDLKIENI 211

Query: 165 LISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALP-VD 223
           +IS  G+ ++ DFG +S +  P K  + F           +  + APE++   +A P   
Sbjct: 212 MISSSGEIRIIDFG-LSNMYDPKKQLHTF---------CGSLYFAAPELL---KAHPYTG 258

Query: 224 EKSDIWALGVFLYKVCYFTTPFEKVGENA------ILQAKFQFPSYPQYTDRLKNLISVM 277
            + DIW+ GV LY +     PF+   ENA      I Q K ++P +   +  + +L+S M
Sbjct: 259 PEVDIWSFGVVLYVLVCGKVPFDD--ENASVLHEKIKQGKVEYPQH--LSIDVISLLSKM 314

Query: 278 LSEHPVQRPNICQVLEEVSRIQGVPCPLPNF 308
           L   P +R  + QV+      +G   P P++
Sbjct: 315 LVVDPYKRATLKQVVHHQWMQKGYDFPPPSY 345

>Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074
           aa] {ON} YHR102W (REAL)
          Length = 1074

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 62/234 (26%), Positives = 104/234 (44%), Gaps = 37/234 (15%)

Query: 61  DKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFM 120
           D   +  ++ E+  +  LK   ++  Y  S+   +        ++++MEYC  G L   +
Sbjct: 59  DSDEVEDVQREIQFLASLKQIHNITRYYGSYLKDT-------SLWIIMEYCAGGSLRSLL 111

Query: 121 NSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSV 180
                 ++ E  +  IM  V   +  +H     +IHRDIK  NVLI+ +G+ K+CDFG  
Sbjct: 112 RP---GKIDEKYIGVIMREVLVALKCIHK--DNVIHRDIKAANVLITNEGNVKLCDFGVA 166

Query: 181 SGVIRPPKNAYEFNYVQHDILKNTTA---QYRAPEMIDLYRALPVDEKSDIWALGVFLYK 237
           + V             Q  + + T A    + APE+I     +  D K DIW+LG+  Y+
Sbjct: 167 AQV------------NQTSLRRQTMAGTPYWMAPEVI--MEGVYYDTKVDIWSLGITTYE 212

Query: 238 VCYFTTPFEKVGENAILQAKFQFPSYP------QYTDRLKNLISVMLSEHPVQR 285
           +     P+ +V   A+   +    S P       Y+  LK  I++ L E P +R
Sbjct: 213 IATGNPPYCEV--EALRAMQLIIKSKPPRLEGRSYSPSLKEFIALCLDEDPKER 264

>KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1.271
            YJL095W
          Length = 1580

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 65/244 (26%), Positives = 114/244 (46%), Gaps = 39/244 (15%)

Query: 26   QYLTSGGFAQIYSCEVLSPGPIQGSLACLKRVHVP-----DKPSLNT---LRAEVDAMKM 77
            + +  G F  +Y C  L+     G +  +K+V VP     D+  L+T   LR+EV  +K 
Sbjct: 1279 EMIGKGSFGAVYLCLNLT----TGEMMAVKQVEVPKYSAQDQNILDTVEALRSEVSTLKD 1334

Query: 78   LKGHRHVVSYIDSHAAKSPRHDGTYEVY-LLMEYCLRGGLIDFMNSRLQTRLSEFEVLKI 136
            L  H ++V Y+          +  +++Y L +EY   G +   +  RL  R  E  +  +
Sbjct: 1335 LD-HLNIVQYLG--------FENDHDIYSLFLEYVGGGSVGSLI--RLYGRFDEALIRFL 1383

Query: 137  MSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKNAYEFNYV 196
               V +G+  +H+    ++HRD+K +N+L+  DG  K+ DF    G+ R  K+ Y     
Sbjct: 1384 TVQVLEGLAYLHS--KGILHRDMKADNLLLDLDGVCKISDF----GISRKSKDIYS---- 1433

Query: 197  QHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYFTTPFEKVGENAILQA 256
              D+    T  + APEM+D  +      K DIW+LG  + ++     P+  +    ++ A
Sbjct: 1434 NSDMTMRGTVFWMAPEMVDTKQGYSA--KVDIWSLGCVVLEMFAGKRPWSNL---EVVAA 1488

Query: 257  KFQF 260
             F+ 
Sbjct: 1489 MFKI 1492

>Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {ON}
            similar to Ashbya gossypii ACR281C
          Length = 1325

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 65/239 (27%), Positives = 108/239 (45%), Gaps = 45/239 (18%)

Query: 65   LNTLRAEVDAMKML--KGHRHVVSYID------SHAAKSPRHD--GTYEVYLLMEYCLRG 114
            L T+ +E+  M  L  K H +++  +D       +  +SP H   G+ +++ L+E     
Sbjct: 1112 LGTIPSEIQIMATLQKKPHENIMKLLDFFEDDQYYYIESPMHGETGSIDLFDLIE----- 1166

Query: 115  GLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKV 174
                     L+T ++E+E   +   +  G+  +H     ++HRDIK ENV++   G  K+
Sbjct: 1167 ---------LKTNMTEYEAKLLFKQITSGVKHLHD--NGIVHRDIKDENVIVDNKGCVKL 1215

Query: 175  CDFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMI--DLYRALPVDEKSDIWALG 232
             DFGS + V R P + +             T  Y APE++  D Y   P     DIWA+G
Sbjct: 1216 IDFGSAAYVKRGPFDVFV-----------GTIDYAAPEVLEGDPYEGKP----QDIWAIG 1260

Query: 233  VFLYKVCYFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQV 291
            V LY + Y   PF  V E  IL    +       ++    LI+++L     +RP +  +
Sbjct: 1261 VLLYTIIYKENPFYNVDE--ILDGDLRINPSVIVSEECVALITMVLDRSLSKRPTVDDI 1317

>Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {ON}
           YDR490C (REAL)
          Length = 758

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 81/357 (22%), Positives = 150/357 (42%), Gaps = 39/357 (10%)

Query: 14  ILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGPIQGSLACLKRVHVPDKPSLNTLRAEVD 73
           ++ +G  + K  + L  G ++ +        G  + ++  L + ++  +  +  +  E  
Sbjct: 117 VVKMGIKDFKFGEQLGDGSYSSVVLATARESGK-KYAVKVLSKEYLIRQKKVKYVTVEKL 175

Query: 74  AMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTRLSEFEV 133
           A++ L G + ++    +   ++        +Y L+EY   G  +  +  +    L+E   
Sbjct: 176 ALQKLNGTKGIIRLFFTFQDEA-------SLYFLLEYAPHGDFLGLI--KKYGSLNEICA 226

Query: 134 LKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKNAYE- 192
               S +   + ++H++   +IHRDIK EN+L+  D   K+ DFG+   +   P NA + 
Sbjct: 227 RYYASQIIDAVDSLHSI--GIIHRDIKPENILLDKDMKVKLTDFGTAKILPEQPSNAADG 284

Query: 193 ---FNYVQHDILKNTTAQYRAPEMI-DLYRALPVDEKSDIWALGVFLYKVCYFTTPFEKV 248
              F+          TA+Y +PE++ D Y     D + DIWA G  LY++     PF+  
Sbjct: 285 KPCFDLYAKSKSFVGTAEYVSPELLNDSY----TDSRCDIWAFGCILYQMLAGKPPFKAA 340

Query: 249 GENAILQA--KFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQV----------LEEVS 296
            E    Q   K Q+     +   +K+L+  +L   P  R  I Q+           E+ S
Sbjct: 341 NEYLTFQKVMKIQYAFTAGFPQIVKDLVKKLLVRDPNDRLAIEQIKAHVFFDKINFEDGS 400

Query: 297 RIQGVPCPLPNFYL--ERMKHGACTPVHHSASQPALPLATHQFSTSTPMVTHPQPPA 351
              G P  + ++ +  E MK     P   S +     L   Q S+ + +   PQ PA
Sbjct: 401 VWDGDPPEIQSYKISAEAMK----PPPKVSENDTTSKLGNLQLSSRSHLDNTPQEPA 453

>SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] {ON}
            similar to uniprot|P31374 Saccharomyces cerevisiae
            YAL017W PSK1 One of two (see also PSK2) PAS domain
            containing S/T protein kinases coordinately regulates
            protein synthesis and carbohydrate metabolism and storage
            in response to a unknown metabolite that reflects
            nutritional status
          Length = 1274

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 67/237 (28%), Positives = 106/237 (44%), Gaps = 35/237 (14%)

Query: 65   LNTLRAEVDAMKML--KGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRG--GLIDFM 120
            L T+ +E+  M  L  K H ++++ +D               Y  +E  + G  G ID  
Sbjct: 1061 LGTIPSEIQIMATLNKKPHENILTLLDFFEDDD---------YYYIETPMHGETGSIDLF 1111

Query: 121  N-SRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGS 179
            +   L+T ++E E   I   VA GI  +H     ++HRDIK EN+++   G  K+ DFGS
Sbjct: 1112 DLIELKTNMTEHEAKLIFKQVASGIKHLHD--NGIVHRDIKDENIIVDNKGFVKLIDFGS 1169

Query: 180  VSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMI--DLYRALPVDEKSDIWALGVFLYK 237
             + V   P + +             T  Y APE++  D Y   P     DIWA+GV LY 
Sbjct: 1170 AAYVKSGPFDVFV-----------GTIDYAAPEVLGGDPYEGKP----QDIWAIGVLLYT 1214

Query: 238  VCYFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEE 294
            + +   PF  + E  IL    +  S    ++    LI  +L+    +RP I ++  +
Sbjct: 1215 IIFKENPFYNIDE--ILDGDLRISSSVTVSEECIALIRRILNRSVPKRPTIEEIYND 1269

>Suva_7.83 Chr7 complement(159329..161038) [1710 bp, 569 aa] {ON}
           YGL179C (REAL)
          Length = 569

 Score = 81.6 bits (200), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 84/301 (27%), Positives = 137/301 (45%), Gaps = 48/301 (15%)

Query: 13  IILTVGSHE---VKIIQYLTSGGFAQIYSCEVLSPGPIQGSLACLKRVHVPDKPSLNTLR 69
           I+ T+G+ +   VK+ + LT+GG   I   ++L+    +   +    V  P       +R
Sbjct: 52  ILGTLGNGQYGKVKLARDLTTGGLVAI---KILNRFEKKNGYSLQGTVENP------RIR 102

Query: 70  AEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTR-- 127
            E++ MK    H +VV   D      P    + +VYL++EYC RG +     ++L+ +  
Sbjct: 103 EEIEIMKRCH-HENVVKLYD--ILNDPE---STKVYLVLEYCSRGPVKWCPENQLEIKAV 156

Query: 128 ----LSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGV 183
               L+  +  KI+S V  G+  +H+    + HRDIK  N+LIS +G  K+ DFG VS  
Sbjct: 157 GPSILTFEQARKIVSDVVSGLEYLHS--QGITHRDIKPSNLLISSNGAVKISDFG-VS-- 211

Query: 184 IRPPKNAYEFNYVQHDILKNTTA---QYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCY 240
           I     +      Q  I K+ T     + APE+             DIW+LGV LY + +
Sbjct: 212 ILTTTGSTNIQSSQEQISKSKTLGTPAFFAPELCTADGDYRCSSAIDIWSLGVTLYCMLF 271

Query: 241 FTTPFEKVGE----NAILQAKFQFPSYPQYTDR------------LKNLISVMLSEHPVQ 284
            T PF         + I+     FPSY Q + R             K++++ +L ++P +
Sbjct: 272 GTLPFNANSALELFDNIISKPLSFPSYEQVSKRGHPNLAREEYNDAKDILNRLLKKNPSE 331

Query: 285 R 285
           R
Sbjct: 332 R 332

>KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8.279
           YLR096W
          Length = 1192

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 60/214 (28%), Positives = 104/214 (48%), Gaps = 24/214 (11%)

Query: 105 YLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENV 164
           Y+L EY   G L+D++       L E    K    +   +  +HA    ++HRD+KIEN+
Sbjct: 209 YMLFEYVSGGQLLDYIIQ--HGSLREHHARKFARGIGSALQYLHA--NNIVHRDLKIENI 264

Query: 165 LISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALP-VD 223
           +IS  G+ K+ DFG +S V  P K  + F           +  + APE++   +A P + 
Sbjct: 265 MISTSGEIKIIDFG-LSNVYDPRKQLHTF---------CGSLYFAAPELL---KARPYLG 311

Query: 224 EKSDIWALGVFLYKVCYFTTPFEK----VGENAILQAKFQFPSYPQYTDRLKNLISVMLS 279
            + D+W+ GV LY +     PF+     V    I Q   ++P++   +  + +L+S ML 
Sbjct: 312 PEVDVWSFGVVLYVLVCGKVPFDDEVSSVLHEKIKQGNVEYPNH--LSIEVLSLLSKMLV 369

Query: 280 EHPVQRPNICQVLEEVSRIQGVPCPLPNFYLERM 313
             P +R ++ QV+E     +G     P++  +R+
Sbjct: 370 VDPERRASLKQVIEHPWMNRGYDYITPSYLPKRI 403

>Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL095W
            (REAL)
          Length = 1478

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 71/286 (24%), Positives = 125/286 (43%), Gaps = 48/286 (16%)

Query: 26   QYLTSGGFAQIYSCEVLSPGPIQGSLACLKRVHVPDKPSLN--------TLRAEVDAMKM 77
            + +  G F  +Y C  ++     G +  +K+V VP   S N         LR+EV  +K 
Sbjct: 1179 EMIGKGSFGAVYLCLNVT----TGEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKD 1234

Query: 78   LKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIM 137
            L  H ++V Y+          D  Y ++L  EY   G +   +  R+  R  E  +  + 
Sbjct: 1235 L-DHLNIVQYLGFE-----NKDNIYSLFL--EYVAGGSVGSLI--RMYGRFDEPLIKHLT 1284

Query: 138  SHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQ 197
            + V +G+  +H+    ++HRD+K +N+L+  DG  K+ DF    G+ R  K+ Y      
Sbjct: 1285 TQVLKGLAYLHS--KGILHRDMKADNLLLDQDGICKISDF----GISRKSKDIYS----N 1334

Query: 198  HDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYFTTPFEKVGENAILQAK 257
             D+    T  + APEM+D  +      K DIW+LG  + ++     P+  +    ++ A 
Sbjct: 1335 SDMTMRGTVFWMAPEMVDTKQGYSA--KVDIWSLGCIVLEMFAGKRPWSNL---EVVAAM 1389

Query: 258  FQF------PSYPQYTDRL-----KNLISVMLSEHPVQRPNICQVL 292
            F+       P  P+ T  L     +  +      +P +RP   ++L
Sbjct: 1390 FKIGKSKSAPPIPEDTLPLISQVGRGFLDACFEINPEKRPTATELL 1435

>TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1367

 Score = 82.4 bits (202), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 63/237 (26%), Positives = 109/237 (45%), Gaps = 35/237 (14%)

Query: 65   LNTLRAEVDAMKMLKG--HRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRG--GLIDFM 120
            L T+ +E+  M  L    H +++  +D               Y  +E  L G  G ID  
Sbjct: 1154 LGTIPSEIQIMTTLNKSPHENIMQLLDFFEDDD---------YYYIETPLHGETGCIDLF 1204

Query: 121  N-SRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGS 179
            +    ++ ++E E   I   V  GI  +H     ++HRD+K ENV++   G  K+ DFGS
Sbjct: 1205 DLIEFKSNMTESEARLIFIQVVLGIKHLHD--SNIVHRDVKDENVIVDAKGFVKLIDFGS 1262

Query: 180  VSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMI--DLYRALPVDEKSDIWALGVFLYK 237
             + V   P + +             T  Y APE++  + Y   P     DIWA+G+ LY 
Sbjct: 1263 AAYVNSGPFDVFV-----------GTIDYAAPEVLSGEPYLGKP----QDIWAIGILLYT 1307

Query: 238  VCYFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEE 294
            + +   PF  + E  IL+A+ +  +    +    +LI  +L+++P +RP I +++ +
Sbjct: 1308 IMFKENPFYNIDE--ILEAELKINNTSDASQDCIDLIKRILTKNPNKRPTIDEIVND 1362

>ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YOL045W and
            YAL017W (FUN31)
          Length = 1259

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 65/239 (27%), Positives = 108/239 (45%), Gaps = 45/239 (18%)

Query: 65   LNTLRAEVDAMKML--KGHRHVVSYID------SHAAKSPRHD--GTYEVYLLMEYCLRG 114
            L T+ +E+  M  L  K H +++  +D       +  +SP H   G+ +++ L+E     
Sbjct: 1046 LGTIPSEIQIMATLNKKPHENIMRLLDFFEDDEYYYIESPMHGETGSIDLFDLIE----- 1100

Query: 115  GLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKV 174
                     L+T ++E E   +   VA G+  +H     ++HRDIK ENV++   G  K+
Sbjct: 1101 ---------LKTNMTEHEAKLLFKQVASGLRHLHE--NGIVHRDIKDENVIVDNRGRVKI 1149

Query: 175  CDFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMI--DLYRALPVDEKSDIWALG 232
             DFGS + V R P + +             T  Y APE++  D Y   P     D+WA+G
Sbjct: 1150 IDFGSAAYVKRGPFDVFV-----------GTIDYAAPEVLGGDPYEGKP----QDVWAVG 1194

Query: 233  VFLYKVCYFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQV 291
            V LY + Y   PF  + E  IL    +       ++    LI+ +L+    +RP +  +
Sbjct: 1195 VLLYTIIYKENPFYNIDE--ILDGDLRISPAVVVSEECVALITRILNRSVNRRPTVDDI 1251

>CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON}
           similar to uniprot|P38692 Saccharomyces cerevisiae
           YHR102w NRK1 ser/thr protein kinase
          Length = 1072

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 61/210 (29%), Positives = 99/210 (47%), Gaps = 34/210 (16%)

Query: 97  RHDGTY----EVYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVP 152
           R+ G+Y     ++++MEYC  G L   +      ++ E  +  IM  +   +  +H    
Sbjct: 77  RYYGSYLRGTSLWIIMEYCAGGSLRSLLRP---GKIDEKYIGVIMRELLVALKVIHK--D 131

Query: 153 PLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTA---QYR 209
            +IHRDIK  NVLI+ +G  K+CDFG           A + N  Q  + + T A    + 
Sbjct: 132 NVIHRDIKAANVLITNEGQVKLCDFGV----------AAQLN--QTSLRRQTMAGTPYWM 179

Query: 210 APEMIDLYRALPVDEKSDIWALGVFLYKVCYFTTPFEKVGENAILQAKFQFPSYP----- 264
           APE+I     +  D K DIW+LG+  Y++     P+  V   A+   +    S P     
Sbjct: 180 APEVI--MEGVYYDTKVDIWSLGITAYEIATGNPPYCDV--EALRAMQLIIKSKPPRLEE 235

Query: 265 -QYTDRLKNLISVMLSEHPVQRPNICQVLE 293
             YT +LK  I++ L E P +R +  ++L+
Sbjct: 236 RNYTPQLKEFIALCLDEDPQERLSAEELLK 265

>TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {ON}
           Anc_3.92 YDR490C
          Length = 1057

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 67/286 (23%), Positives = 128/286 (44%), Gaps = 29/286 (10%)

Query: 14  ILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGPIQGSLACLKRVHVPDKPSLNTLRAEVD 73
           ++  G  + K  + L  G ++ +        G  + ++  L + ++  +  +  +  E +
Sbjct: 159 VVKKGIKDFKFGETLGDGSYSTVMLATSKESGK-KYAVKVLSKEYLIRQKKVKYVNIEKN 217

Query: 74  AMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTRLSEFEV 133
           A++ L   R +V    +   +S        +Y L+EY   G  +  M  +    L+E   
Sbjct: 218 ALQRLNNSRGIVKLYFTFQDES-------SLYFLLEYAPNGDFLSIM--KKYGSLNEDCA 268

Query: 134 LKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKNAYEF 193
               + +   I  +H+    ++HRDIK EN+L+  D   K+ DFG+   ++ P  N  + 
Sbjct: 269 CYYSAQIIDAIDFLHS--KGIVHRDIKPENILLDKDFKVKLTDFGTAK-ILEPKPNTTD- 324

Query: 194 NYVQHDILKNT-----TAQYRAPEMI-DLYRALPVDEKSDIWALGVFLYKVCYFTTPFEK 247
               +D+L  +     TA+Y +PE++ D Y    VD + DIWA G  L+++     PF+ 
Sbjct: 325 ---SYDLLSRSKSFVGTAEYVSPELLNDNY----VDYRCDIWAFGCILFQMIAGKPPFKA 377

Query: 248 VGENAILQA--KFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQV 291
             E    Q   K Q+     +   +++L+  +L + P QR  I Q+
Sbjct: 378 TNEYLTFQKVMKVQYAFTAGFPLVVRDLVKGILIKQPAQRLTIPQI 423

>YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}
           KIN1Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1064

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 59/214 (27%), Positives = 105/214 (49%), Gaps = 24/214 (11%)

Query: 105 YLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENV 164
           Y+L EY   G L+D++      R  E +  K    +A  ++ +HA    ++HRD+KIEN+
Sbjct: 220 YMLFEYVSGGQLLDYIIQHGSIR--EHQARKFARGIASALIYLHA--NNIVHRDLKIENI 275

Query: 165 LISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALP-VD 223
           +IS   + K+ DFG +S +    K  + F           +  + APE++   +A P   
Sbjct: 276 MISDSSEIKIIDFG-LSNIYDSRKQLHTF---------CGSLYFAAPELL---KANPYTG 322

Query: 224 EKSDIWALGVFLYKVCYFTTPFEK----VGENAILQAKFQFPSYPQYTDRLKNLISVMLS 279
            + D+W+ GV L+ +     PF+     V    I Q K ++P +   +  + +L+S ML 
Sbjct: 323 PEVDVWSFGVVLFVLVCGKVPFDDENSSVLHEKIKQGKVEYPQH--LSIEVISLLSKMLV 380

Query: 280 EHPVQRPNICQVLEEVSRIQGVPCPLPNFYLERM 313
             P +R  + QV+E    ++G   P P++  +R+
Sbjct: 381 VDPKRRATLKQVVEHHWMVRGFNGPPPSYLPKRV 414

>Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON}
           (25064..28447) [3384 nt, 1128 aa]
          Length = 1127

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 59/202 (29%), Positives = 95/202 (47%), Gaps = 34/202 (16%)

Query: 97  RHDGTY----EVYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVP 152
           R+ G+Y     ++++MEYC  G L   +   +   + E  +  IM  +   +  +H    
Sbjct: 105 RYYGSYLQDTNLWIIMEYCAGGSLRTLLRPGM---IDEKYIGVIMRELLTALQCIHK--D 159

Query: 153 PLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTA---QYR 209
            +IHRDIK  NVLI+ +G  K+CDFG           A + N  Q  + + T A    + 
Sbjct: 160 NVIHRDIKAANVLITNEGKVKLCDFGV----------AAQLN--QTSLRRQTMAGTPYWM 207

Query: 210 APEMIDLYRALPVDEKSDIWALGVFLYKVCYFTTPFEKVGENAILQAKFQFPSYP----- 264
           APE+I     +  D K DIW+LG+  Y++     P+ ++   A+   +    S P     
Sbjct: 208 APEVI--MEGVYYDTKVDIWSLGITAYEIATGNPPYCEI--EALRAMQLITKSKPARLEG 263

Query: 265 -QYTDRLKNLISVMLSEHPVQR 285
            QY+  LK  I++ L E P +R
Sbjct: 264 RQYSSGLKEFIALCLDEDPKER 285

>KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {ON}
           Anc_3.92 YDR490C
          Length = 1095

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 60/247 (24%), Positives = 112/247 (45%), Gaps = 20/247 (8%)

Query: 48  QGSLACLKRVHVPDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLL 107
           Q ++  L + ++  +  +  +  E +A++ +   + +V    +   +S        +Y L
Sbjct: 204 QYAVKVLNKEYLIKQKKVKYVNIEKNALQRINNSKMIVKLFFTFQDES-------SLYFL 256

Query: 108 MEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLIS 167
           +EYC  G  +  M  +    L+E       + V   I  +H     +IHRDIK EN+L+ 
Sbjct: 257 LEYCPNGDFLSLM--KKYGSLNETVACYYSAQVIDAIDYLH--TNGIIHRDIKPENILLD 312

Query: 168 GDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMI-DLYRALPVDEKS 226
            +   K+ DFG+   +     N ++        +   TA+Y APE++ D +    VD + 
Sbjct: 313 KEFKIKLTDFGTAKILDSSTNNKFDLLTRSKSFV--GTAEYVAPELLNDSF----VDYRC 366

Query: 227 DIWALGVFLYKVCYFTTPFEKVGENAILQA--KFQFPSYPQYTDRLKNLISVMLSEHPVQ 284
           D+WA G  LY++     PF+   E    Q   K Q+     +   +++L+  +L +   Q
Sbjct: 367 DVWAFGCILYQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPLIIRDLVKKILVKDLNQ 426

Query: 285 RPNICQV 291
           RP+I Q+
Sbjct: 427 RPSISQI 433

>Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {ON}
            YJL095W (REAL)
          Length = 1484

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 71/282 (25%), Positives = 123/282 (43%), Gaps = 50/282 (17%)

Query: 31   GGFAQIYSCEVLSPGPIQGSLACLKRVHVPDKPSLN--------TLRAEVDAMKMLKGHR 82
            G F  +Y C  ++     G +  +K+V VP   S N         LR+EV  +K L  H 
Sbjct: 1190 GSFGAVYLCLNVT----TGEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDL-DHL 1244

Query: 83   HVVSYIDSHAAKSPRHDGTYEVY-LLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVA 141
            ++V Y+      S        +Y L +EY   G +   +  R+  R  E  +  + + V 
Sbjct: 1245 NIVQYLGFENKNS--------IYSLFLEYVAGGSVGSLI--RMYGRFDESLIKHLTTQVL 1294

Query: 142  QGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDIL 201
            +G+  +H+    ++HRD+K +N+L+  DG  K+ DF    G+ R  K+ Y       D+ 
Sbjct: 1295 RGLAYLHS--KGILHRDMKADNLLLDQDGICKISDF----GISRKSKDIYS----NSDMT 1344

Query: 202  KNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYFTTPFEKVGENAILQAKFQF- 260
               T  + APEM+D  +      K DIW+LG  + ++     P+  +    ++ A F+  
Sbjct: 1345 MRGTVFWMAPEMVDTKQGYSA--KVDIWSLGCIVLEMFAGKRPWSNL---EVVAAMFKIG 1399

Query: 261  -----PSYPQYTDRL-----KNLISVMLSEHPVQRPNICQVL 292
                 P  P+ T  L     ++ +       P +RP   ++L
Sbjct: 1400 KSKSAPPIPEDTLPLITRVGRSFLDACFEIDPEKRPTATKLL 1441

>CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017w FUN31
          Length = 1336

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 61/239 (25%), Positives = 111/239 (46%), Gaps = 39/239 (16%)

Query: 65   LNTLRAEVDAMKMLKG--HRHVVSYID------SHAAKSPRHDGTYEVYLLMEYCLRGGL 116
            L T+ +E+  M  +    H ++++ +D       +  ++P H  T  + L         L
Sbjct: 1123 LGTIPSEIQIMATISKEPHENILTLLDFFEDDDYYYIETPVHGETGSIDLF-------DL 1175

Query: 117  IDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCD 176
            I+F     +T ++E E   +   V  G+  +H     ++HRDIK EN+++   G  K+ D
Sbjct: 1176 IEF-----KTNMTEIEAKLLFKQVVSGVKHLHD--QGIVHRDIKDENIIVDSQGFVKIID 1228

Query: 177  FGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEK-SDIWALGVFL 235
            FGS + V   P + +             T  Y APE++      P + K  DIWA+G+ L
Sbjct: 1229 FGSAAYVKSGPFDVFV-----------GTIDYAAPEVLG---GSPYEGKPQDIWAIGILL 1274

Query: 236  YKVCYFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEE 294
            Y + +   PF  + E  IL+ + +F S    +++   LI+ +L+ +  +RP I  +  +
Sbjct: 1275 YTIVFKENPFYNIDE--ILEGELKFNSSELVSEQCTTLIAKILNRNVQKRPTIDDIYND 1331

>KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 1016

 Score = 81.3 bits (199), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 60/229 (26%), Positives = 104/229 (45%), Gaps = 39/229 (17%)

Query: 68  LRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTR 127
           +R E+  +  LK   ++  Y  S+   +       +++++MEYC  G L   +   +   
Sbjct: 59  IRKEIQFLSSLKQTPNITHYYGSYLIDT-------KLWVIMEYCAGGSLRTLLRPGI--- 108

Query: 128 LSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPP 187
           + E  +  IM  +   ++++H     +IHRDIK  N+LI+ +G  K+CDFG  +      
Sbjct: 109 IEEKYIGVIMREILVALISIHR--DNVIHRDIKAANILIANNGSVKLCDFGVAA------ 160

Query: 188 KNAYEFNYVQHDILKNTTAQ----YRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYFTT 243
                   +   +LK  T      + APE+I     +  D K DIW+LG+  Y++     
Sbjct: 161 -------QLSQSMLKRQTMAGTPYWMAPEVI--MEGVYYDTKVDIWSLGITAYEIATGNP 211

Query: 244 PFEKVGENAILQAKFQFPSYP------QYTDRLKNLISVMLSEHPVQRP 286
           P+  +   AI   +    S P      +Y+  LK  I++ L E P +RP
Sbjct: 212 PYCHM--EAIRAMQMITKSKPPRLEGREYSQPLKEFIALCLDEDPKERP 258

>Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}
           YAR019C (REAL)
          Length = 974

 Score = 81.3 bits (199), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 69/247 (27%), Positives = 115/247 (46%), Gaps = 28/247 (11%)

Query: 51  LACLKRVHVPDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEY 110
           +  +K +   +   LN + AE+  +K L  H ++V Y   H         +YE+Y+L+EY
Sbjct: 50  VVAIKEIVYENDEELNDIMAEISLLKNL-NHHNIVKY---HGFIRK----SYELYILLEY 101

Query: 111 CLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDG 170
           C  G L   + SR  T LSE E    ++    G+  +H     +IHRDIK  N+L+S D 
Sbjct: 102 CANGSLRRLI-SRSSTGLSENESKTYVTQTLLGLKYLHG--EGVIHRDIKAANILLSADN 158

Query: 171 DFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWA 230
             K+ DFG VS ++               +    T  + APE++    A  +   SDIW+
Sbjct: 159 TVKLADFG-VSTIVNSSA-----------LTLAGTLNWMAPEILGNRGASTL---SDIWS 203

Query: 231 LGVFLYKVCYFTTPFEKVGENAILQAKFQFPSYP--QYTDRLKNLISVMLSEHPVQRPNI 288
           LG  + ++     P+  + +  I  A      YP   +++ LK+ +S    ++  +RP  
Sbjct: 204 LGATVVEMLTKNPPYHNLTDANIYYAVENDTYYPPSSFSESLKDFLSKCFVKNMYKRPTA 263

Query: 289 CQVLEEV 295
            Q+L+ V
Sbjct: 264 DQLLKHV 270

>NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON} 
          Length = 1258

 Score = 81.3 bits (199), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 61/213 (28%), Positives = 103/213 (48%), Gaps = 25/213 (11%)

Query: 105 YLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENV 164
           Y+L EY   G L+D++       L E    K    +A  +  +H  +  ++HRD+KIEN+
Sbjct: 264 YMLFEYVSGGQLLDYIIQ--HGSLREHHARKFARGIASALQYLH--LNNIVHRDLKIENI 319

Query: 165 LISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALP-VD 223
           +IS  G+ K+ DFG +S V    K  + F           +  + APE++   +A P   
Sbjct: 320 MISNSGEIKIIDFG-LSNVFDNRKQLHTF---------CGSLYFAAPELL---KAHPYTG 366

Query: 224 EKSDIWALGVFLYKVCYFTTPFEK----VGENAILQAKFQFPSYPQYTDRLKNLISVMLS 279
            + D+W+ G+ LY +     PF+     V    I Q K ++P++   +  + +L+S M+ 
Sbjct: 367 PEVDVWSFGIVLYVLVCGKVPFDDENSSVLHEKIRQGKVEYPNH--LSIEVISLLSKMIV 424

Query: 280 EHPVQRPNICQVLEEVSRIQGVPCPLPNFYLER 312
             P +R ++ QV+E     +G   P P  YL R
Sbjct: 425 VDPAKRASLRQVVEHPWMTRGYDFP-PLSYLPR 456

>AFR335C Chr6 complement(1046756..1049857) [3102 bp, 1033 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL100W
           (PKH2) and YDR490C (PKH1)
          Length = 1033

 Score = 80.9 bits (198), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 63/193 (32%), Positives = 96/193 (49%), Gaps = 16/193 (8%)

Query: 104 VYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHAL-VPPLIHRDIKIE 162
           +Y L+EY   G  +  M  R  T LSE E  K   + AQ + A+H L    +IHRD+K E
Sbjct: 276 LYFLLEYAPNGDFLSVMK-RFGT-LSE-ECTKY--YGAQILDAIHHLHKQGIIHRDVKPE 330

Query: 163 NVLISGDGDFKVCDFGSVSGVIRPPKNA-YEFNYVQHDILKNTTAQYRAPEMI-DLYRAL 220
           N+L+      K+ DFG+   + R  +N  Y+ N      +   TA+Y +PE++ D Y   
Sbjct: 331 NILLDKTMKIKLTDFGTAKLIGREDENKPYDLNTRSKSFV--GTAEYVSPELLNDNY--- 385

Query: 221 PVDEKSDIWALGVFLYKVCYFTTPFEKVGENAILQA--KFQFPSYPQYTDRLKNLISVML 278
            VD + DIWA G  L+++     PF+   E    Q   + Q+     +   L++LI  +L
Sbjct: 386 -VDSRCDIWAFGCILFQMVAGKPPFKATNEYLTFQKVMRVQYAFTAGFPMILRDLIKQLL 444

Query: 279 SEHPVQRPNICQV 291
            + P QR  I Q+
Sbjct: 445 VKKPEQRLTILQI 457

>ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {ON}
           weakly similar to uniprot|Q03497 Saccharomyces
           cerevisiae YHL007C STE20 Signal transducing kinase of
           the PAK (p21-activated kinase) family involved in
           pheromone response and pseudohyphal/invasive growth
           pathways activated by Cdc42p binds Ste4p at a GBB motif
           present in noncatalytic domains of PAK kinases
          Length = 963

 Score = 80.9 bits (198), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 73/276 (26%), Positives = 127/276 (46%), Gaps = 45/276 (16%)

Query: 53  CLKRVHVPDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCL 112
            +K++++  +P    +  E+  MK  K HR++V++IDS+  K        +++++MEY  
Sbjct: 682 AIKQMNLEKQPKKELIINEIMVMKGSK-HRNIVNFIDSYLLKG-------DLWVVMEYME 733

Query: 113 RGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDF 172
            G L D +   +   L+E ++  +      G+  +H+    +IHRDIK +N+L+S  G+ 
Sbjct: 734 GGSLTDVVTHCI---LTEGQIGAVCRETLAGLQFLHS--KGVIHRDIKSDNILLSMTGEI 788

Query: 173 KVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALG 232
           K+ DFG  + +        E N  +  ++   T  + APE++      P   K DIW+LG
Sbjct: 789 KLTDFGFCAQI-------NEINLKRTTMVG--TPYWMAPEVVSRKEYGP---KVDIWSLG 836

Query: 233 VFLYKVCYFTTPF--EKVGENAILQAKFQFPSYPQ---YTDRLKNLISVMLSEHPVQR-- 285
           + + ++     P+  E       L A    P   +     + L+N +   L+  P QR  
Sbjct: 837 IMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKEPDNLGEELQNFLDWCLTVEPDQRAS 896

Query: 286 -------PNICQVLEEVSRIQGVPCPLPNFYLERMK 314
                  P + QV EE S +     PL    L RMK
Sbjct: 897 SSQLLKDPFVTQVAEENSSL----APL--VKLARMK 926

>SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {ON}
           highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001C
          Length = 695

 Score = 80.5 bits (197), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 70/279 (25%), Positives = 127/279 (45%), Gaps = 40/279 (14%)

Query: 27  YLTSGGFAQIYSCEVLSPGPIQGSLACLKRVHVPDKPSLNTLRAEVDAMKMLKGHRHVVS 86
           +L  GGFA+ +  +  S G I  +   + ++ +  + +   L +E+   K +K H ++V 
Sbjct: 82  FLGEGGFARCFQMKDDS-GKIFAA-KTVAKISIKSEKTRKKLLSEIQIHKSMK-HPNIVQ 138

Query: 87  YIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMA 146
           +ID         D T  VY+L+E C  G L+D +  R    L+E EV    + +   I  
Sbjct: 139 FIDCF------EDDT-NVYILLEICPNGSLMDLLKKR--KVLTEPEVRYFTTQIVGAIKY 189

Query: 147 MHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKNAYEF----NYVQHDIL- 201
           MH     +IHRD+K+ N+    + + K+ DFG  + +    +  Y      NY+  ++L 
Sbjct: 190 MHN--RRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANDRERKYTVCGTPNYIAPEVLA 247

Query: 202 -KNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYFTTPFEKVGENAILQ----A 256
            K++   Y                  DIW++GV +Y +     PF+    N I +     
Sbjct: 248 GKHSGHSYEV----------------DIWSIGVMIYALLIGKPPFQAKEVNIIYERIKSG 291

Query: 257 KFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEV 295
            + FP     +  +  LI  +LS  P++RP++ ++++ V
Sbjct: 292 DYIFPREKPTSKEVMVLIQDILSIDPIERPSLDEIMDYV 330

>Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {ON}
           complement(57430..60243) [2814 nt, 938 aa]
          Length = 937

 Score = 80.9 bits (198), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 66/252 (26%), Positives = 118/252 (46%), Gaps = 30/252 (11%)

Query: 46  PIQGSLACLKRVHVPDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVY 105
           P +     +K++++  +P    +  E+  MK  K H ++V++IDS+  K        +++
Sbjct: 670 PTREGYVAIKQMNLEKQPKKELIINEIIVMKESK-HENIVNFIDSYLLKG-------DLW 721

Query: 106 LLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVL 165
           ++MEY   G L D +   L   L+E +V  +      G+  +H+    +IHRDIK +N+L
Sbjct: 722 VIMEYMEGGSLTDVVTHCL---LTEAQVGAVCRETLSGLQFLHS--KGVIHRDIKSDNIL 776

Query: 166 ISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEK 225
           +S  GD K+ DFG  + +        E N  +  ++   T  + APE++      P   K
Sbjct: 777 LSMRGDIKLTDFGFCAQI-------NELNLKRTTMVG--TPYWMAPEVVSRKEYGP---K 824

Query: 226 SDIWALGVFLYKVCYFTTPF--EKVGENAILQAKFQFPSYPQ---YTDRLKNLISVMLSE 280
            DIW+LG+ + ++     P+  E       L A    PS  +    +D L N +   L  
Sbjct: 825 VDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPSLKEPEALSDALNNFLGWCLKV 884

Query: 281 HPVQRPNICQVL 292
           +P +R +   +L
Sbjct: 885 NPDERASAKDLL 896

>CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {ON}
           similar to uniprot|Q12236 Saccharomyces cerevisiae
           YOL100w PKH2
          Length = 965

 Score = 80.9 bits (198), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 70/285 (24%), Positives = 127/285 (44%), Gaps = 20/285 (7%)

Query: 14  ILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGPIQGSLACLKRVHVPDKPSLNTLRAEVD 73
           I+  G  + K    L  G ++Q++     +      ++  L + ++  +  +  +  E  
Sbjct: 110 IIRKGIKDFKFGDMLGDGSYSQVFLATSKTDSSKTYAVKVLNKEYLIKQKKVKYVNIEKT 169

Query: 74  AMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTRLSEFEV 133
           A++ LK    V++        S        +Y L+EY   G  +  +  +  T L+E   
Sbjct: 170 ALQNLKSVTGVINL-------SFTFQDEANLYFLLEYAPNGDFLSLI-KKFGT-LNEECT 220

Query: 134 LKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGV-IRPPKNAY- 191
           +   + +   I +MH+    +IHRDIK EN+L+ G+   K+ DFG+   +  +  KN   
Sbjct: 221 IYYSAQIIDAIGSMHS--HGIIHRDIKPENILLDGNMKIKLTDFGTAKLLQKKSDKNGKP 278

Query: 192 EFNYVQHDILKNTTAQYRAPEMI-DLYRALPVDEKSDIWALGVFLYKVCYFTTPFEKVGE 250
            +N +        TA+Y +PE++ D Y     D K DIWA G  +Y++     PF+   E
Sbjct: 279 HYNLLTRSSSFVGTAEYVSPELLSDNY----TDYKCDIWAFGCLVYQMIAGKPPFKATNE 334

Query: 251 NAILQA--KFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLE 293
               Q   K QF     +   +++L+  +L + P +R  I Q+ E
Sbjct: 335 YLTFQKVMKVQFAFTAGFPTIIRDLVKNILVKQPEKRLTIPQIKE 379

>SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly
           similar to uniprot|P38692 Saccharomyces cerevisiae
           YHR102W KIC1 Protein kinase of the PAK/Ste20 kinase
           family required for cell integrity possibly through
           regulating 1 6-beta-glucan levels in the wall physically
           interacts with Cdc31p (centrin) which is a component of
           the spindle pole body
          Length = 885

 Score = 80.5 bits (197), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 61/227 (26%), Positives = 104/227 (45%), Gaps = 37/227 (16%)

Query: 68  LRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTR 127
           ++ E+  +  LK   ++  Y  S+   +       +++++MEYC  G L   +      +
Sbjct: 69  VQKEIQFLSSLKQVPNITHYYGSYLYDT-------KLWIIMEYCAGGSLRTLLRP---GK 118

Query: 128 LSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPP 187
           + E  +  IM  +   ++ +H     +IHRDIK  NVLI+ DG  K+CDFG  + +    
Sbjct: 119 IDEKYIGVIMRELLVALLYIHK--DNVIHRDIKAANVLITNDGRVKLCDFGVAAQL---- 172

Query: 188 KNAYEFNYVQHDILKNTTA---QYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYFTTP 244
                    Q ++ + T A    + APE+I     +  D K DIW+LG+  Y++     P
Sbjct: 173 --------TQSNVRRQTMAGTPYWMAPEVI--MEGVYYDTKVDIWSLGITTYEITTGNPP 222

Query: 245 FEKVGENAILQAKFQFPSYP------QYTDRLKNLISVMLSEHPVQR 285
           +  V   A+   +    S P      QY+  LK  I++ L E P +R
Sbjct: 223 YCDV--EALRAMQLITKSKPPRLEGRQYSPLLKEFIALCLDEDPKER 267

>Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W
           (REAL)
          Length = 1076

 Score = 80.5 bits (197), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 62/234 (26%), Positives = 102/234 (43%), Gaps = 37/234 (15%)

Query: 61  DKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFM 120
           D   +  ++ E+  +  LK   ++  Y  S+   +        +++LMEYC  G L   +
Sbjct: 59  DSDEVEDVQREIQFLASLKQMPNITRYYGSYLKDT-------SLWILMEYCAGGSLRSLL 111

Query: 121 NSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSV 180
                 ++ E  +  IM  +   +  +H     +IHRDIK  NVLI+ +G  K+CDFG  
Sbjct: 112 RP---GKIDEKYIGVIMRELLVALKCIHK--DNVIHRDIKAANVLITNEGSVKLCDFGVA 166

Query: 181 SGVIRPPKNAYEFNYVQHDILKNTTA---QYRAPEMIDLYRALPVDEKSDIWALGVFLYK 237
           + V             Q  + + T A    + APE+I     +  D K DIW+LG+  Y+
Sbjct: 167 AQV------------NQTSLRRQTMAGTPYWMAPEVI--MEGVYYDTKVDIWSLGITTYE 212

Query: 238 VCYFTTPFEKVGENAILQAKFQFPSYP------QYTDRLKNLISVMLSEHPVQR 285
           +     P+  V   A+   +    S P       Y+  LK  I++ L E P +R
Sbjct: 213 IATGNPPYCDV--EALRAMQLIIKSKPPRLEGRSYSSSLKEFIALCLDEDPKER 264

>Suva_1.50 Chr1 (96474..100556) [4083 bp, 1360 aa] {ON} YAL017W (REAL)
          Length = 1360

 Score = 80.5 bits (197), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 64/234 (27%), Positives = 104/234 (44%), Gaps = 35/234 (14%)

Query: 65   LNTLRAEVDAMKMLKG--HRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRG--GLIDFM 120
            L T+ +E+  M  L    H +++  +D               Y  +E  + G  G ID  
Sbjct: 1147 LGTIPSEIQIMATLNKTPHENILRLLDFFEDDD---------YYYIETPVHGETGCIDLF 1197

Query: 121  N-SRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGS 179
            +    +T ++E E   I+  V  GI  +H     ++HRDIK ENV++   G  K+ DFGS
Sbjct: 1198 DLIEFKTNMTECEAKLIVKQVVAGIKHLHD--QGIVHRDIKDENVIVDSKGFVKIIDFGS 1255

Query: 180  VSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMI--DLYRALPVDEKSDIWALGVFLYK 237
             + V   P + +             T  Y APE++  + Y   P     DIWA+G+ LY 
Sbjct: 1256 AAYVKSGPFDVFV-----------GTIDYAAPEVLGGNPYEGKP----QDIWAIGILLYT 1300

Query: 238  VCYFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQV 291
            V +   PF  + E  IL+   +F +  + ++    LI  +L+    +RP I  +
Sbjct: 1301 VVFKENPFYNIDE--ILEGDLKFNNAEEVSEDCIELIKSILNRCVPKRPTIDDI 1352

>NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496
          Length = 895

 Score = 80.5 bits (197), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 62/219 (28%), Positives = 113/219 (51%), Gaps = 37/219 (16%)

Query: 31  GGFAQIYSC-EVLSPGPIQGSLACLKRVHVPDKPSLNTLRAEVDAMKMLKGHRHVVSYID 89
           GG A +Y+  EV +   +      +K++++  +P    +  E+  MK  + H ++V++ID
Sbjct: 622 GGSALVYTAYEVGTNLSV-----AIKQINLEKQPRKQLILNEIIVMKKSQ-HPNIVNFID 675

Query: 90  SHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHA 149
           S+       DG  +++++MEY   G L D +   +   L E ++  +   V +G++ +H+
Sbjct: 676 SYLV-----DG--KLWVIMEYMEAGSLTDVVTRCI---LREGQIGAVCREVLKGLVFLHS 725

Query: 150 LVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNT---TA 206
               +IHRDIK +NVL+S DGD K+ DFG  +          + N +   + +NT   T 
Sbjct: 726 --KGVIHRDIKSDNVLLSMDGDIKLTDFGFCA----------QLNDIH--LKRNTMVGTP 771

Query: 207 QYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYFTTPF 245
            + APE+++     P   K DIW+LGV + ++     P+
Sbjct: 772 YWMAPEIVEKKHYCP---KVDIWSLGVMIIEMIEGEPPY 807

>CAGL0K02167g Chr11 complement(192297..195785) [3489 bp, 1162 aa]
           {ON} similar to uniprot|P38990 Saccharomyces cerevisiae
           YER129w Serine/threonine-protein kinase
          Length = 1162

 Score = 80.5 bits (197), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 75/277 (27%), Positives = 121/277 (43%), Gaps = 51/277 (18%)

Query: 60  PDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDF 119
           P K   + ++ E+  MK    H+HVV  I+       R     ++YL++EYC RG +   
Sbjct: 188 PGKTENDKIKREIAIMKKCH-HKHVVKLIEVLDDLKSR-----KIYLVLEYCSRGEVKWC 241

Query: 120 MNSRLQTR------LSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFK 173
               L+T       LS     +I+  V  G+  +H     +IHRDIK  N+L+S  G  K
Sbjct: 242 PPDCLETEAKGPSPLSFQFTREILRGVVLGLEYLH--YQGIIHRDIKPANLLLSETGIVK 299

Query: 174 VCDFGSVSGVIRPPKNAYEFNYVQHDILKNT-TAQYRAPEMI--------------DLYR 218
           + DFG          +  +    + ++ K   T  + APE+               +L++
Sbjct: 300 ISDFGVSLAASSSNVDGSDETIDELELAKTAGTPAFFAPEICLGEDAFEKYQLDREELFK 359

Query: 219 ALPVDEKSDIWALGVFLYKVCYFTTPFEKVGENAILQAKFQFP-SYPQYTDRLKN----- 272
              +  K DIWALGV LY + +   PF    E  + +     P  +P+Y+D LKN     
Sbjct: 360 GSCISFKIDIWALGVTLYCLVFGMLPFVSSFELELFEKIVNDPVKFPKYSDMLKNNQVLQ 419

Query: 273 ------------LISVMLSEHPVQRPNICQVLEEVSR 297
                       L++ +L ++P++R NI    EE+ R
Sbjct: 420 MTEEAEYEAAKDLLTRLLEKNPIKRINI----EEIKR 452

>KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 843

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 59/193 (30%), Positives = 96/193 (49%), Gaps = 21/193 (10%)

Query: 104 VYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIEN 163
           V++++EYC    L + +    + RLS  E  K+ S +A  +   H L    +HRD+K+EN
Sbjct: 103 VWMVLEYCSGHELYEHLLK--EQRLSLEESKKLFSQIASAVYYAHEL--KCVHRDLKLEN 158

Query: 164 VLISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVD 223
           VL+ G+G  K+ DFG    +             Q + +  TT  Y APE+I+  R     
Sbjct: 159 VLLDGNGHAKLTDFGFTREMA---------TRSQLETICGTTV-YMAPELIE--RKCYDG 206

Query: 224 EKSDIWALGVFLYKVCYFTTPFEKVGEN----AILQAKFQFPSYPQYTDRLKNLISVMLS 279
            K DIW+LG+ LY +     PF++  +      I+  +  F +    +D   +LI  ML 
Sbjct: 207 FKVDIWSLGIILYTMINGYMPFDEDDDIKTKLKIVNDELDF-NQEWISDDAIDLIQGMLR 265

Query: 280 EHPVQRPNICQVL 292
           ++P +R ++ QVL
Sbjct: 266 KNPNERISLAQVL 278

>Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W
           (REAL)
          Length = 1073

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 61/234 (26%), Positives = 103/234 (44%), Gaps = 37/234 (15%)

Query: 61  DKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFM 120
           D   +  ++ E+  +  LK   ++  Y  S+   +        ++++MEYC  G L   +
Sbjct: 59  DSDEVEDVQREIQFLASLKQISNITRYYGSYLKDT-------SLWIIMEYCAGGSLRSLL 111

Query: 121 NSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSV 180
                 ++ E  +  IM  +   +  +H     +IHRDIK  NVLI+ +G+ K+CDFG  
Sbjct: 112 RP---GKIDEKYIGVIMRELLVALKCIHK--DNVIHRDIKAANVLITNEGNVKLCDFGVA 166

Query: 181 SGVIRPPKNAYEFNYVQHDILKNTTA---QYRAPEMIDLYRALPVDEKSDIWALGVFLYK 237
           + V             Q  + + T A    + APE+I     +  D K DIW+LG+  Y+
Sbjct: 167 AQV------------NQTSLRRQTMAGTPYWMAPEVI--MEGVYYDTKVDIWSLGITTYE 212

Query: 238 VCYFTTPFEKVGENAILQAKFQFPSYP------QYTDRLKNLISVMLSEHPVQR 285
           +     P+  V   A+   +    S P       Y+  LK  I++ L E P +R
Sbjct: 213 IATGNPPYCDV--EALRAMQLIIKSKPPRLEGRSYSPSLKEFIALCLDEDPKER 264

>NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {ON}
           Anc_2.496
          Length = 909

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 66/255 (25%), Positives = 124/255 (48%), Gaps = 44/255 (17%)

Query: 53  CLKRVHVPDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCL 112
            +K++++  +P    +  E+  MK  K H ++V++IDS+       DG  +++++MEY  
Sbjct: 654 AIKQMNLEKQPKKELIINEILVMKGSK-HPNIVNFIDSYLL-----DG--DLWVIMEYME 705

Query: 113 RGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDF 172
            G L D +   +   L+E ++  +      G+  +H+    ++HRDIK +N+L+S +G+ 
Sbjct: 706 GGSLTDVVTHCI---LTEGQIGAVCRETLSGLQFLHS--KGVLHRDIKSDNILLSINGNI 760

Query: 173 KVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTA----QYRAPEMIDLYRALPVDEKSDI 228
           K+ DFG  +              V    LK TT      + APE++      P   K DI
Sbjct: 761 KLTDFGFCA-------------QVNETTLKRTTMVGTPYWMAPEVVSRKEYGP---KVDI 804

Query: 229 WALGVFLYKVCYFTTPFEKVGENAILQAKF--------QFPSYPQYTDRLKNLISVMLSE 280
           W+LG+ + ++     P+  + E   L+A +        +     + +D LK+ +   LS 
Sbjct: 805 WSLGIMIIEMIEGEPPY--LNETP-LRALYLIATNGTPELKEREKLSDVLKHFLDWCLSV 861

Query: 281 HPVQRPNICQVLEEV 295
           +P QR +  ++LE+V
Sbjct: 862 NPDQRASATELLEDV 876

>TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]
           {ON} Anc_3.92 YDR490C
          Length = 1347

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 57/216 (26%), Positives = 100/216 (46%), Gaps = 16/216 (7%)

Query: 104 VYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIEN 163
           +Y L+EY   G L+  +  +      E   +   + +   I  +H++   +IHRDIK EN
Sbjct: 334 LYFLLEYASNGDLLTLL--KKYGSFDETSTIYFTAQIIDSIHYIHSM--GIIHRDIKPEN 389

Query: 164 VLISGDGDFKVCDFGSVSGV----IRPPKNAYEFNYVQHDILKNTTAQYRAPEMI-DLYR 218
           +L++ D   K+ DFG+   +        ++   FN ++       TA+Y +PE++ D Y 
Sbjct: 390 ILLTKDFKIKLTDFGTAKILDPSQPSQSQSQPHFNLLERSKSFVGTAEYVSPELLTDSY- 448

Query: 219 ALPVDEKSDIWALGVFLYKVCYFTTPFEKVGENAILQA--KFQFPSYPQYTDRLKNLISV 276
               D + DIWA G  L+++     PF+   E    Q   K Q+     +   L++LI  
Sbjct: 449 ---TDSRCDIWAFGCILFQLIAGKPPFKATNEYLTFQKIIKLQYAFTAGFPTILRDLIKK 505

Query: 277 MLSEHPVQRPNICQVLEEV-SRIQGVPCPLPNFYLE 311
           +L ++P  R  I Q+   +  R +    P   +YL+
Sbjct: 506 ILIKNPNNRLTIHQIKSHLFYRSKDFSNPWNIWYLD 541

>Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON}
           complement(4445..5575) [1131 nt, 377 aa]
          Length = 376

 Score = 78.2 bits (191), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 69/277 (24%), Positives = 121/277 (43%), Gaps = 32/277 (11%)

Query: 20  HEVKIIQYLTSGGFAQIYSCEVLSPGPIQGSLACLKRVHVPDKPSLNTLRAEVDAMKMLK 79
           ++ +I + L  G F ++Y C    P  +  +L  + ++ + +       + E+D    L 
Sbjct: 116 NDFEIGRKLGKGKFGKVY-CVRHKPSGLICALKVMNKMEIVNFNVQKQFKREIDIQYHLN 174

Query: 80  GHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSH 139
                  Y   H +K+        VYL+MEY + G L   +  +    +++      +  
Sbjct: 175 HKNLTKLYAFFHDSKN--------VYLVMEYLIGGELYKLL--KKNGPMNDITASNYVYQ 224

Query: 140 VAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHD 199
           +   +  MH     +IHRD+K EN+LI  +   K+ DFG     I  P N       Q  
Sbjct: 225 MTDALNYMHK--RKIIHRDLKPENILIGFNNQIKLTDFG---WSIYNPNN-------QKR 272

Query: 200 ILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYFTTPFEKVGENA----ILQ 255
                T  Y +PE+I    +   DE  D+WALG+  Y++     PFE+  +      I +
Sbjct: 273 KTLCGTIDYLSPELIS---SREYDENVDVWALGILTYELVVGAPPFEEDTKEQTYKRIAK 329

Query: 256 AKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVL 292
           +  +FP  P  +   ++LI+ +L   P +R N+ QV+
Sbjct: 330 SDLKFP--PNVSSEARDLITNLLKVVPSERFNLQQVM 364

>NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141
          Length = 948

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 80/321 (24%), Positives = 138/321 (42%), Gaps = 66/321 (20%)

Query: 15  LTVGSHEVKIIQYLTSGGFAQIYSCEVL---------SPGPIQGSLACLKRVHVPDKPSL 65
           +T+G     I + +  G FA ++   +L         SP P+  ++  + R  + +K  L
Sbjct: 30  ITIGPDTYMIDKEIGKGSFATVHRAHLLRKQIKDDLTSP-PLNFAIKIVSRSKLKNKKLL 88

Query: 66  NTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSR-- 123
             L  E+  +K +  H H+V  ID           T + YL+MEYC  G L   +  R  
Sbjct: 89  ENLEIEIAILKKI-NHPHIVKLIDCERT-------TTDFYLIMEYCALGDLTFLIKKRHE 140

Query: 124 ------LQTRLSE-----------FEVLKIMSHVAQGIMAMHALVPP-LIHRDIKIENVL 165
                 L  ++ E                I++++ Q   A+  L    L+HRDIK +N+L
Sbjct: 141 LIKNHPLLEKIFEKYPSPNENYNGLHRAFILNYLQQLASALKFLRSKNLVHRDIKPQNLL 200

Query: 166 I-------SGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQ--------YRA 210
           +       +    FK   F  +  +  P     +F + +   L NT+          Y A
Sbjct: 201 LLTPLINYNDSKAFKKLGFIGIYEL--PILKIADFGFAR--FLPNTSMAETLCGSPLYMA 256

Query: 211 PEMIDLYRALPVDEKSDIWALGVFLYKVCYFTTPFEKVGENAILQA------KFQFPSYP 264
           PE+++  +    + K+D+W++G  LY++CY T PF+      + +       K  FP+Y 
Sbjct: 257 PEILNYQK---YNAKADLWSVGTVLYEMCYGTPPFKASNHLELYKKIKRSNNKINFPNYI 313

Query: 265 QYTDRLKNLISVMLSEHPVQR 285
           Q  + +K LIS +L+  P +R
Sbjct: 314 QIQNDMKILISKLLTFDPQRR 334

>ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W Hypothetical ORF
          Length = 938

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 57/196 (29%), Positives = 100/196 (51%), Gaps = 25/196 (12%)

Query: 103 EVYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIE 162
           +V++ +EYC    L + +   +  R+   E  K+ + +   +   H+L    +HRD+K+E
Sbjct: 102 KVWMALEYCPGRELYEHL--LMLHRIPLDECAKLFAQIVSAVHYAHSL--NCVHRDLKLE 157

Query: 163 NVLISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPV 222
           N+L+  +G+ K+ DFG     +   K++ E        +  TT  Y APE+I   R    
Sbjct: 158 NILLDKNGNAKLTDFGFTRECV--SKSSLE-------TICGTTV-YMAPELIQ--RQAYD 205

Query: 223 DEKSDIWALGVFLYKVCYFTTPFEKVGENAILQAKFQFPS-YPQYTDRL-----KNLISV 276
             K DIW+LGV LY +   T PF++  E    + K++  + +P + D       K+LI  
Sbjct: 206 GFKIDIWSLGVILYTMINGTMPFDEDDET---KTKWKIVNDFPNFNDNFVSHEAKDLIKR 262

Query: 277 MLSEHPVQRPNICQVL 292
           +L++ P +RP + Q+L
Sbjct: 263 LLAKCPSERPTMEQIL 278

>NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa] {ON}
            
          Length = 1515

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 60/228 (26%), Positives = 104/228 (45%), Gaps = 34/228 (14%)

Query: 26   QYLTSGGFAQIYSCEVLSPGPIQGSLACLKRVHVPDKPS--------LNTLRAEVDAMKM 77
            + +  G F  +Y C  ++     G +  +K+V VP   S        +  LR+EV  +K 
Sbjct: 1218 EMIGKGSFGAVYLCLNVT----TGEMMAVKQVEVPKYSSQDEAIISTVEALRSEVSTLKD 1273

Query: 78   LKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIM 137
            L  H ++V Y+          D  Y ++L  EY   G +   +  R+  R  E  +  + 
Sbjct: 1274 L-DHLNIVQYLGFE-----NKDNIYSLFL--EYVAGGSVGSLI--RMYGRFDEPLIRHLN 1323

Query: 138  SHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQ 197
            + V +G+  +H+    ++HRD+K +N+L+  DG  K+ DF    G+ R  K+ Y      
Sbjct: 1324 TQVLRGLAYLHSR--GILHRDMKADNLLLDQDGVCKISDF----GISRKSKDIYS----N 1373

Query: 198  HDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYFTTPF 245
             D+    T  + APEM+D  +      K DIW+LG  + ++     P+
Sbjct: 1374 SDMTMRGTVFWMAPEMVDTKQGYSA--KVDIWSLGCIVLEMFAGKRPW 1419

>KNAG0D00830 Chr4 complement(130823..131986) [1164 bp, 387 aa] {ON}
           Anc_6.262 YPL236C
          Length = 387

 Score = 77.8 bits (190), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 79/364 (21%), Positives = 153/364 (42%), Gaps = 81/364 (22%)

Query: 14  ILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGPIQGSL--------ACLKRVHVPDKPSL 65
           ++T+ + + +I++ L+    +  Y  + L+ G I G +        + L  +   D+P+ 
Sbjct: 26  LITINARKYQIVRLLSESELSLTYQVKSLTSGSIFGGMRRQSSMSTSNLNDIDGYDEPTD 85

Query: 66  NTLRAEV----------DAMKMLKGHRH-----VVSYIDSHAAKSPRHDGTYEVYLLMEY 110
             +R  +          +A+K +  +R+     ++  +DS   +  R DG+  V +L+ Y
Sbjct: 86  MVVRQIMCPFGDIESVSNALKEIDNYRYFKSPYIMQCLDSQVIQ--RRDGSKTVLILLPY 143

Query: 111 CLRGGLIDFMNSRLQ--TRLSEFEVLKIMSHVAQGIM-------------------AMHA 149
              G L D ++  L    R+SE EV+++M    +G++                    M A
Sbjct: 144 LPLGSLRDAIDRNLLDGIRMSESEVIRVMIGTCRGLLYLHDPTSRGNLGSSMGPQNGMDA 203

Query: 150 LVPPL----------------------------IHRDIKIENVLISGDGDFKVCDFGSVS 181
           +   L                             H +IK  N+L S DG   + + GS+ 
Sbjct: 204 VSMTLSDDAAMLLDGTPFEMDMLSSHSMKMDSYAHMNIKPSNILFSSDGLPVITELGSLQ 263

Query: 182 GVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYF 241
            +    +N      ++    ++ T  Y  PE+++L     +D   DIW+LG  LY + + 
Sbjct: 264 KLDLKIENVKMLKSIKEWTEEHCTVYYMPPELLNLKVGTVLDCSVDIWSLGCTLYTLLFG 323

Query: 242 TTPF---EKVGE----NAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEE 294
            +PF   E+V E      I +A++ FP    Y+ +L ++I   L  +P  RP + ++L +
Sbjct: 324 ISPFKREEQVNEVPLKYGISKARYSFPEGHVYSKKLVSVIETCLQVNPTMRPTVNELLGQ 383

Query: 295 VSRI 298
           +  I
Sbjct: 384 LQDI 387

>TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa]
           {ON} Anc_1.24 YDR523C
          Length = 468

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 77/290 (26%), Positives = 131/290 (45%), Gaps = 47/290 (16%)

Query: 24  IIQYLTSGGFAQIY-SCEVLSPGPIQGSLACLKRVHVP-DKPSLNTLRAEVDAMKMLKGH 81
           I Q +  G F  +Y +CE +S     G +  +K V++      +N L  E+  +  LK  
Sbjct: 19  IKQCVGRGNFGDVYKACEKVS-----GKVVAVKVVNLEHTDEDINLLAQEIFFLAELKSP 73

Query: 82  RHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVA 141
            ++ +YI +             ++++MEYC  G   D + +     L E +   I   V 
Sbjct: 74  -YITNYITTMTED-------VSMWIIMEYCGGGSCADLLRNIYNCGLPESKSAYITREVL 125

Query: 142 QGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDIL 201
           +G+  +H      IHRDIK  N+L++ +G  K+ DFG VSG IR       F        
Sbjct: 126 KGLEYLHE--QKKIHRDIKAANILLTDEGKVKLGDFG-VSGQIRATLKRGTF-------- 174

Query: 202 KNTTAQYRAPEMI----DLYRALPVDEKSDIWALGVFLYKVCYFTTPFEKVGENAILQAK 257
              T  + APE++    D Y     DEK+DIW+LG+ +Y++   + P  K     ++   
Sbjct: 175 -VGTPFWMAPEVVSKDSDGY-----DEKADIWSLGITVYELLKGSPPLYKCDPMKVM--- 225

Query: 258 FQFPS------YPQYTDRLKNLISVMLSEHPVQRPNICQVL--EEVSRIQ 299
              P       +  Y+   K+ ++  L ++P  RP+  ++L  E V+ +Q
Sbjct: 226 VNLPKRKPPVLHGHYSSAAKHFVASCLVKNPKNRPSAVELLNSEFVTNLQ 275

>NCAS0I00470 Chr9 (74336..77584) [3249 bp, 1082 aa] {ON} Anc_7.86
          Length = 1082

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 63/234 (26%), Positives = 105/234 (44%), Gaps = 35/234 (14%)

Query: 65   LNTLRAEVDAMKML--KGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRG--GLIDFM 120
            L T+ +E+  M  L  K H+++V+ +D             E Y  ME    G  G ID  
Sbjct: 869  LGTIPSEIQIMATLNKKPHKNIVALLDFFED---------EEYYYMETPAHGETGSIDLF 919

Query: 121  N-SRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGS 179
            +   L+  ++E+E   I   V  G+  +H     ++HRDIK ENV++   G  K+ D+GS
Sbjct: 920  DLIELKKNMTEYEEKLIFKQVVSGLKHLHD--QGIVHRDIKDENVIVDSKGHVKLIDYGS 977

Query: 180  VSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMI--DLYRALPVDEKSDIWALGVFLYK 237
             +     P + +             T  Y APE++   +Y   P     DIWA+G+ LY 
Sbjct: 978  AAYTKSGPFDVFV-----------GTIDYAAPEVLGGSVYDGKP----QDIWAIGILLYT 1022

Query: 238  VCYFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQV 291
            + +   PF  + E  I+  + +F      ++    LI  +L+   V RP + ++
Sbjct: 1023 IIFKENPFYNIDE--IMDGELRFNDAGNTSEACIKLIKKILNRSIVDRPCVDEI 1074

>YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}
           CDC15Protein kinase of the Mitotic Exit Network that is
           localized to the spindle pole bodies at late anaphase;
           promotes mitotic exit by directly switching on the
           kinase activity of Dbf2p; required for spindle
           disassembly after meiosis II
          Length = 974

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 70/247 (28%), Positives = 115/247 (46%), Gaps = 28/247 (11%)

Query: 51  LACLKRVHVPDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEY 110
           +  +K V   +   LN + AE+  +K L  H ++V Y   H         +YE+Y+L+EY
Sbjct: 50  VVAIKEVVYENDEELNDIMAEISLLKNL-NHNNIVKY---HGFIRK----SYELYILLEY 101

Query: 111 CLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDG 170
           C  G L   + SR  T LSE E    ++    G+  +H     +IHRDIK  N+L+S D 
Sbjct: 102 CANGSLRRLI-SRSSTGLSENESKTYVTQTLLGLKYLHG--EGVIHRDIKAANILLSADN 158

Query: 171 DFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWA 230
             K+ DFG VS ++               +    T  + APE++    A  +   SDIW+
Sbjct: 159 TVKLADFG-VSTIVNSSA-----------LTLAGTLNWMAPEILGNRGASTL---SDIWS 203

Query: 231 LGVFLYKVCYFTTPFEKVGENAILQAKFQFPSYP--QYTDRLKNLISVMLSEHPVQRPNI 288
           LG  + ++     P+  + +  I  A      YP   +++ LK+ +S    ++  +RP  
Sbjct: 204 LGATVVEMLTKNPPYHNLTDANIYYAVENDTYYPPSSFSEPLKDFLSKCFVKNMYKRPTA 263

Query: 289 CQVLEEV 295
            Q+L+ V
Sbjct: 264 DQLLKHV 270

>CAGL0D01694g Chr4 complement(176981..178279) [1299 bp, 432 aa] {ON}
           similar to uniprot|P41808 Saccharomyces cerevisiae
           YPR054w SMK1 sporulation-specific MAP kinase or
           uniprot|Q00772 Saccharomyces cerevisiae YHR030c SLT2
           ser/thr
          Length = 432

 Score = 78.2 bits (191), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 55/173 (31%), Positives = 85/173 (49%), Gaps = 28/173 (16%)

Query: 71  EVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTRLSE 130
           E+  M   KGH+H+V+ ID    +   +DG Y    L++Y     L   ++S +Q  LSE
Sbjct: 121 EIKFMNYFKGHKHIVNLIDIEIVQDKPYDGLYCYQELIDY----DLARVIHSSVQ--LSE 174

Query: 131 FEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKNA 190
           F +   +  +  G+  +H+    +IHRD+K  N+L + +G  K+CDFG   GV +   N 
Sbjct: 175 FHIQHFIYQILCGVKYIHS--ADVIHRDLKPGNILCTVNGCLKICDFGLARGVAKQFVNK 232

Query: 191 YE-----FNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKS---DIWALGVFL 235
                   NYV        T  YRAPE+I     L  +E +   D+W++G  L
Sbjct: 233 NSKPNEITNYV-------ATRWYRAPELI-----LSNNEYTKSVDMWSVGCIL 273

>Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}
           (4910..5845,5849..7711) [2799 nt, 933 aa]
          Length = 932

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 54/179 (30%), Positives = 90/179 (50%), Gaps = 23/179 (12%)

Query: 116 LIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVC 175
           L DF+  +   ++ E E   I   +  GI  +H L   +IHRDIK EN++I  +G  +V 
Sbjct: 766 LFDFIEKK--DKIDEVEQKLIFKQIVAGIKHIHGL--GIIHRDIKTENIIIDSEGCVQVI 821

Query: 176 DFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEK-SDIWALGVF 234
           DFGS +     P   +           + T  Y +PE++   +  P + K  D+WALG+ 
Sbjct: 822 DFGSAAYATNGPFQVF-----------HGTIDYASPEVL---KGEPYEGKPQDVWALGIL 867

Query: 235 LYKVCYFTTPFEKVGENAILQAKFQF-PSYPQ-YTDRLKNLISVMLSEHPVQRPNICQV 291
           LY + +  TPF  V E  I++ + +  P++ +  +D+ + LI  ML +    RP I ++
Sbjct: 868 LYIITFKQTPFNSVAE--IIENELEIDPAHSENVSDQCRVLIHKMLDKKAWARPKISEI 924

>Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 aa]
           {ON} YDR507C (REAL)
          Length = 1024

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 64/237 (27%), Positives = 107/237 (45%), Gaps = 42/237 (17%)

Query: 68  LRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTR 127
           +  E+  MK+L  H +V+S  D     +        +YL++EY  +G L + +  R    
Sbjct: 66  IEREIVVMKLL-SHPNVLSLYDVWETNN-------NLYLILEYAEKGELFNLLVDR--GP 115

Query: 128 LSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPP 187
           L E E +K    +   I   HAL   ++HRD+K EN+L+  D + K+ DFG  +      
Sbjct: 116 LPEKEAVKCFRQIIIAISYCHAL--GIVHRDLKPENLLLDNDYNIKIADFGMAA------ 167

Query: 188 KNAYEFNYVQHD--ILKNTTA--QYRAPEMIDL--YRALPVDEKSDIWALGVFLYKVCYF 241
                   +Q D  +L+ +     Y APE++    YR       SD+W+ GV L+ +   
Sbjct: 168 --------LQTDARLLETSCGSPHYAAPEIVSGLPYRGFA----SDVWSCGVILFALLTG 215

Query: 242 TTPFEKVGENA------ILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVL 292
             PF++   N       + + +F+ P   + +   +NLIS +L   P QR     +L
Sbjct: 216 RLPFDEDNGNVRDLLLKVQRGQFEMPDATEISKDAQNLISRILVVDPTQRMKTRDIL 272

>KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {ON}
           Anc_5.406 YHR102W
          Length = 1027

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 64/242 (26%), Positives = 109/242 (45%), Gaps = 37/242 (15%)

Query: 61  DKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFM 120
           D+  +  ++ E+  +  LK   +V  Y  S+   +        ++++MEYC  G L   +
Sbjct: 77  DEDEVEDVQREIQFLASLKQLPNVTRYYGSYLKNT-------SLWIIMEYCAGGSLRSLL 129

Query: 121 NSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSV 180
                 ++ E  +  IM  +   +  +H     +IHRDIK  NVLI+ +G  K+CDFG  
Sbjct: 130 RP---GKIDEKYIGVIMRELLVALKFIHK--DNIIHRDIKAANVLITNEGGVKLCDFGV- 183

Query: 181 SGVIRPPKNAYEFNYVQHDILKNTTA---QYRAPEMIDLYRALPVDEKSDIWALGVFLYK 237
                    A + N  Q  + + T A    + APE+I     +  D K DIW+LG+  Y+
Sbjct: 184 ---------AAQLN--QRTLRRQTMAGTPYWMAPEVI--MEGVYYDTKVDIWSLGITAYE 230

Query: 238 VCYFTTPFEKVGENAILQAKFQFPSYP------QYTDRLKNLISVMLSEHPVQRPNICQV 291
           +     P+  V   A+   +    S P       YT  +K  I++ L E P +R +  ++
Sbjct: 231 ISTGNPPYCDV--EALRAMQLITKSKPPRLEGRNYTPLIKEFIALCLDEDPNERLSADEL 288

Query: 292 LE 293
           L+
Sbjct: 289 LK 290

>TPHA0L00500 Chr12 (83710..86589) [2880 bp, 959 aa] {ON} Anc_7.86
           YAL017W
          Length = 959

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 84/288 (29%), Positives = 125/288 (43%), Gaps = 52/288 (18%)

Query: 24  IIQYLTSGGFAQIYSCEVLSPGPIQGSLACLKRVHVPDKPSLNTLRA-----EVDAMKML 78
           I++ L +G F  +Y C   +   I  ++  + +  + ++  L    A     EV  +  L
Sbjct: 700 ILKELGAGAFGNVYLCLHRTEKYII-TIKVIYKEKIAEEYWLKEDLADGIPLEVKILLDL 758

Query: 79  KGHRH-----VVSYI---DSHAAKSPRH--DGTYEVYLLMEYCLRGGLIDFMNSRLQTRL 128
             ++H     ++ Y    D++  +SP H  DG  +++            D ++S+    L
Sbjct: 759 HENKHANVLELLDYFEDKDNYYLESPVHGIDGCVDLF------------DIIDSK--QEL 804

Query: 129 SEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPK 188
           SE E   I   +   +   H L   + HRDIK +NV+I   G  K+ DFGS       P 
Sbjct: 805 SEIEYKLIFKQIVSAVKHSHTL--GIAHRDIKEQNVIIDSRGHCKLIDFGSAVYTHMGPF 862

Query: 189 NAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEK-SDIWALGVFLYKVCYFTTPFEK 247
            ++             T  Y APE I   RA+  + K  DIWALGV LY + +   PF+ 
Sbjct: 863 LSF-----------TGTIDYSAPETI---RAMAYEGKPQDIWALGVLLYTLIFKQLPFKN 908

Query: 248 VGENAILQAKFQF--PSYPQYTDRLKNLISVMLSEHPVQRPNICQVLE 293
           V E  IL+AK  F  PS P  +    NLI  ML      RP I  V E
Sbjct: 909 VEE--ILEAKLNFSNPSIP-ISKECMNLIERMLELQVRNRPFIEDVYE 953

>KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W
          Length = 849

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 55/198 (27%), Positives = 95/198 (47%), Gaps = 29/198 (14%)

Query: 104 VYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIEN 163
           V++ +EYC    L +++   ++ R+   E   + S +   +   H++    +HRD+K+EN
Sbjct: 103 VWMALEYCPGKELYEYL--LIKKRIPLDECSHLFSQIVGAVFYAHSM--KCVHRDLKLEN 158

Query: 164 VLISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNT--TAQYRAPEMIDLYRALP 221
           +L+   G  K+ DFG            +        IL+    T  Y APE+I+  R   
Sbjct: 159 ILLDKKGQAKLTDFG------------FTRECATKGILETVCGTTVYMAPELIE--RKPY 204

Query: 222 VDEKSDIWALGVFLYKVCYFTTPFEKVGENAILQAKFQF-PSYPQYTDRL-----KNLIS 275
              K D W+LG+ LY + +   PF+   E   ++ K++   + P Y D       K+LI 
Sbjct: 205 EGYKIDTWSLGIILYTMIHGAMPFD---EEDDIKTKYRIVNNEPFYDDNFIDANGKDLIM 261

Query: 276 VMLSEHPVQRPNICQVLE 293
            +L + P QRP++ QVL+
Sbjct: 262 QLLQKDPSQRPSLTQVLQ 279

>Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {ON}
           YMR001C (CDC5) - protein kinase which functions at the
           G(sub)2/M boundary [contig 185] FULL
          Length = 697

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 68/280 (24%), Positives = 124/280 (44%), Gaps = 40/280 (14%)

Query: 26  QYLTSGGFAQIYSCEVLSPGPIQGSLACLKRVHVPDKPSLNTLRAEVDAMKMLKGHRHVV 85
            +L  GGFA+ +  ++   G    +   + ++ +  + +   L +E+   K ++ H ++V
Sbjct: 83  HFLGEGGFARCF--QIKDDGGKIFAAKTVAKISIKSEKTRKKLLSEIQIHKSMR-HTNIV 139

Query: 86  SYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIM 145
            ++D         D T  VY+L+E C  G L+D +  R    L+E EV    + +   + 
Sbjct: 140 QFVDCF------EDDT-NVYILLEICPNGSLMDLLKRR--KMLTEPEVRFFTTQIVGAVK 190

Query: 146 AMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKNAYEF----NYVQHDIL 201
            MH+    +IHRD+K+ N+      + KV DFG  + +    +  Y      NY+  ++L
Sbjct: 191 YMHS--RRVIHRDLKLGNIFFDKHYNLKVGDFGLAAVLANDRERKYTVCGTPNYIAPEVL 248

Query: 202 --KNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYFTTPFEKVGENAILQ---- 255
             K+T   Y                  DIW+ GV +Y +     PF+    N I +    
Sbjct: 249 TGKHTGHSYEV----------------DIWSCGVMIYALLIGKPPFQAKEVNIIYERIKC 292

Query: 256 AKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEV 295
             F FP     +     LI  +LS  P++RP++ ++++ V
Sbjct: 293 GDFVFPKDKFISPEALVLIKDILSIDPLERPSLDEIIDYV 332

>NDAI0A08560 Chr1 complement(1969778..1973731) [3954 bp, 1317 aa] {ON}
            Anc_7.86
          Length = 1317

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 71/285 (24%), Positives = 121/285 (42%), Gaps = 51/285 (17%)

Query: 21   EVKIIQYLTSGGFAQIYSC-EVLSPGPIQGSLACLKRV----HVPDKPSLNTLRAEVDAM 75
            +  I++ +  G + ++  C   LS   +   +   +R+     V D+  L T+ +E+  M
Sbjct: 1056 DFAILEEMGQGAYGKVNLCIHKLSRQIVVIKMIVKERILVDTWVRDR-KLGTIPSEIQIM 1114

Query: 76   KMLKG--HRHVVSYID------SHAAKSPRH--DGTYEVYLLMEYCLRGGLIDFMNSRLQ 125
              L    H +++S +D       +  + P H   GT ++Y L+E+              +
Sbjct: 1115 ATLNKTPHENILSILDFFEDDNYYYVEMPTHGETGTIDLYDLIEF--------------K 1160

Query: 126  TRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIR 185
              ++E E   +   V   I  MH     ++HRDIK EN+++   G  K+ D+GS +    
Sbjct: 1161 KNMTELECKLMFKQVVSAIKCMHD--QGIVHRDIKDENIIVDSKGCIKLIDYGSAAYTKS 1218

Query: 186  PPKNAYEFNYVQHDILKNTTAQYRAPEMI--DLYRALPVDEKSDIWALGVFLYKVCYFTT 243
             P + +             T  Y APE++  +LY   P     DIWALG+ LY + +   
Sbjct: 1219 GPFDVFV-----------GTIDYAAPEVLSGNLYDGKP----QDIWALGILLYTIVFKEN 1263

Query: 244  PFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNI 288
            PF  + E  I+  +  F        +   LI  ML+    QRP I
Sbjct: 1264 PFYNIDE--IVDGELTFNESMSIDSKCIILIKKMLNRVVGQRPTI 1306

>NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON}
           Anc_3.92
          Length = 1116

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 65/279 (23%), Positives = 124/279 (44%), Gaps = 22/279 (7%)

Query: 14  ILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGPIQGSLACLKRVHVPDKPSLNTLRAEVD 73
           ++  G  + K  + L  G ++ +        G  + ++  L + ++  +  +  +  E  
Sbjct: 166 VVKKGIKDFKFGEMLGDGAYSTVMLATSNDSGK-KYAVKVLNKEYLIRQKKVKYVNIEKL 224

Query: 74  AMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTRLSEFEV 133
           A++ L   R ++    +   ++        +Y L+EY   G L+  M  +    L+E   
Sbjct: 225 ALQRLNNSRSIIRLFFTFQDEA-------SLYFLLEYAPNGDLLSLM--KKFGSLNEECC 275

Query: 134 LKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVI-RPPKNAYE 192
               + +   I  MH+    +IHRDIK EN+L+  D   K+ DFG+   +  +PP  +Y+
Sbjct: 276 CYYGAQIIDAIKFMHS--KGIIHRDIKPENILLDKDMKVKITDFGTAKILDNKPPGTSYD 333

Query: 193 FNYVQHDILKNTTAQYRAPEMI-DLYRALPVDEKSDIWALGVFLYKVCYFTTPFEKVGEN 251
                   +   TA+Y +PE++ D Y     D +SDIWA G  ++++     PF+   E 
Sbjct: 334 LLTRSKSFV--GTAEYVSPELLNDNY----TDARSDIWAFGCIVFQMIAGKPPFKATNEY 387

Query: 252 AILQA--KFQFPSYPQYTDRLKNLISVMLSEHPVQRPNI 288
              Q   K Q+     +   +++L+  +L + P QR  I
Sbjct: 388 LTFQKVMKVQYAFTAGFPTVVRDLVKRILIKAPEQRLTI 426

>NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5.406
          Length = 1015

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 64/234 (27%), Positives = 105/234 (44%), Gaps = 37/234 (15%)

Query: 61  DKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFM 120
           D+  +  ++ EV  +  LK   ++  Y  S+   +        ++++MEYC  G L   +
Sbjct: 73  DEDEVEDVQREVQFLSSLKQIPNITRYYGSYLKDT-------SLWIIMEYCAGGSLRSLL 125

Query: 121 NSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSV 180
                 ++ E  +  IM  +   +  +H     +IHRDIK  NVLI+ +G  K+CDFG  
Sbjct: 126 RP---GKIDEKYIGVIMRELLVALKYIHK--DNVIHRDIKAANVLITNEGSVKLCDFGV- 179

Query: 181 SGVIRPPKNAYEFNYVQHDILKNTTA---QYRAPEMIDLYRALPVDEKSDIWALGVFLYK 237
                    A + N  Q  + + T A    + APE+I     +  D K DIW+LG+  Y+
Sbjct: 180 ---------AAQLN--QSTLRRQTMAGTPYWMAPEVI--MEGVYYDTKVDIWSLGITAYE 226

Query: 238 VCYFTTPFEKVGENAILQAKFQFPSYP------QYTDRLKNLISVMLSEHPVQR 285
           +     P+ +V   A+   +    S P       YT  LK  I++ L E P +R
Sbjct: 227 IATGNPPYCEV--EALRAMQLITKSKPPRLESRSYTPLLKEFIALCLDEDPKER 278

>Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 619

 Score = 78.2 bits (191), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 69/271 (25%), Positives = 123/271 (45%), Gaps = 33/271 (12%)

Query: 52  ACLKRVHVPDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYC 111
             +K++++  +P    +  E+  MK  K H ++V++IDS+  K        +++++MEY 
Sbjct: 355 VAIKQMNLEKQPKKELIINEILVMKGSK-HSNIVNFIDSYLLKG-------DLWVVMEYM 406

Query: 112 LRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGD 171
             G L D +   +   L+E ++  +     +G+  +H+    +IHRDIK +N+L+S +GD
Sbjct: 407 EGGSLTDVVTHCI---LTEGQIGAVCRETLKGLQFLHS--KGVIHRDIKSDNILLSMNGD 461

Query: 172 FKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWAL 231
            K+ DFG  + +        E N  +  ++   T  + APE++      P   K DIW+L
Sbjct: 462 IKLTDFGFCAQI-------NEVNLKRTTMVG--TPYWMAPEVVSRKEYGP---KVDIWSL 509

Query: 232 GVFLYKVCYFTTPF--EKVGENAILQAKFQFPSY---PQYTDRLKNLISVMLSEHPVQRP 286
           G+ + ++     P+  E       L A    P        +D LK  +   L   P  R 
Sbjct: 510 GIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKDPENLSDTLKEFLGWCLKVDPEDRA 569

Query: 287 NICQVLEEV---SRIQGVPCPLPNFYLERMK 314
           N  ++L      +  +   C  P   L RMK
Sbjct: 570 NAAELLSGTFISTYAEKNECLAPLVKLARMK 600

>KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON}
            uniprot|O60030 Kluyveromyces lactis BCK1 MAP kinase
            kinase kinase
          Length = 1338

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 66/261 (25%), Positives = 115/261 (44%), Gaps = 40/261 (15%)

Query: 26   QYLTSGGFAQIYSCEVLSPGPIQGSLACLKRVHVPDKPS--------LNTLRAEVDAMKM 77
            + +  G F  +Y    L+     G +  +K+V VP+  S        +  L++EV  +K 
Sbjct: 1042 EIIGKGSFGAVY----LALNVTTGEMLAVKQVTVPEFSSQDESAISMVEALKSEVSTLKD 1097

Query: 78   LKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIM 137
            L  H ++V Y+          +G Y ++L  EY   G +   +  R+  R  +  +  + 
Sbjct: 1098 L-NHVNIVQYLGFE-----EKNGIYSLFL--EYVAGGSVGSLI--RMYGRFDDQLIRHLT 1147

Query: 138  SHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQ 197
              V +G+  +H+    ++HRD+K +N+L+  DG  K+ DF    G+ R   N Y      
Sbjct: 1148 KQVLEGLAYLHS--KGILHRDMKADNLLLDNDGVCKISDF----GISRKSNNIYS----N 1197

Query: 198  HDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYFTTPFEKVGENAILQAK 257
             D+    T  + APEM+D         K DIW+LG  + ++     P+       ++ A 
Sbjct: 1198 SDMTMRGTVFWMAPEMVDTAHGYSA--KVDIWSLGCVVLEMFAGKRPWSNF---EVVAAM 1252

Query: 258  FQF---PSYPQYTDRLKNLIS 275
            FQ     + P   D  K+L+S
Sbjct: 1253 FQIGKSKTAPPIPDDTKDLVS 1273

>KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5.406
           YHR102W
          Length = 1008

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 63/237 (26%), Positives = 108/237 (45%), Gaps = 27/237 (11%)

Query: 61  DKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFM 120
           D+  +  ++ E+  +  LK   ++  Y  S+   +        ++++MEYC  G L   +
Sbjct: 71  DEDEVEDVQKEIQFLASLKQLPNITRYYGSYLKNT-------SLWIIMEYCGGGSLRSLL 123

Query: 121 NSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSV 180
                 ++ E  +  IM  +   +  +H     +IHRDIK  NVLI+ DG  K+CDFG V
Sbjct: 124 RP---GKIDEKYIGVIMREILIALKYIHK--DNVIHRDIKAANVLINNDGSIKLCDFG-V 177

Query: 181 SGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCY 240
           +  +   K+  +            T  + APE+I     +  D K+DIW+ G+  Y+V  
Sbjct: 178 AAQLNQTKSRRQ--------TMAGTPYWMAPEVI--MEGVYYDTKADIWSTGITAYEVTT 227

Query: 241 FTTPFEKVGENAILQ--AKFQFPSYP--QYTDRLKNLISVMLSEHPVQRPNICQVLE 293
              P+  V     +Q  AK + P      Y+  +K  I+  L E P +RP   ++L+
Sbjct: 228 GNPPYCDVEALRAMQLIAKSKPPRLEGRNYSALIKEFIATCLDEDPSERPTADELLK 284

>KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 697

 Score = 78.2 bits (191), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 69/280 (24%), Positives = 125/280 (44%), Gaps = 40/280 (14%)

Query: 26  QYLTSGGFAQIYSCEVLSPGPIQGSLACLKRVHVPDKPSLNTLRAEVDAMKMLKGHRHVV 85
            +L  GGFA+ +  +  S G I  +   + ++ +  + +   L +E+   K ++ H ++V
Sbjct: 83  HFLGEGGFARCFQIKDDS-GKIFAA-KTVAKISIKSEKTRKKLLSEIQIHKSMR-HFNIV 139

Query: 86  SYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIM 145
            +ID         D T  VY+L+E C  G L+D +  R    L+E EV    + +   + 
Sbjct: 140 QFIDCF------EDDT-NVYILLEICPNGSLMDLLKRR--KVLTEPEVRFFTTQIVGAVK 190

Query: 146 AMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKNAYEF----NYVQHDIL 201
            MH+    +IHRD+K+ N+      + K+ DFG  + +    +  Y      NY+  ++L
Sbjct: 191 YMHS--RRVIHRDLKLGNIFFDKHYNLKIGDFGLAAVLANDRERKYTVCGTPNYIAPEVL 248

Query: 202 --KNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYFTTPFEKVGENAILQ---- 255
             K+T   Y                  DIW+ GV +Y +     PF+    N I +    
Sbjct: 249 TGKHTGHSYEV----------------DIWSCGVMIYALLIGKPPFQAKEVNIIYERIKC 292

Query: 256 AKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEV 295
             + FP     +     LI  +LS  P++RP++ ++++ V
Sbjct: 293 GDYVFPRDKCISQEALTLIRDILSIDPLERPSLDEIIDYV 332

>YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Protein
           kinase of the PAK/Ste20 family, required for cell
           integrity; physically interacts with Cdc31p (centrin),
           which is a component of the spindle pole body; part of
           the RAM network that regulates cellular polarity and
           morphogenesis
          Length = 1080

 Score = 78.6 bits (192), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 60/234 (25%), Positives = 103/234 (44%), Gaps = 37/234 (15%)

Query: 61  DKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFM 120
           D   +  ++ E+  +  LK   ++  Y  S+   +        ++++ME+C  G L   +
Sbjct: 59  DSDEVEDVQREIQFLASLKQISNITRYYGSYLKDT-------SLWIIMEHCAGGSLRSLL 111

Query: 121 NSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSV 180
                 ++ E  +  IM  +   +  +H     +IHRDIK  NVLI+ +G+ K+CDFG  
Sbjct: 112 RP---GKIDEKYIGVIMRELLVALKCIHK--DNVIHRDIKAANVLITNEGNVKLCDFGVA 166

Query: 181 SGVIRPPKNAYEFNYVQHDILKNTTA---QYRAPEMIDLYRALPVDEKSDIWALGVFLYK 237
           + V             Q  + + T A    + APE+I     +  D K DIW+LG+  Y+
Sbjct: 167 AQV------------NQTSLRRQTMAGTPYWMAPEVI--MEGVYYDTKVDIWSLGITTYE 212

Query: 238 VCYFTTPFEKVGENAILQAKFQFPSYP------QYTDRLKNLISVMLSEHPVQR 285
           +     P+  V   A+   +    S P       Y+  LK  I++ L E P +R
Sbjct: 213 IATGNPPYCDV--EALRAMQLIIKSKPPRLEDRSYSTSLKEFIALCLDEDPKER 264

>Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150W
           (REAL)
          Length = 924

 Score = 78.6 bits (192), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 58/202 (28%), Positives = 101/202 (50%), Gaps = 37/202 (18%)

Query: 103 EVYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIE 162
           +V++ +EYC    L D + S    R+S  E  ++ + ++  +   H++    +HRD+K+E
Sbjct: 106 KVWMALEYCPGKELYDHLLS--LHRISLLECGELFAQISGAVYYAHSM--HCVHRDLKLE 161

Query: 163 NVLISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNT------TAQYRAPEMIDL 216
           N+L+  +G+ K+ DFG                + +  + K T      T  Y APE+I  
Sbjct: 162 NILLDKNGNAKLTDFG----------------FTRECMTKTTLETVCGTTVYMAPELIG- 204

Query: 217 YRALPVDEKSDIWALGVFLYKVCYFTTPFEKVGENAILQAKFQFPS-YPQYT-----DRL 270
            R      K D W+LGV LY +   + PF+   E    + K++  +  P+Y      D  
Sbjct: 205 -RKTYDGFKIDTWSLGVILYTLITGSLPFDDDDE---AKTKWKIVNEEPKYDPKLIPDDA 260

Query: 271 KNLISVMLSEHPVQRPNICQVL 292
           K+LIS +L+++P +RP++ QVL
Sbjct: 261 KDLISRLLAKNPGERPSLPQVL 282

>NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141
          Length = 349

 Score = 76.3 bits (186), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 62/203 (30%), Positives = 100/203 (49%), Gaps = 23/203 (11%)

Query: 104 VYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIEN 163
           VYLLMEY + G L   + S      ++    + +  +A  +  +H     +IHRD+K EN
Sbjct: 164 VYLLMEYLVYGELYKLLRS--HGPFNDVIASRFVFQIADALNYLHD--KQIIHRDLKPEN 219

Query: 164 VLISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVD 223
           +LI  +   K+ DFG    +I P         V+   L  T   Y +PEMI   R+   D
Sbjct: 220 ILIGFNNVIKLTDFGW--SIINPRG-------VKRKTLCGTI-DYLSPEMI---RSREYD 266

Query: 224 EKSDIWALGVFLYKVCYFTTPFE----KVGENAILQAKFQFPSYPQYTDRLKNLISVMLS 279
           +K D+WALGV  Y++   + PFE    ++    IL+   +FP    +   +K+LIS +L 
Sbjct: 267 DKVDVWALGVLTYELIVGSPPFEEDTKELTYKRILKNDIKFPETVSHD--VKDLISKLLK 324

Query: 280 EHPVQRPNICQVLEEVSRIQGVP 302
            +P +R ++  V++    I+  P
Sbjct: 325 YNPSERISMRDVMKHPWIIRNKP 347

>Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W
           (REAL)
          Length = 1017

 Score = 78.2 bits (191), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 63/236 (26%), Positives = 108/236 (45%), Gaps = 40/236 (16%)

Query: 68  LRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTR 127
           +  E+  MK+L  H +V+   D     +        +YL++EY  +G L + +  R    
Sbjct: 74  IEREIVIMKLL-SHPNVLGLYDVWETNN-------NLYLILEYAEKGELFNLLVDR--GA 123

Query: 128 LSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPP 187
           L E E +K    +   +   HAL   ++HRD+K EN+L+  D + KV DFG  +      
Sbjct: 124 LPEREAMKCFRQIIIAVSYCHAL--GIVHRDLKPENLLLDSDYNIKVADFGMAA------ 175

Query: 188 KNAYEFNYVQHD--ILKNTTA--QYRAPEMIDLYRALPVDE-KSDIWALGVFLYKVCYFT 242
                   +Q D  +L+ +     Y APE++     LP +   SD+W+ GV L+ +    
Sbjct: 176 --------LQTDAALLETSCGSPHYAAPEIVS---GLPYEGFSSDVWSCGVILFALLTGR 224

Query: 243 TPFEKVGEN------AILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVL 292
            PF++   N       + + +F+ P   + +   ++LIS +L   P QR  I  +L
Sbjct: 225 LPFDEENGNIRTLLLKVQRGQFEMPDDTEISKDAQDLISKILVVDPAQRIKIRDIL 280

>TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON}
           Anc_8.279 YLR096W
          Length = 1315

 Score = 78.6 bits (192), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 61/212 (28%), Positives = 98/212 (46%), Gaps = 28/212 (13%)

Query: 105 YLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENV 164
           Y+L EY   G L+D++       L E    K    +A  +  +H+    ++HRD+KIEN+
Sbjct: 283 YMLFEYVSGGQLLDYIIQ--HGSLREHHARKFARGIASALQYLHS--NNIVHRDLKIENI 338

Query: 165 LISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALP-VD 223
           +IS  G+ K+ DFG          N Y+     H      +  + APE++   +A P   
Sbjct: 339 MISTSGEIKIIDFGL--------SNLYDTTRQLHTFCG--SLYFAAPELL---KAHPYTG 385

Query: 224 EKSDIWALGVFLYKVCYFTTPFEK----VGENAILQAKFQFPSYPQYTDRLKNLISVMLS 279
            + D+W+ GV LY +     PF+     V    I Q K  +P +   +  + +L+S ML 
Sbjct: 386 PEVDVWSFGVVLYVLVCGKVPFDDENSSVLHEKIKQGKVDYPQH--LSIEVISLLSKMLV 443

Query: 280 EHPVQRPNICQVLEEVSRIQGVPCP----LPN 307
             P +R  + QV+E    ++G   P    LPN
Sbjct: 444 VDPKKRATLRQVVEHHWMVRGYDNPSSSYLPN 475

>NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_1.271
          Length = 1555

 Score = 78.6 bits (192), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 59/228 (25%), Positives = 104/228 (45%), Gaps = 34/228 (14%)

Query: 26   QYLTSGGFAQIYSCEVLSPGPIQGSLACLKRVHVPDKPS--------LNTLRAEVDAMKM 77
            + +  G F  +Y C  ++     G +  +K+V VP   S        ++ +++EV  +K 
Sbjct: 1258 EMIGKGSFGAVYLCLNVT----TGEMMAVKQVEVPKYSSQDEAIMSTVDAIKSEVSTLKD 1313

Query: 78   LKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIM 137
            L  H ++V Y+          D  Y ++L  EY   G +   +  R+  R  E  +  + 
Sbjct: 1314 L-DHLNIVQYLGFE-----NKDNIYSLFL--EYVAGGSVGSLI--RIYGRFDEPLIRHLN 1363

Query: 138  SHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQ 197
              V +G+  +HA    ++HRD+K +N+L+  DG  K+ DF    G+ R  K+ Y      
Sbjct: 1364 IQVLRGLAYLHAR--GILHRDMKADNLLLDQDGVCKISDF----GISRKSKDIYS----N 1413

Query: 198  HDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYFTTPF 245
             D+    T  + APEM+D  +      K DIW+LG  + ++     P+
Sbjct: 1414 SDMTMRGTVFWMAPEMVDTKQGYSA--KVDIWSLGCIVLEMFAGKRPW 1459

>Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}
            complement(18696..23039) [4344 nt, 1448 aa]
          Length = 1447

 Score = 78.2 bits (191), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 73/283 (25%), Positives = 125/283 (44%), Gaps = 42/283 (14%)

Query: 26   QYLTSGGFAQIYSCEVLSPGPIQGSLACLKRVHVP-----DKPSLNT---LRAEVDAMKM 77
            + +  G F  ++    L+     G +  +K+V VP     ++  +NT   LR EV  +K 
Sbjct: 1144 EMIGKGSFGAVF----LAMNITTGEMMAVKQVEVPKYGLQNETVVNTVDALRLEVSTLKD 1199

Query: 78   LKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIM 137
            L  H ++V Y+   A      +G Y ++L  EY   G +   +  R+  R  +  +  + 
Sbjct: 1200 L-DHLNIVQYLGFEA-----KNGIYSLFL--EYVAGGSVGSLI--RMYGRFDDILIRHLT 1249

Query: 138  SHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQ 197
              V QG+  +H+    ++HRD+K +N+L+  DG  K+ DF    G+ R   + Y      
Sbjct: 1250 IQVLQGLSYLHSR--GILHRDMKADNLLLDQDGVCKISDF----GISRKSNDIYS----N 1299

Query: 198  HDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYFTTP---FEKVGEN-AI 253
             ++    T  + APEM+D  +      K DIW+LG  + ++     P   FE V     I
Sbjct: 1300 SEMTMKGTVFWMAPEMVDTKQGYSA--KVDIWSLGCIVLEMFAGKRPWSNFEVVAAMFKI 1357

Query: 254  LQAKFQFP----SYPQYTDRLKNLISVMLSEHPVQRPNICQVL 292
             QAK   P    + P  ++  K  +       P +RP   ++L
Sbjct: 1358 GQAKSAPPIPEDTLPLISENAKEFLDCCFEIDPEKRPTADKLL 1400

>TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON}
           Anc_8.279 YLR096W
          Length = 1218

 Score = 78.2 bits (191), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 59/209 (28%), Positives = 97/209 (46%), Gaps = 24/209 (11%)

Query: 105 YLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENV 164
           Y+L EY   G L+D++       L E    K    +A  +  +H     ++HRD+KIEN+
Sbjct: 254 YMLFEYVSGGQLLDYIIQ--HGSLREHHARKFTRGIASALQYLHG--NNIVHRDLKIENI 309

Query: 165 LISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALP-VD 223
           +IS  GD K+ DFG +S +    K    F           +  + APE++   +A P V 
Sbjct: 310 MISTSGDIKIIDFG-LSNLYDSKKQLNTF---------CGSLYFAAPELL---KANPYVG 356

Query: 224 EKSDIWALGVFLYKVCYFTTPFEK----VGENAILQAKFQFPSYPQYTDRLKNLISVMLS 279
            + DIW+ GV LY +     PF+     V    I Q K  +P +   +  + +L+S ML 
Sbjct: 357 PEVDIWSFGVVLYVLACGKVPFDDENSSVLHEKIKQGKVDYPQH--LSIEVISLLSKMLV 414

Query: 280 EHPVQRPNICQVLEEVSRIQGVPCPLPNF 308
             P +R ++ Q++      +G     P++
Sbjct: 415 VDPKKRASLQQIVNHPWMTRGFDTKAPSY 443

>ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]
           {ON} similar to uniprot|P08458 Saccharomyces cerevisiae
           YDR523C SPS1 dispensable for mitosis involved in
           middle/late stage of meiosis required for spore wall
           formation serine/threonine kinase homologous to Ste20p
           expressed in middle/late meiosis
          Length = 471

 Score = 77.0 bits (188), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 73/282 (25%), Positives = 128/282 (45%), Gaps = 45/282 (15%)

Query: 24  IIQYLTSGGFAQIY-SCEVLSPGPIQGSLACLKRVHVP-DKPSLNTLRAEVDAMKMLKGH 81
           I Q +  G F  +Y +C+      ++G +  +K V++   +  ++ L  E+  +  L+  
Sbjct: 17  IQQCVGRGNFGDVYKACD-----KVEGKVVAVKVVNLEHSEEDIDLLAQEIFFLAELRS- 70

Query: 82  RHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVA 141
             + +YI +             ++++MEYC  G   D +       + E +V  I S V 
Sbjct: 71  PFITNYITTLTEDV-------SMWIVMEYCGGGSCADLIKHIYINGMPEKKVAFITSQVL 123

Query: 142 QGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDIL 201
           +G++ +H      IHRDIK  N+L++ +G  K+ DFG VSG IR       F        
Sbjct: 124 RGLVYLHE--QKKIHRDIKAANILLTDEGTVKLGDFG-VSGQIRATLKRGTF-------- 172

Query: 202 KNTTAQYRAPEMI----DLYRALPVDEKSDIWALGVFLYKVCYFTTPFEKVGENAILQAK 257
              T  + APE++    D Y     DEK+DIW+LG+ +Y++     P  K      ++  
Sbjct: 173 -VGTPYWMAPEVVSKENDGY-----DEKADIWSLGITVYELLKGAPPLSKCDP---MKVM 223

Query: 258 FQFPS------YPQYTDRLKNLISVMLSEHPVQRPNICQVLE 293
              P       +  Y+   KN +S  L ++PV R +  +++E
Sbjct: 224 INLPKRKPPALHGHYSHSAKNFVSSCLVKNPVGRASAYEMVE 265

>KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON}
           similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1104

 Score = 78.2 bits (191), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 62/214 (28%), Positives = 105/214 (49%), Gaps = 24/214 (11%)

Query: 105 YLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENV 164
           Y+L EY   G L+D++       L E    K +  +A  +  +H  +  ++HRD+KIEN+
Sbjct: 198 YMLFEYVSGGQLLDYIIQ--HGSLRERHARKFVRGIASALQYLH--LNNIVHRDLKIENI 253

Query: 165 LISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALP-VD 223
           +IS  G+ K+ DFG +S +    K  + F           +  + APE++   +A P + 
Sbjct: 254 MISTSGEIKIIDFG-LSNLYDNKKQLHTF---------CGSLYFAAPELL---KANPYIG 300

Query: 224 EKSDIWALGVFLYKVCYFTTPFEKVGENA-ILQAKFQFP--SYPQYTD-RLKNLISVMLS 279
            + DIW+ GV +Y +     PF+   ENA +L  K +     YPQ+      +L+S ML 
Sbjct: 301 PEVDIWSFGVVIYVLVCGKVPFD--DENASVLHEKIKKGKVEYPQHLSIECISLLSKMLV 358

Query: 280 EHPVQRPNICQVLEEVSRIQGVPCPLPNFYLERM 313
             P++R ++ QV       +G   P P++   R+
Sbjct: 359 VDPLKRASLKQVCNHQWMQRGFDFPPPSYIPHRV 392

>Skud_5.249 Chr5 complement(400867..404310) [3444 bp, 1147 aa] {ON}
           YER129W (REAL)
          Length = 1147

 Score = 78.2 bits (191), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 80/316 (25%), Positives = 130/316 (41%), Gaps = 72/316 (22%)

Query: 14  ILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGPIQGSLACLKRVHVPDKPSLNTLRAEVD 73
           I  V  HE K  ++     F  I S ++     I+  +A +K+ H               
Sbjct: 161 IKIVDRHEKKQRKF-----FTFIKSSKISENDKIKREIAIMKKCH--------------- 200

Query: 74  AMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLI----DFMNSRLQ--TR 127
                  H+HVV  I+       R     ++YL++EYC RG +     D + S  +  + 
Sbjct: 201 -------HKHVVQLIEVLDDLKSR-----KIYLVLEYCSRGEVKWCPPDCLESDAKGPSL 248

Query: 128 LSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPP 187
           LS  E  +I+  V  G+  +H     +IHRDIK  N+LIS DG  K+ DFG         
Sbjct: 249 LSFQETREILRGVVLGLEYLH--YQGIIHRDIKPANLLISEDGTVKISDFGVSLAASSTN 306

Query: 188 KNAYEFNYVQHDILKNT-TAQYRAPEMI--------------DLYRALPVDEKSDIWALG 232
            +    +  + ++ K   T  + APEM               +L+R   +    DIWA+G
Sbjct: 307 SSDSSESLNELELAKTVGTPAFFAPEMCLGEDAFTKYNLTKDNLFRGSCISFMIDIWAVG 366

Query: 233 VFLYKVCY----FTTPFEKVGENAILQAKFQFPSYPQYTDR-------------LKNLIS 275
           V LY + +    F + FE      I+    +FP+Y +                  K+L+S
Sbjct: 367 VTLYCLLFGMLPFFSDFELKLFEKIVDDPLKFPTYEEMQSNNVSKISCEEEYQMAKDLLS 426

Query: 276 VMLSEHPVQRPNICQV 291
            +L ++P +R  I ++
Sbjct: 427 KLLEKNPQKRMTIPEI 442

>Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C
           (REAL)
          Length = 974

 Score = 77.8 bits (190), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 68/245 (27%), Positives = 113/245 (46%), Gaps = 28/245 (11%)

Query: 51  LACLKRVHVPDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEY 110
           +  +K +       LN + AE+  +K L  H ++V Y   H         +YE+Y+L+EY
Sbjct: 50  VVAIKEIVYESDEELNDIMAEISLLKNL-NHDNIVKY---HGFIRK----SYELYILLEY 101

Query: 111 CLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDG 170
           C  G L   + SR  T LSE E    ++    G+  +H     +IHRDIK  N+L+S D 
Sbjct: 102 CANGSLRRLI-SRSSTGLSENESKSYVTQTLLGLKYLHG--EGVIHRDIKAANILLSADN 158

Query: 171 DFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWA 230
             K+ DFG VS ++               +    T  + APE++    A  +   SDIW+
Sbjct: 159 TVKLADFG-VSTIVNSSA-----------LTLAGTLNWMAPEILGNRGASTL---SDIWS 203

Query: 231 LGVFLYKVCYFTTPFEKVGENAILQAKFQFPSYP--QYTDRLKNLISVMLSEHPVQRPNI 288
           LG  + ++     P+  + +  I  A      YP   +++ LK+ +S    ++  +RP  
Sbjct: 204 LGATVVEMLTKNPPYHNLTDANIYYAVENDTYYPPSSFSESLKDFLSKCFVKNMYKRPTA 263

Query: 289 CQVLE 293
            Q+L+
Sbjct: 264 DQLLK 268

>ZYRO0C15862g Chr3 (1239992..1241305) [1314 bp, 437 aa] {ON} similar
           to uniprot|P41808 Saccharomyces cerevisiae YPR054W SMK1
           Mitogen-activated protein kinase required for spore
           morphogenesis that is expressed as a middle
           sporulation-specific gene
          Length = 437

 Score = 76.6 bits (187), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 56/169 (33%), Positives = 84/169 (49%), Gaps = 20/169 (11%)

Query: 71  EVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTRLSE 130
           E+  M   KGH+++VS I+        +DG Y    L++Y     L   ++S +Q  LSE
Sbjct: 122 ELKFMNYFKGHKNIVSLINLEIVTEKPYDGVYCYQELIDY----DLAKVIHSSVQ--LSE 175

Query: 131 FEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGV---IRPP 187
           F V      +  G+  +H+    +IHRD+K  N+L S +G  K+CDFG   GV       
Sbjct: 176 FHVKHFFYQILCGLKYIHS--ADVIHRDLKPGNILCSLNGCLKICDFGLARGVAPQYFTT 233

Query: 188 KNAYEFNYVQHDILKNT-TAQYRAPEMIDLYRALPVDEKSDIWALGVFL 235
           K +Y      HDI     T  YRAPE+I  ++A    +  D+W++G  L
Sbjct: 234 KESY------HDITNYVATRWYRAPELILSHKAY--SKAIDMWSVGCIL 274

>TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {ON}
            Anc_1.271 YJL095W
          Length = 1643

 Score = 78.2 bits (191), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 70/289 (24%), Positives = 127/289 (43%), Gaps = 48/289 (16%)

Query: 26   QYLTSGGFAQIYSCEVLSPGPIQGSLACLKRVHVPDKPSLN--------TLRAEVDAMKM 77
            + +  G F  +Y    LS     G +  +K+V VP+  S N         LR+EV  +K 
Sbjct: 1342 ELIGKGSFGSVY----LSLNVTTGEMMAVKQVEVPEFGSQNEAIVSTVEALRSEVTLLKD 1397

Query: 78   LKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIM 137
            L  H ++V Y+        + +  Y ++L  EY   G +   +  R+  R  E  +    
Sbjct: 1398 L-DHINIVQYLGFE-----KKNNIYSLFL--EYVAGGSIGSLI--RMYGRFDESLIRHST 1447

Query: 138  SHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQ 197
            + +  G+  +H+    ++HRD+K +N+L+ G+G  K+ DF    G+ R  K+ Y      
Sbjct: 1448 TQILAGLSYLHS--KGILHRDMKADNILLDGEGICKISDF----GISRKSKDIYS----N 1497

Query: 198  HDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYFTTPFEKVGENAILQAK 257
             ++    T  + APEM+D  +      K DIW+LG  + ++     P+  +    ++ A 
Sbjct: 1498 SEMTMRGTVFWMAPEMVDTKQGYSA--KVDIWSLGCIILEMFAGKRPWSNL---EVVAAM 1552

Query: 258  FQF------PSYPQYTDRL-----KNLISVMLSEHPVQRPNICQVLEEV 295
            F+       P  P+ T  L     ++ +       P +RP   Q+L+ +
Sbjct: 1553 FKIGQSKSAPPIPEDTLPLISQDGRDFLDDCFKIDPEKRPTAEQMLDHL 1601

>Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095W
            (BCK1) - MEKK serine/threonine kinase [contig 48] FULL
          Length = 1446

 Score = 77.8 bits (190), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 68/286 (23%), Positives = 121/286 (42%), Gaps = 48/286 (16%)

Query: 26   QYLTSGGFAQIYSCEVLSPGPIQGSLACLKRVHVPDKPS--------LNTLRAEVDAMKM 77
            + +  G F  ++    L      G +  +K+V VP   S        L  LR+EV  +K 
Sbjct: 1150 EMIGKGSFGSVF----LGLNVTTGEMIAVKQVEVPRYGSQDETTLSVLEALRSEVATLKD 1205

Query: 78   LKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIM 137
            L  H ++V Y+          +  Y   L +EY   G +   +  RL  +  E  +  + 
Sbjct: 1206 LD-HTNIVQYLGFE-------NKNYVYSLFLEYVAGGSVGSLI--RLYGKFDENLIRFLA 1255

Query: 138  SHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQ 197
              V +G+  +H+    ++HRD+K +N+L+  DG  K+ DF    G+ +   N Y      
Sbjct: 1256 VQVLRGLSYLHS--KKILHRDMKADNLLLDVDGICKISDF----GISKKSNNIYS----N 1305

Query: 198  HDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYFTTPFEKVGENAILQAK 257
             D+    T  + APEM+D  +      K DIW+LG  + ++     P+  +    ++ A 
Sbjct: 1306 SDMTMRGTVFWMAPEMVDTKQGYSA--KVDIWSLGCVVLEMFAGKRPWSNL---EVVAAM 1360

Query: 258  FQF------PSYPQYTDRL-----KNLISVMLSEHPVQRPNICQVL 292
            F+       P  P+ T ++     K  +      +P +RP   ++L
Sbjct: 1361 FKIGKFKSAPPIPEDTQKIISAEGKEFLDACFEINPEKRPTADELL 1406

>TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {ON}
           Anc_2.496 YHL007C
          Length = 915

 Score = 77.8 bits (190), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 50/193 (25%), Positives = 100/193 (51%), Gaps = 25/193 (12%)

Query: 53  CLKRVHVPDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCL 112
            +K++++  +P    +  E+  MK  K H+++V++IDS+  K        +++++MEY  
Sbjct: 650 AIKQMNLEKQPKKELIINEILVMKGSK-HQNIVNFIDSYVLKG-------DLWVVMEYME 701

Query: 113 RGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDF 172
            G L D +   +   L+E ++  +     +G+  +H+    +IHRDIK +N+L+S +G+ 
Sbjct: 702 GGSLTDVVTHCI---LTEAQIGAVCRETLRGLQFLHS--KGVIHRDIKSDNILLSMNGEI 756

Query: 173 KVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALG 232
           K+ DFG  + +        E N  +  ++   T  + APE++      P   K DIW+LG
Sbjct: 757 KLTDFGFCAQI-------NEINLKRTTMVG--TPYWMAPEVVSRKEYGP---KVDIWSLG 804

Query: 233 VFLYKVCYFTTPF 245
           + + ++     P+
Sbjct: 805 IMIIEMIEGEPPY 817

>CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]
           {ON} similar to uniprot|Q12263 Saccharomyces cerevisiae
           YDR507c GIN4
          Length = 1103

 Score = 77.8 bits (190), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 61/236 (25%), Positives = 109/236 (46%), Gaps = 38/236 (16%)

Query: 68  LRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTR 127
           +  E+  MK+L  H +V+   D     S       ++YL++EY  +G L + +  R    
Sbjct: 76  IEQEIIIMKLL-NHPNVLRLFDVWETNS-------DLYLVLEYAEKGELFNMLVER--GP 125

Query: 128 LSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPP 187
           L E E ++    +  GI   H+L   ++HRD+K EN+L+    + K+ DFG  +      
Sbjct: 126 LPENEAVRAFRQIIIGISYCHSL--GVVHRDLKPENLLLDNKLNIKIADFGMAA------ 177

Query: 188 KNAYEFNYVQHDILKNTTA---QYRAPEMIDLYRALPVDE-KSDIWALGVFLYKVCYFTT 243
                      D L  T+     Y APE+I     LP +   SD+W+ GV L+ +     
Sbjct: 178 -------LESEDKLLETSCGSPHYAAPEIIS---GLPYEGFSSDVWSCGVILFALLTGRL 227

Query: 244 PFEKVGEN------AILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLE 293
           PF++   N       + + +F+ P   + T   ++L++ +L+  P +R  I ++L+
Sbjct: 228 PFDEEDGNIRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILK 283

>TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.496
           YHL007C
          Length = 973

 Score = 77.4 bits (189), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 61/228 (26%), Positives = 109/228 (47%), Gaps = 40/228 (17%)

Query: 22  VKIIQYLTSGGFAQIYSCEVLSPGPIQGSLACLKRVHVPDKPSLNTLRAEVDAMKMLKGH 81
           VKI Q  + G F    S +       +  L  +K++++  +P    +  E+  MK  + H
Sbjct: 681 VKIGQGASGGVFTAHDSRD-------ENRLVAIKQMNLQKQPKKELIINEIIVMKGSR-H 732

Query: 82  RHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVA 141
            ++V++IDS+  K        +++++MEY   G L D +   +   L+E ++  +     
Sbjct: 733 ENIVNFIDSYLMKG-------DLWVVMEYMEGGSLTDVVTHCI---LTEGQIGTVCKETL 782

Query: 142 QGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDIL 201
            G+  +H+    +IHRDIK +N+L+S +GD K+ DFG  +          + N V    L
Sbjct: 783 GGLAFLHS--KGVIHRDIKSDNILLSMNGDIKLTDFGFCA----------QINEVH---L 827

Query: 202 KNTTA----QYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYFTTPF 245
           K TT      + APE++      P   K DIW+LG+ + ++     P+
Sbjct: 828 KRTTMVGTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 872

>TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {ON}
           Anc_1.24 YDR523C
          Length = 482

 Score = 76.6 bits (187), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 58/196 (29%), Positives = 94/196 (47%), Gaps = 22/196 (11%)

Query: 104 VYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIEN 163
           ++++MEYC  G   D +       + E +V  I+    +G+  +H      IHRDIK  N
Sbjct: 86  MWIVMEYCGGGSCADLIKMVYSKGIPESKVSYILRDTVKGLKYLHD--QKKIHRDIKAAN 143

Query: 164 VLISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVD 223
           +L++  G  K+ DFG VSG IR       F           T  + APE+I+  +    +
Sbjct: 144 ILLTDCGKVKLGDFG-VSGQIRATMKRGTF---------VGTPYWMAPEVIN-KQCKGYN 192

Query: 224 EKSDIWALGVFLYKVCYFTTPFEKVGENAILQAKFQFPS------YPQYTDRLKNLISVM 277
           EK+DIW+LG+  Y++     P  K     ++      P       + QY+++ K  +S+ 
Sbjct: 193 EKADIWSLGITAYELLKGVPPLSKYDPFKVM---LNIPKRKPPKLHGQYSEKAKYFVSLC 249

Query: 278 LSEHPVQRPNICQVLE 293
           L + P QRP+I  +LE
Sbjct: 250 LIKDPKQRPSIEALLE 265

>NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa]
           {ON} Anc_1.24
          Length = 489

 Score = 76.6 bits (187), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 57/194 (29%), Positives = 94/194 (48%), Gaps = 16/194 (8%)

Query: 104 VYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIEN 163
           ++++MEYC  G   D +       L E +V  I  +V +G+  +H      IHRD+K  N
Sbjct: 92  MWIVMEYCGGGSCSDLIRYHYNEGLHEDKVAFITKNVLRGLQYLHE--QRKIHRDVKAAN 149

Query: 164 VLISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVD 223
           VL++ DG  K+ DFG VSG +R       F           T  + APE+I    +   +
Sbjct: 150 VLLTDDGLVKLADFG-VSGQLRSTAKRNTF---------VGTPYWMAPEIIS-NSSHGYN 198

Query: 224 EKSDIWALGVFLYKVCYFTTPFEKVGENAILQ---AKFQFPSYPQYTDRLKNLISVMLSE 280
           EK+DIW+LG+ +Y++     P+ K     +++    K        ++D  K  IS  L +
Sbjct: 199 EKADIWSLGITVYELLKGCPPYAKYDAGKVMRNIPKKNLQDCMVSFSDAAKLFISACLIK 258

Query: 281 HPVQRPNICQVLEE 294
            P +RP   ++L++
Sbjct: 259 DPDERPTATELLQQ 272

>NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {ON}
           Anc_8.668
          Length = 896

 Score = 77.4 bits (189), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 57/202 (28%), Positives = 97/202 (48%), Gaps = 35/202 (17%)

Query: 103 EVYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIE 162
           +V++ +EYC    L D + S    R+   E +++ + +  G+   H+L    +HRD+K+E
Sbjct: 103 KVWMALEYCPGKELYDRVLS--MHRVPTDECVQLFAQIVGGVHYAHSL--NCVHRDLKLE 158

Query: 163 NVLISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNT------TAQYRAPEMIDL 216
           N+L+   GD K+ DFG                + +  + K T      T  Y APE+I+ 
Sbjct: 159 NILLDKSGDAKLTDFG----------------FTRECMTKTTLETICGTTVYMAPELIER 202

Query: 217 --YRALPVDEKSDIWALGVFLYKVCYFTTPFEKVGENAI-LQAKFQFPSYPQ--YTDRLK 271
             Y    +    DIW+LGV LY +   + PF++  E     +   Q P   +   T   K
Sbjct: 203 KSYDGFKI----DIWSLGVILYTMINGSMPFDEDDETKTEWKIVHQTPQLNENIVTADAK 258

Query: 272 NLISVMLSEHPVQRPNICQVLE 293
           +LI  +L+++P  RP + Q+L+
Sbjct: 259 DLILRLLAKNPNDRPTVEQILK 280

>NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]
           {ON} Anc_3.92
          Length = 1113

 Score = 77.4 bits (189), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 66/286 (23%), Positives = 126/286 (44%), Gaps = 27/286 (9%)

Query: 14  ILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGPIQGSLACLKRVHVPDKPSLNTLRAEVD 73
           ++  G  + K  + +  G ++ +     +  G  + ++  L + ++  +  +  +  E  
Sbjct: 162 VIKKGIKDFKFGEMIGDGAYSTVLLATSIDSGK-KYAVKVLNKEYLIRQKKVKYVNIEKI 220

Query: 74  AMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTRLSEFEV 133
           A++ L   R ++    +   ++        +Y L+EY   G  +  M  +    L+E   
Sbjct: 221 ALQRLNNSRSIIRLFFTFQDEA-------SLYFLLEYAPNGDFLSVM--KKYGSLNEECA 271

Query: 134 LKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKNAYEF 193
               + +   I  MH     +IHRDIK EN+L+  D   K+ DFG+ + ++    N    
Sbjct: 272 CYYGAQILDAIGFMHTR--GIIHRDIKPENILMDKDMKVKITDFGT-AKILDEKTNGN-- 326

Query: 194 NYVQHDILKNT-----TAQYRAPEMI-DLYRALPVDEKSDIWALGVFLYKVCYFTTPFEK 247
           N   +++L  +     TA+Y +PE++ D Y     D + DIWA G  LY++     PF+ 
Sbjct: 327 NKTSYELLTRSKSFVGTAEYVSPELLNDNYS----DSRCDIWAFGCILYQMIAGKPPFKA 382

Query: 248 VGENAILQA--KFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQV 291
             E    Q   K Q+     +   +++LI  +L + P QR  I Q+
Sbjct: 383 TNEYLTFQKVMKVQYAFTAGFPTIIRDLIKRILLKVPEQRLTIGQI 428

>KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1.271
            YJL095W
          Length = 1398

 Score = 77.8 bits (190), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 59/228 (25%), Positives = 102/228 (44%), Gaps = 34/228 (14%)

Query: 26   QYLTSGGFAQIYSCEVLSPGPIQGSLACLKRVHVPDKPS--------LNTLRAEVDAMKM 77
            + +  G F  +Y C  ++     G +  +K+V VP   S        +  LR+EV  +K 
Sbjct: 1100 EMIGKGSFGAVYLCLNVT----TGEMMAVKQVEVPKYSSQDENIISTVEALRSEVSTLKD 1155

Query: 78   LKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIM 137
            L  H ++V Y+          D  Y ++L  EY   G +   +  R+  R  E  +  + 
Sbjct: 1156 L-DHLNIVQYLGFE-----NKDNIYSLFL--EYVAGGSVGSLI--RMYGRFDEAMIRHLT 1205

Query: 138  SHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQ 197
              V +G+  +H+    ++HRD+K +N+L+  DG  K+ DF    G+ R   + Y      
Sbjct: 1206 IQVLRGLSYLHSR--GILHRDMKADNLLLDQDGVCKISDF----GISRKSNDIYS----N 1255

Query: 198  HDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYFTTPF 245
             D+    T  + APEM+D  +      K DIW+LG  + ++     P+
Sbjct: 1256 SDMTMRGTVFWMAPEMVDTKQGYSA--KVDIWSLGCVVLEMFAGKRPW 1301

>Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON}
           YHL007C (REAL)
          Length = 923

 Score = 77.4 bits (189), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 50/193 (25%), Positives = 98/193 (50%), Gaps = 25/193 (12%)

Query: 53  CLKRVHVPDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCL 112
            +K++++  +P    +  E+  MK  K H ++V++IDS+  K        +++++MEY  
Sbjct: 626 AIKQMNLEKQPKKELIINEILVMKGSK-HPNIVNFIDSYVLKG-------DLWVIMEYME 677

Query: 113 RGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDF 172
            G L D +   +   L+E ++  +      G+  +H+    ++HRDIK +N+L+S +GD 
Sbjct: 678 GGSLTDVVTHCI---LTEGQIGAVCRETLSGLKFLHSKG--VLHRDIKSDNILLSMEGDI 732

Query: 173 KVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALG 232
           K+ DFG  + +        E N  +  ++   T  + APE++      P   K DIW+LG
Sbjct: 733 KLTDFGFCAQI-------NELNLKRTTMVG--TPYWMAPEVVSRKEYGP---KVDIWSLG 780

Query: 233 VFLYKVCYFTTPF 245
           + + ++     P+
Sbjct: 781 IMIIEMIEGEPPY 793

>KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.496
           YHL007C
          Length = 798

 Score = 77.0 bits (188), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 60/226 (26%), Positives = 106/226 (46%), Gaps = 36/226 (15%)

Query: 26  QYLTSGGFAQIYSCEVLSPGPIQGS-LACLKRVHVPDKPSLNTLRAEVDAMKMLKGHRHV 84
           QY       Q  S  V +   ++ + L  +K++ +  +P    +  E+  MK  + H +V
Sbjct: 516 QYANLTKIGQGASGGVYTANQVKSNELVAIKQMDLEKQPKKELILNEIIVMKESR-HNNV 574

Query: 85  VSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGI 144
           V++I++H +K         ++++MEY   G L D +   L   LSE ++  +     +G+
Sbjct: 575 VNFINAHLSKG-------NLWIVMEYMEGGSLTDVVTHCL---LSEGQIGAVCRETLEGL 624

Query: 145 MAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNT 204
             +H+    +IHRDIK +NVL+S  GD K+ DFG  + +              +DI  N 
Sbjct: 625 KFLHS--KGVIHRDIKSDNVLLSMKGDIKLTDFGFCAQI--------------NDIDLNR 668

Query: 205 TAQ-----YRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYFTTPF 245
           T       + APE++      P   K DIW+LG+ + ++     P+
Sbjct: 669 TTMVGTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 711

>KNAG0D00210 Chr4 complement(22721..25222) [2502 bp, 833 aa] {ON}
           Anc_6.371 YCR091W
          Length = 833

 Score = 77.0 bits (188), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 57/200 (28%), Positives = 92/200 (46%), Gaps = 25/200 (12%)

Query: 104 VYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIEN 163
           VYL MEYC+ G     + +R    +SE +     S V   +  +H L    I+RD+K EN
Sbjct: 509 VYLCMEYCMGGEFFRALQTRKAKSISEDDARFYASEVTAALEYLHLL--GFIYRDLKPEN 566

Query: 164 VLISGDGDFKVCDFG---SVSGVIRPPKN-AYEFNYVQHDILKN--------TTAQYRAP 211
           +L+   G   + DF      +   +P K  A + + V   +            T +Y AP
Sbjct: 567 ILLHKSGHIMLSDFDLSVQANDAAKPVKRVATQSSMVDTKVFSEGFRTNSFVGTEEYIAP 626

Query: 212 EMIDLYRALPVDEKSDIWALGVFLYKVCYFTTPFEKVGENA------ILQAKFQFPSYPQ 265
           E+I   R        D W LG+ +Y++ +  TPF+  GEN       IL+ +  FP + +
Sbjct: 627 EVI---RGNGHTAAVDWWTLGILIYEMLFGCTPFK--GENTNETFCNILKNEVTFPEHHE 681

Query: 266 YTDRLKNLISVMLSEHPVQR 285
            +   K+LI  +LS++  +R
Sbjct: 682 ISRHCKDLIRKLLSKNESKR 701

>Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON}
           YHL007C (REAL)
          Length = 939

 Score = 77.0 bits (188), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 47/176 (26%), Positives = 91/176 (51%), Gaps = 26/176 (14%)

Query: 72  VDAMKMLKGHRH--VVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTRLS 129
           ++ + ++KG RH  +V++IDS+  K        +++++MEY   G L D +   +   L+
Sbjct: 665 INEILVMKGSRHPNIVNFIDSYVLKG-------DLWVIMEYMEGGSLTDVVTHCI---LT 714

Query: 130 EFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKN 189
           E ++  +      G+  +H+    ++HRDIK +N+L+S +GD K+ DFG  + +      
Sbjct: 715 EGQIGAVCRETLSGLKFLHSKG--VLHRDIKSDNILLSMEGDIKLTDFGFCAQI------ 766

Query: 190 AYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYFTTPF 245
             E N  +  ++   T  + APE++      P   K DIW+LG+ + ++     P+
Sbjct: 767 -NELNLKRTTMVG--TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 816

>Kpol_376.5 s376 (6334..7767) [1434 bp, 477 aa] {ON} (6334..7767)
           [1434 nt, 478 aa]
          Length = 477

 Score = 76.3 bits (186), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 54/166 (32%), Positives = 86/166 (51%), Gaps = 14/166 (8%)

Query: 71  EVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTRLSE 130
           E+  +   +GH+++VS ID        +DG Y    L++Y     L   ++S +Q  L++
Sbjct: 161 ELKFINYFRGHKNIVSLIDIELVTEKPYDGLYCYQELIDY----DLAKVIHSSVQ--LTD 214

Query: 131 FEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKNA 190
           F +      +  GI  +H+    +IHRD+K  N+L + +G  K+CDFG   GV   PK  
Sbjct: 215 FHIRHFFYQILCGIKYIHS--ADVIHRDLKPGNILCTLNGTLKICDFGLARGV--APK-Y 269

Query: 191 YEFNYVQHDILKNT-TAQYRAPEMIDLYRALPVDEKSDIWALGVFL 235
           +  N  +HDI     T  YRAPE+I L + +  D+  D+W+ G  L
Sbjct: 270 FAANQSRHDITNYVATRWYRAPELI-LSQKM-YDKSIDMWSAGCIL 313

>TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa]
           {ON} Anc_8.668 YPL150W
          Length = 861

 Score = 77.0 bits (188), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 56/198 (28%), Positives = 99/198 (50%), Gaps = 29/198 (14%)

Query: 103 EVYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIE 162
           +V++ +EYC    L + + +    R+S  E  ++ + +   I   H+L    +HRD+K+E
Sbjct: 102 KVWMALEYCPGKELYEHLLA--LKRISLDECSRLFAQIVGAIYYAHSL--NCVHRDLKLE 157

Query: 163 NVLISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDL--YRAL 220
           N+L+   G+ K+ DFG     +            Q D +  TT  Y APE+ +   Y   
Sbjct: 158 NILLDKKGNAKLTDFGFTRECVSKS---------QLDTICGTTV-YMAPELTERKSYDGF 207

Query: 221 PVDEKSDIWALGVFLYKVCYFTTPFEKVGENAILQAKFQFPS-YPQYTDRL-----KNLI 274
            +    DIWALGV LY +   + PF+   E+   + K++  +  P+  + L     K+LI
Sbjct: 208 KI----DIWALGVILYTMINGSMPFD---EDDEAKTKWKIVNEMPEINEDLVSPDAKDLI 260

Query: 275 SVMLSEHPVQRPNICQVL 292
             +L++ P +RP+I ++L
Sbjct: 261 EQLLAKDPNERPSIEKIL 278

>TDEL0D01400 Chr4 (269367..273656) [4290 bp, 1429 aa] {ON} Anc_1.271
            YJL095W
          Length = 1429

 Score = 77.4 bits (189), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 59/243 (24%), Positives = 109/243 (44%), Gaps = 37/243 (15%)

Query: 26   QYLTSGGFAQIYSCEVLSPGPIQGSLACLKRVHVPDKPSLN--------TLRAEVDAMKM 77
            + +  G F  +Y C  ++     G +  +K+V VP   S N         LRAE+  +K 
Sbjct: 1128 EMIGKGSFGAVYLCLNVT----TGEMMAVKQVEVPKYGSQNEQIIHTVEALRAEMSTLKN 1183

Query: 78   LKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIM 137
            L  H ++V Y+   A         +   L +EY   G +   +  R+  R  E  +  + 
Sbjct: 1184 LD-HLNIVQYLGFEAKD-------HMNSLFLEYVAGGSVGSLI--RMYGRFDEVMIKHLT 1233

Query: 138  SHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQ 197
            + V +G+  +H+    ++HRD+K +N+L+  +G  K+ DF    G+ R  K+ Y      
Sbjct: 1234 TQVLRGLSYLHSR--GILHRDMKADNLLLDQEGVCKISDF----GISRKSKDIYS----N 1283

Query: 198  HDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYFTTPFEKVGENAILQAK 257
             ++    T  + APEM+D  +      K DIW++G  + ++     P+  +    ++ A 
Sbjct: 1284 SEMTMRGTVFWMAPEMVDTAQGYSA--KVDIWSMGCVVLEMFAGKRPWSNL---EVVAAM 1338

Query: 258  FQF 260
            F+ 
Sbjct: 1339 FKI 1341

>Kwal_27.12559 s27 (1273349..1274593) [1245 bp, 414 aa] {ON} YPR054W
           (SMK1) - MAP kinase [contig 260] FULL
          Length = 414

 Score = 75.9 bits (185), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 65/222 (29%), Positives = 105/222 (47%), Gaps = 17/222 (7%)

Query: 16  TVGSHEVKIIQYLTSGGFAQIYSCEVLSPGPIQGSLACLKRVHVPDKPSL--NTLRAEVD 73
           T G++E  IIQ L  G +  + S            LA  K  ++ ++  L    +R E+ 
Sbjct: 62  TPGNYE--IIQVLGKGSYGVVVSAIDKGEDGKPRRLAIKKVTNIFNREILLKRAIR-ELK 118

Query: 74  AMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTRLSEFEV 133
            +   KGH+++VS +D        +DG Y    L++Y     L   ++S +Q   SEF +
Sbjct: 119 FLNFFKGHKNIVSLVDLEIVSEKPYDGLYCYQELVDY----DLARVIHSTVQ--FSEFHI 172

Query: 134 LKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKNAYEF 193
              +  +  G+  +H+    +IHRD+K  N+L S  G+ K+CDFG   G+   P+   + 
Sbjct: 173 KHFLYQILCGLKYIHS--ADVIHRDLKPGNILCSIGGNLKICDFGLARGI--APQYFEQK 228

Query: 194 NYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFL 235
           +   H      T  YRAPE+I  +R     +  DIWA+G  L
Sbjct: 229 SDEIHITSYVATRWYRAPELILSHRRYT--KAIDIWAVGCIL 268

>KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} similar
           to uniprot|Q12236 YOL100W Saccharomyces cerevisiae
           YOL100W PKH2 Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis
          Length = 993

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 62/281 (22%), Positives = 126/281 (44%), Gaps = 20/281 (7%)

Query: 14  ILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGPIQGSLACLKRVHVPDKPSLNTLRAEVD 73
           ++  G  + K  + L  G ++ +     +  G  + ++  L + ++  +  +  +  E +
Sbjct: 155 VIKKGIKDFKFGEVLGDGSYSTVMLARSIDSGK-KYAVKVLNKEYLIRQKKVKYVNIEKN 213

Query: 74  AMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTRLSEFEV 133
            ++ L   R ++    +   ++        +Y L+EY   G  +  +  +    L++   
Sbjct: 214 TLQRLNDGRGIIKLYFTFQDEA-------SLYFLLEYAPNGDFLSVI--KKYGSLNQDCS 264

Query: 134 LKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKNAYEF 193
           +   + +   I  +H     +IHRDIK EN+L+  D   K+ DFG+   ++   +    +
Sbjct: 265 VYYSAQILDAIDYLHQ--KGVIHRDIKPENILLDKDMKVKLTDFGTAK-LVEKDETTQTY 321

Query: 194 NYVQHDILKNTTAQYRAPEMI-DLYRALPVDEKSDIWALGVFLYKVCYFTTPFEKVGENA 252
           N ++       TA+Y +PE++ D Y    VD K DIWA G  L+++     PF+   E  
Sbjct: 322 NLLERSKSFVGTAEYVSPELLNDNY----VDYKCDIWAFGCILFQMIAGKPPFKATNEYL 377

Query: 253 ILQA--KFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQV 291
             Q   K Q+     +   +++LI  +L ++P QR +  QV
Sbjct: 378 TFQKVMKVQYAFTAGFPLIIRDLIKQILVKNPEQRLDTLQV 418

>KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa]
           {ON} Anc_2.496 YHL007C
          Length = 836

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 62/251 (24%), Positives = 119/251 (47%), Gaps = 36/251 (14%)

Query: 52  ACLKRVHVPDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYC 111
             +K++++  +P    +  E+  MK  K H ++V++IDS   K        +++++ME+ 
Sbjct: 577 VAIKQMNLEKQPKKELIINEIIVMKDSK-HPNIVNFIDSFLLKG-------DLWVIMEFM 628

Query: 112 LRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGD 171
             G L D +   +   L+E ++  +     +G+  +H+    +IHRDIK +N+L+S  GD
Sbjct: 629 EGGSLTDVVTHCI---LTEGQIGTVCRETLRGLQFLHS--NGVIHRDIKSDNILLSMKGD 683

Query: 172 FKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNT---TAQYRAPEMIDLYRALPVDEKSDI 228
            K+ DFG  + +             +H++ + T   T  + APE++      P   K DI
Sbjct: 684 IKLTDFGFCAQI------------NEHNLKRTTMVGTPYWMAPEVVSRKEYGP---KVDI 728

Query: 229 WALGVFLYKVCYFTTPF--EKVGENAILQAKFQFPSYPQ---YTDRLKNLISVMLSEHPV 283
           W+LG+ + ++     P+  E       L A    P   +    +D L + +S  L  +P 
Sbjct: 729 WSLGIMIIEMIESEPPYLNETPLRALYLIATNGTPKLKEPELLSDVLNDFLSWCLKVNPD 788

Query: 284 QRPNICQVLEE 294
           +R +   +LE+
Sbjct: 789 ERASASTLLED 799

>CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa]
           {ON} similar to uniprot|Q03497 Saccharomyces cerevisiae
           YHL007c STE20 Serine/threonine-protein kinase
          Length = 915

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 52/197 (26%), Positives = 98/197 (49%), Gaps = 33/197 (16%)

Query: 53  CLKRVHVPDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCL 112
            +K++++  +P    +  E+  M+  K H ++V++IDS+ AK        +++++MEY  
Sbjct: 647 AIKQMNLEKQPKKELILNEILVMRESK-HSNIVNFIDSYLAKG-------DLWIVMEYME 698

Query: 113 RGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDF 172
            G L D +   L   LSE ++  +     +G+  +H+    ++HRDIK +N+L+S  G+ 
Sbjct: 699 GGSLTDVVTHCL---LSEGQIGAVCRETLKGLQFLHS--KGVLHRDIKSDNILLSLKGNI 753

Query: 173 KVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTA----QYRAPEMIDLYRALPVDEKSDI 228
           K+ DFG  +              +  + LK TT      + APE++      P   K DI
Sbjct: 754 KLTDFGFCA-------------QINENNLKRTTMVGTPYWMAPEVVSRKEYGP---KVDI 797

Query: 229 WALGVFLYKVCYFTTPF 245
           W+LG+ + ++     P+
Sbjct: 798 WSLGIMIIEMIEGEPPY 814

>Suva_2.666 Chr2 complement(1183839..1186133) [2295 bp, 764 aa] {ON}
           YDR490C (REAL)
          Length = 764

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 63/287 (21%), Positives = 125/287 (43%), Gaps = 27/287 (9%)

Query: 14  ILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGPIQGSLACLKRVHVPDKPSLNTLRAEVD 73
           ++ +G  + K  + L  G ++ +        G  + ++  L + ++  +  +  +  E  
Sbjct: 116 VVKMGIKDFKFGEQLGDGSYSSVVLATARDSGK-KYAVKVLSKEYLIRQKKVKYVTVEKL 174

Query: 74  AMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTRLSEFEV 133
           A++ L G + ++    +   ++        +Y L+EY   G  +  +  +    L+E   
Sbjct: 175 ALQKLNGTKGIIRLFFTFQDEA-------SLYFLLEYAPHGDFLALI--KKYGSLNEQCA 225

Query: 134 LKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKN---- 189
               S +   + ++H +   +IHRDIK EN+L+  D   K+ DFG+   +   P N    
Sbjct: 226 RYYASQIIDAVDSLHTI--GIIHRDIKPENILLDKDMKVKLTDFGTAKILPEEPSNDADG 283

Query: 190 --AYEFNYVQHDILKNTTAQYRAPEMI-DLYRALPVDEKSDIWALGVFLYKVCYFTTPFE 246
              ++ N      +   TA+Y +PE++ D Y     D + DIWA G  L+++     PF+
Sbjct: 284 KPCFDLNARSKSFV--GTAEYVSPELLNDSY----TDSRCDIWAFGCILFQMVAGKPPFK 337

Query: 247 KVGENAILQA--KFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQV 291
              E    Q   K Q+     +   +K+L+  +L + P  R  I Q+
Sbjct: 338 ASNEYLTFQKVMKIQYAFTAGFPQIIKDLVKKLLVKEPNDRLTIEQI 384

>TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.406
           YHR102W
          Length = 975

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 55/203 (27%), Positives = 98/203 (48%), Gaps = 26/203 (12%)

Query: 104 VYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIEN 163
           ++++MEYC  G +   +      ++ E  +  IM  +   +  +H     +IHRDIK  N
Sbjct: 114 LWIIMEYCAGGSVRTLLRP---GKIDEKYIAVIMRELLVALHYIHK--DNVIHRDIKAAN 168

Query: 164 VLISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTA---QYRAPEMIDLYRAL 220
           +LI+ +G+ K+CDFG           A + N  Q+ + + T A    + APE+I     +
Sbjct: 169 LLITNEGNVKLCDFGV----------AAQLN--QNTMRRQTMAGTPYWMAPEVI--MEGI 214

Query: 221 PVDEKSDIWALGVFLYKVCYFTTPFEKV----GENAILQAKFQFPSYPQYTDRLKNLISV 276
             D K+DIW++G+  Y++     PF ++        I ++K        +   LK  I++
Sbjct: 215 SYDTKADIWSVGITAYEIATGNPPFCEMEALRAMQVISKSKPARLEGKNHDPLLKEFIAM 274

Query: 277 MLSEHPVQRPNICQVLEEVSRIQ 299
            L E P +RP   ++L E + I+
Sbjct: 275 CLDEDPQERPTADKLLHESAFIK 297

>Smik_7.92 Chr7 (155049..157742) [2694 bp, 897 aa] {ON} YGL180W
           (REAL)
          Length = 897

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 74/295 (25%), Positives = 126/295 (42%), Gaps = 54/295 (18%)

Query: 31  GGFAQIYSCEVLSPGPIQGSLACLKRVHVPDKPSLNTLRAEVDAMKMLKGHRHVVSYIDS 90
           G FA +Y   ++S      ++  + R  + +K  L  L  E+  +K +K H H+V  ID 
Sbjct: 33  GSFATVYRGHLISDKSQHIAIKEVSRAKLKNKKLLENLEIEIAILKKIK-HPHIVGLIDC 91

Query: 91  HAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLK--------------- 135
               +       + YL+MEYC  G L  F+  R +  +    +L+               
Sbjct: 92  ERTST-------DFYLIMEYCALGDLT-FLLKRRKELMENHPLLRTVFEKYPPPSESHNG 143

Query: 136 -----IMSHVAQGIMAMHALVPP-LIHRDIKIENVLIS----GDGDFKVC-DFGSVSGVI 184
                ++S++ Q   A+  L    L+HRDIK +N+L+S    G  D K   + G V    
Sbjct: 144 LHRAFVLSYLQQLASALKFLRSKNLVHRDIKPQNLLLSTPLIGYHDSKTFHELGFVGIYN 203

Query: 185 RPPKNAYEFNYVQHDILKNTTAQ--------YRAPEMIDLYRALPVDEKSDIWALGVFLY 236
            P     +F + +   L NT+          Y APE+++  +    + K+D+W++G  ++
Sbjct: 204 LPILKIADFGFAR--FLPNTSLAETLCGSPLYMAPEILNYQK---YNAKADLWSVGTVVF 258

Query: 237 KVCYFTTPFEKVGENAILQA------KFQFPSYPQYTDRLKNLISVMLSEHPVQR 285
           ++C  T PF       + +          FPSY      LK LI  +L+  P +R
Sbjct: 259 EMCCGTPPFRASNHLELFKKIKRANDAITFPSYCNIEPELKKLICSLLTFDPAKR 313

>Skud_7.91 Chr7 (165681..168374) [2694 bp, 897 aa] {ON} YGL180W
           (REAL)
          Length = 897

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 75/295 (25%), Positives = 126/295 (42%), Gaps = 54/295 (18%)

Query: 31  GGFAQIYSCEVLSPGPIQGSLACLKRVHVPDKPSLNTLRAEVDAMKMLKGHRHVVSYIDS 90
           G FA +Y   + S      ++  + R  + +K  L  L  E+  +K +K H H+V  ID 
Sbjct: 33  GSFATVYRGHLTSDKSQHIAIKEVSRTKLKNKKLLENLEIEIAILKKIK-HPHIVGLIDC 91

Query: 91  HAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLK--------------- 135
               +       + YL+MEYC  G L  F+  R +  +    +L+               
Sbjct: 92  ERTST-------DFYLIMEYCALGDLT-FLLKRRKELMENHPLLRTVFEKYPPPSESHNG 143

Query: 136 -----IMSHVAQGIMAMHALVPP-LIHRDIKIENVLIS----GDGDFKVC-DFGSVSGVI 184
                ++S++ Q   A+  L    L+HRDIK +N+L+S    G  D K   + G V    
Sbjct: 144 LHRAFVLSYLQQLASALKFLRSKNLVHRDIKPQNLLLSTPLIGYHDSKTFHELGFVGIYN 203

Query: 185 RPPKNAYEFNYVQHDILKNTTAQ--------YRAPEMIDLYRALPVDEKSDIWALGVFLY 236
            P     +F + +   L NT+          Y APE+++  +    + K+D+W++G  ++
Sbjct: 204 LPILKIADFGFAR--FLPNTSLAETLCGSPLYMAPEILNYQK---YNAKADLWSVGTVVF 258

Query: 237 KVCYFTTPFEKVGENAILQA------KFQFPSYPQYTDRLKNLISVMLSEHPVQR 285
           ++C  T PF       + +          FPSY      LK LI  +L+  PV+R
Sbjct: 259 EMCCGTPPFRASNHLELFKKIKRANDVITFPSYCNIEPELKELICSLLTFDPVKR 313

>TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8.141
           YGL180W
          Length = 1154

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 74/304 (24%), Positives = 130/304 (42%), Gaps = 56/304 (18%)

Query: 31  GGFAQIYSCEVLSPGPIQGSLACLKRVHVPDKPSLNTLRAEVDAMKMLKGHRHVVSYIDS 90
           G FA +Y          + ++  + +  + +K  L  L  E+  +K L  H+H+V+ ID 
Sbjct: 141 GSFAVVYRGYSNEDPNFKLAVKSVPKSKLKNKKILENLEIEISILKKL-NHKHIVNLIDC 199

Query: 91  HAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSR---------LQTRLSEF---------- 131
              K+       +  L+MEYC  G L   +  R         L     +F          
Sbjct: 200 QRNKN-------DFLLIMEYCSLGDLTFLIKKRNELIINHPLLNQIFQKFPSPNPDCNGL 252

Query: 132 EVLKIMSHVAQGIMAMHALVP-PLIHRDIKIENVLIS-------GDGDFKVCDFGSVSGV 183
            +  +++++ Q   A+  L    LIHRDIK +N+L+S           FK   +  +S +
Sbjct: 253 NIAFVLNYLQQLASALKFLRSRNLIHRDIKPQNLLLSTPYTDYHDQQTFKKLGYIGISCL 312

Query: 184 IRPPKNAYEFNYVQHDILKNTTAQ--------YRAPEMIDLYRALPVDEKSDIWALGVFL 235
             P     +F + +   L NT+          Y APE+++  +    + K+D+W++G  L
Sbjct: 313 --PILKIADFGFAR--FLPNTSLAETLCGSPLYMAPEILNYQK---YNAKADLWSVGTVL 365

Query: 236 YKVCYFTTPFEKVGENAILQA------KFQFPSYPQYTDRLKNLISVMLSEHPVQRPNIC 289
           Y++ Y   PF+      +L+          FPSY +  D +K LIS +L   P++R +  
Sbjct: 366 YEMVYGKPPFKANNHLELLKKIKRTNDNIPFPSYIEIDDDMKFLISRLLKFDPIKRMSFQ 425

Query: 290 QVLE 293
           +  E
Sbjct: 426 EFFE 429

>NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141
          Length = 905

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 79/328 (24%), Positives = 138/328 (42%), Gaps = 72/328 (21%)

Query: 15  LTVGSHEVKIIQYLTSGGFAQIYSCEVLSP----------------GPIQGSLACLKRVH 58
           + VGS    + + +  G FA ++   +++P                 P   ++  + R  
Sbjct: 31  IYVGSDRYIVDKEIGKGSFATVHRAHLITPTSPHLHQSVVDSSSINNPTCFAIKIVPRSK 90

Query: 59  VPDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLID 118
           + +K  L  L  E+  +K +  H H+V  ID             + YL+MEYC  G L  
Sbjct: 91  LKNKKLLENLEIEIAILKKI-SHPHIVKLIDFERTSK-------DFYLIMEYCSLGDLT- 141

Query: 119 FMNSRLQTRLSEFEVLK--------------------IMSHVAQGIMAMHALVPP-LIHR 157
           F+  + Q  +    +L+                    I++++ Q   A+  L    L+HR
Sbjct: 142 FLIKKRQQLIKNHPLLEKIFKKYPPPNEKYNGLHKAFILNYLQQLSSALKFLRSKNLVHR 201

Query: 158 DIKIENVLISG-----DGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQ----- 207
           DIK +N+L+S      +      D G V     P     +F + +   L NT+       
Sbjct: 202 DIKPQNLLLSAPLINYNDPKSFHDLGFVGIYNLPILKIADFGFAR--FLPNTSMAETLCG 259

Query: 208 ---YRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYFTTPFEKVGENAILQAKFQ----- 259
              Y APE+++  +    + K+D+W++G  LY++CY   PF K   +  L  K +     
Sbjct: 260 SPLYMAPEILNYQK---YNAKADLWSVGTVLYEMCYGNPPF-KASNHLELYKKIKKANDL 315

Query: 260 --FPSYPQYTDRLKNLISVMLSEHPVQR 285
             FP+Y +  + LK+LIS +L+  P +R
Sbjct: 316 IYFPTYIEIDNNLKSLISKLLTFDPQER 343

>TBLA0I00280 Chr9 (42870..46820) [3951 bp, 1316 aa] {ON} Anc_2.496
            YHL007C
          Length = 1316

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 54/198 (27%), Positives = 98/198 (49%), Gaps = 33/198 (16%)

Query: 52   ACLKRVHVPDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYC 111
              +K++++  +P    +  E+  MK  K H+++V++IDS+  K        +++++MEY 
Sbjct: 1053 VAVKQMNLEKQPKTELIINEIIVMKESK-HKNIVNFIDSYLLKG-------DLWVVMEYM 1104

Query: 112  LRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGD 171
              G L D +   +   L+E ++  +      G+  +H+    +IHRDIK +N+L+S  GD
Sbjct: 1105 EGGSLTDVVTHCI---LTEGQIGAVCRETLNGLKFLHS--KGVIHRDIKSDNILLSMQGD 1159

Query: 172  FKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTA----QYRAPEMIDLYRALPVDEKSD 227
             K+ DFG  +          + N V    LK TT      + APE++      P   K D
Sbjct: 1160 IKLTDFGFCA----------QINEVH---LKRTTMVGTPYWMAPEVVSRKEYGP---KVD 1203

Query: 228  IWALGVFLYKVCYFTTPF 245
            IW+LG+ + ++     P+
Sbjct: 1204 IWSLGIMIIEMIEGEPPY 1221

>YGL180W Chr7 (160065..162758) [2694 bp, 897 aa] {ON}  ATG1Protein
           ser/thr kinase required for vesicle formation in
           autophagy and the cytoplasm-to-vacuole targeting (Cvt)
           pathway; structurally required for phagophore assembly
           site formation; during autophagy forms a complex with
           Atg13p and Atg17p
          Length = 897

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 75/295 (25%), Positives = 125/295 (42%), Gaps = 54/295 (18%)

Query: 31  GGFAQIYSCEVLSPGPIQGSLACLKRVHVPDKPSLNTLRAEVDAMKMLKGHRHVVSYIDS 90
           G FA +Y   + S      ++  + R  + +K  L  L  E+  +K +K H H+V  ID 
Sbjct: 33  GSFATVYRGHLTSDKSQHVAIKEVSRAKLKNKKLLENLEIEIAILKKIK-HPHIVGLIDC 91

Query: 91  HAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLK--------------- 135
               +       + YL+MEYC  G L  F+  R +  +    +L+               
Sbjct: 92  ERTST-------DFYLIMEYCALGDLT-FLLKRRKELMENHPLLRTVFEKYPPPSENHNG 143

Query: 136 -----IMSHVAQGIMAMHALVPP-LIHRDIKIENVLIS----GDGDFK-VCDFGSVSGVI 184
                ++S++ Q   A+  L    L+HRDIK +N+L+S    G  D K   + G V    
Sbjct: 144 LHRAFVLSYLQQLASALKFLRSKNLVHRDIKPQNLLLSTPLIGYHDSKSFHELGFVGIYN 203

Query: 185 RPPKNAYEFNYVQHDILKNTTAQ--------YRAPEMIDLYRALPVDEKSDIWALGVFLY 236
            P     +F + +   L NT+          Y APE+++  +    + K+D+W++G  ++
Sbjct: 204 LPILKIADFGFAR--FLPNTSLAETLCGSPLYMAPEILNYQK---YNAKADLWSVGTVVF 258

Query: 237 KVCYFTTPFEKVGENAILQA------KFQFPSYPQYTDRLKNLISVMLSEHPVQR 285
           ++C  T PF       + +          FPSY      LK LI  +L+  P QR
Sbjct: 259 EMCCGTPPFRASNHLELFKKIKRANDVITFPSYCNIEPELKELICSLLTFDPAQR 313

>ADL315C Chr4 complement(146096..147400) [1305 bp, 434 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR054W
           (SMK1)
          Length = 434

 Score = 75.5 bits (184), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 50/165 (30%), Positives = 82/165 (49%), Gaps = 13/165 (7%)

Query: 71  EVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTRLSE 130
           E+  M   KGH+++VS I+        +DG Y    L++Y     L   ++S +Q   SE
Sbjct: 123 ELKFMHYFKGHKNIVSLINLEIVNEKPYDGLYCYQELIDY----DLARVIHSNVQ--FSE 176

Query: 131 FEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKNA 190
           F +      +  G+  +H+    +IHRD+K  N+L S  G  K+CDFG   G+     N 
Sbjct: 177 FHIKHFTYQILCGVKYIHS--ADVIHRDLKPGNILCSISGQLKICDFGLARGISPLFTNT 234

Query: 191 YEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFL 235
              N++ + +    T  YRAPE+I  ++    ++  D+WA+G  L
Sbjct: 235 KTSNHITNYV---ATRWYRAPELILSHKRY--NKSIDMWAIGCIL 274

>YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}
           KIN2Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin1p
          Length = 1147

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 55/214 (25%), Positives = 100/214 (46%), Gaps = 24/214 (11%)

Query: 105 YLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENV 164
           Y+L EY   G L+D++       L E    K    +A  +  +HA    ++HRD+KIEN+
Sbjct: 199 YMLFEYVSGGQLLDYIIQ--HGSLKEHHARKFARGIASALQYLHA--NNIVHRDLKIENI 254

Query: 165 LISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALP-VD 223
           +IS  G+ K+ DFG          N +++    H      +  + APE++   +A P   
Sbjct: 255 MISSSGEIKIIDFGL--------SNIFDYRKQLHTFC--GSLYFAAPELL---KAQPYTG 301

Query: 224 EKSDIWALGVFLYKVCYFTTPFEK----VGENAILQAKFQFPSYPQYTDRLKNLISVMLS 279
            + DIW+ G+ LY +     PF+     +    I + K  +PS+   +  + +L++ M+ 
Sbjct: 302 PEVDIWSFGIVLYVLVCGKVPFDDENSSILHEKIKKGKVDYPSH--LSIEVISLLTRMIV 359

Query: 280 EHPVQRPNICQVLEEVSRIQGVPCPLPNFYLERM 313
             P++R  +  V+E     +G     P++   R+
Sbjct: 360 VDPLRRATLKNVVEHPWMNRGYDFKAPSYVPNRV 393

>CAGL0M10153g Chr13 complement(1010688..1013291) [2604 bp, 867 aa]
           {ON} some similarities with uniprot|Q03497 Saccharomyces
           cerevisiae YHL007c ser/thr protein kinase of the
           pheromone pathway
          Length = 867

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 64/238 (26%), Positives = 113/238 (47%), Gaps = 38/238 (15%)

Query: 14  ILTVGSHEVKIIQYLTSGGFAQ--IYSCEVLSPGPIQGSLACLKRVHVPDKPSLNTLRAE 71
           I T G+ E K   YL  G  A   +Y     S    +     +K++++  +P    +  E
Sbjct: 556 ICTPGTPEDKFETYLKIGQGASGGVYLSHSRSD---KSQCVAIKQMNLEKQPKKELIVNE 612

Query: 72  VDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTRLSEF 131
           +  M   K H+++V+YIDS+ +         +++++MEY   G L D +   +   L+E 
Sbjct: 613 IMVMSSSK-HQNIVNYIDSYLS-------GLDLWVVMEYMEGGCLTDVVTYCV---LTEG 661

Query: 132 EVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKNAY 191
           ++  +   V QG+  +H+    ++HRDIK +NVL+S +GD K+ DFG  +          
Sbjct: 662 QIGAVCREVLQGLEFLHS--KGVLHRDIKSDNVLLSMNGDIKLTDFGFCA---------- 709

Query: 192 EFNYVQHDILKNTTA----QYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYFTTPF 245
               V   ++K TT      + APE++      P   K DIW+LG+ + ++     P+
Sbjct: 710 ---QVNDTVIKRTTMVGTPYWMAPEIVSRKEYGP---KVDIWSLGIMIIEMIEGEPPY 761

>Smik_15.122 Chr15 (209665..212970) [3306 bp, 1101 aa] {ON} YOL045W
            (REAL)
          Length = 1101

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 55/195 (28%), Positives = 89/195 (45%), Gaps = 24/195 (12%)

Query: 105  YLLMEYCLRG--GLIDFMNS-RLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKI 161
            Y  +E  + G  G ID  +    +  + E E   +   V   I  +H     ++HRDIK 
Sbjct: 921  YYYIETPVHGETGSIDLFDVIEFKKDMVEHEAKLVFKQVVASIKHLHG--QGIVHRDIKD 978

Query: 162  ENVLISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMI--DLYRA 219
            ENV++   G  K+ DFGS + +   P + +             T  Y APE++    Y+ 
Sbjct: 979  ENVIVDSHGFVKLIDFGSAAYIKSGPFDVFV-----------GTMDYAAPEVLGGSSYKG 1027

Query: 220  LPVDEKSDIWALGVFLYKVCYFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLS 279
             P     DIWALGV LY + Y   P+  + E  IL+ + +F    + ++    LI  +L+
Sbjct: 1028 KP----QDIWALGVLLYTIIYKENPYYNIDE--ILEGELRFDKSEKVSEECIGLIKRILT 1081

Query: 280  EHPVQRPNICQVLEE 294
                +RP I ++ E+
Sbjct: 1082 REVDKRPTIDEIYED 1096

>KNAG0L00520 Chr12 (79786..80892) [1107 bp, 368 aa] {ON} Anc_7.86
           YAL017W
          Length = 368

 Score = 74.7 bits (182), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 63/223 (28%), Positives = 99/223 (44%), Gaps = 42/223 (18%)

Query: 81  HRHVVSYIDS------HAAKSPRH---DGTYEVYLLMEYCLRGGLIDFMNSRLQTRLSEF 131
           H +VVS ID       +  + P H   DG  E++            DF++ R    +S++
Sbjct: 172 HDNVVSMIDFFEDDDFYYVEMPIHGQGDGCIELF------------DFIDIR--DEVSDW 217

Query: 132 EVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKNAY 191
           E   I+  +   I  +H     ++HRDIK EN+++   G  ++ DFGS +  +R P   +
Sbjct: 218 ECKLIIKQLVSAIKYLHD--RDIVHRDIKDENIIMDARGHIQLIDFGSATNAVRGPFRTF 275

Query: 192 EFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEK-SDIWALGVFLYKVCYFTTPFEKVGE 250
                        T  Y  PE+    R  P   K  DIWALG+ LY + +   PF  + +
Sbjct: 276 -----------LGTIDYEPPEVA---RGEPFLGKPQDIWALGILLYILRFKEPPF--LDQ 319

Query: 251 NAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLE 293
            AIL    +FP          +LI+ +LS    +RP I  ++E
Sbjct: 320 KAILTGDLKFPQGTSVNTDCIDLINAILSPRVDERPTIDDIVE 362

>SAKL0B07304g Chr2 (625541..627007) [1467 bp, 488 aa] {ON} similar
           to uniprot|P41808 Saccharomyces cerevisiae YPR054W SMK1
           Mitogen-activated protein kinase required for spore
           morphogenesis that is expressed as a middle
           sporulation-specific gene
          Length = 488

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 62/220 (28%), Positives = 105/220 (47%), Gaps = 18/220 (8%)

Query: 18  GSHEVKIIQYLTSGGFAQIYSCEVLSPGPIQGSLACLKRVHVPDKPSLNTLRA--EVDAM 75
           G++EV  +Q L  G +  + S  V +  P  G    +K++       +   RA  E+  M
Sbjct: 119 GNYEV--LQVLGKGSYGTVVSA-VDNSNPEYGVRIAIKKITNIFHREVLLKRAIRELKFM 175

Query: 76  KMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLK 135
              KGH+++++ +D        +DG Y    L++Y     L   ++S +Q  LSEF +  
Sbjct: 176 NYFKGHKNIINLLDLDIVSEKPYDGLYCYQELIDY----DLARVIHSSVQ--LSEFHIKS 229

Query: 136 IMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKNAYEFNY 195
            +  +  G+  +H+    +IHRD+K  N+L +  G+ K+CDFG   GV       ++   
Sbjct: 230 FLYQILCGLKYIHS--ADVIHRDLKPGNILCTIHGNLKICDFGLARGV---SPQFFQGRT 284

Query: 196 VQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFL 235
           V H      T  YRAPE+I  ++     +  D+WA+G  L
Sbjct: 285 VSHITNYVATRWYRAPELILSHKNY--SKAIDMWAVGCIL 322

>Suva_5.250 Chr5 (392904..396323) [3420 bp, 1139 aa] {ON} YER129W
           (REAL)
          Length = 1139

 Score = 76.6 bits (187), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 74/277 (26%), Positives = 114/277 (41%), Gaps = 59/277 (21%)

Query: 14  ILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGPIQGSLACLKRVHVPDKPSLNTLRAEVD 73
           I  V  HE K  ++     F  I S ++     I+  +A +K+ H               
Sbjct: 162 IKIVDRHEKKQRKF-----FTFIKSSKIFENDKIKREIAIMKKCH--------------- 201

Query: 74  AMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLI----DFMNSRLQ--TR 127
                  H+HVV  I+       R     ++YL++EYC RG +     D + S  +  + 
Sbjct: 202 -------HKHVVQLIEVLDDLKSR-----KIYLVLEYCSRGEVKWCPPDCLESDAKGPSL 249

Query: 128 LSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPP 187
           LS  E   I+  V  G+  +H     +IHRDIK  N+LIS DG  K+ DFG         
Sbjct: 250 LSFQETRDILRGVVLGLEYLH--YQGIIHRDIKPANLLISEDGTVKISDFGVSLAATSTN 307

Query: 188 KNAYEFNYVQHDILKNT-TAQYRAPEMI--------------DLYRALPVDEKSDIWALG 232
            +    +  + ++ K   T  + APEM               +L+R   +    DIWA+G
Sbjct: 308 SSDSNESLDELELAKTVGTPAFFAPEMCLGEDAFAKYNLTKENLFRGSCISFMIDIWAVG 367

Query: 233 VFLYKVCY----FTTPFEKVGENAILQAKFQFPSYPQ 265
           V LY + +    F + FE      I+    +FPSY +
Sbjct: 368 VTLYCLIFGMLPFFSDFELKLFEKIVNDPLKFPSYKE 404

>Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {ON}
           YDR490C (REAL)
          Length = 756

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 64/285 (22%), Positives = 123/285 (43%), Gaps = 23/285 (8%)

Query: 14  ILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGPIQGSLACLKRVHVPDKPSLNTLRAEVD 73
           ++ +G  + K  + L  G ++ +        G  + ++  L + ++  +  +  +  E  
Sbjct: 117 VVKMGIKDFKFGEQLGDGSYSSVVLATARDSGK-KYAVKVLSKEYLIRQKKVKYVTVEKL 175

Query: 74  AMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTRLSEFEV 133
           A++ L G + ++    +   ++        +Y L+EY   G  +  +  +    L+E   
Sbjct: 176 ALQKLNGTKGIIRLFFTFQDEA-------SLYFLLEYASHGDFLGLI--KKYGSLNEKCA 226

Query: 134 LKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKNAYE- 192
               S +   + ++HA+   +IHRDIK EN+L+  D   K+ DFG+   +   P N  + 
Sbjct: 227 RYYASQIIDAVDSLHAI--GIIHRDIKPENILLDKDMKVKLTDFGTAKILPEQPSNNADG 284

Query: 193 ---FNYVQHDILKNTTAQYRAPEMI-DLYRALPVDEKSDIWALGVFLYKVCYFTTPFEKV 248
              F+          TA+Y +PE++ D Y     D + DIWA G  LY++     PF+  
Sbjct: 285 KPCFDLYARSKSFVGTAEYVSPELLNDSY----TDSRCDIWAFGCILYQMVAGKPPFKAA 340

Query: 249 GENAILQA--KFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQV 291
            E    Q   K Q+     +    K+L+  +L   P  R  + Q+
Sbjct: 341 NEYLTFQKVMKIQYAFTAGFPLIAKDLVKKLLVREPNDRLTVEQI 385

>SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {ON}
           weakly similar to uniprot|Q03002 Saccharomyces
           cerevisiae YPL141C Hypothetical ORF
          Length = 919

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 63/260 (24%), Positives = 123/260 (47%), Gaps = 40/260 (15%)

Query: 46  PIQGSLACLKRVHVPDKPSLNT-LRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEV 104
           P Q ++  ++R  VP        +  E++A+K L  H ++V   +    ++ ++ G    
Sbjct: 72  PKQVAIKLIRRDTVPKNSDKEVKIYREINALKHL-THPNIVRLEE--VLQNSKYIG---- 124

Query: 105 YLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENV 164
            +++EY   G    ++  +   RL E    ++ + +  G+  MH+    L+HRD+K+EN+
Sbjct: 125 -IVLEYASGGEFYRYIQKK--RRLKEHAACRLFAQLISGVHYMHS--KGLVHRDLKLENL 179

Query: 165 LISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQ--YRAPEMIDLYRALPV 222
           L+  + +  + DFG V+          EFN+ +++++K +     Y APE++   +    
Sbjct: 180 LLDKNENLLITDFGFVN----------EFNH-KNELMKTSCGSPCYAAPELVVTTKPYEA 228

Query: 223 DEKSDIWALGVFLYKVCYFTTPFEKVGEN-----------AILQAKFQFPSYPQYTDRLK 271
             K+DIW+ GV +Y +     P++   EN            I +   +FP Y     R  
Sbjct: 229 -RKADIWSCGVIMYAMLAGYLPWDDDSENPEGDDIAKLYHYITKTPLKFPEYINPVPR-- 285

Query: 272 NLISVMLSEHPVQRPNICQV 291
           +L+  +L  +P +R N+ QV
Sbjct: 286 DLLRRILVSNPKKRLNLRQV 305

>TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1.271
            YJL095W
          Length = 1434

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 71/285 (24%), Positives = 126/285 (44%), Gaps = 44/285 (15%)

Query: 26   QYLTSGGFAQIYSCEVLSPGPIQGSLACLKRVHVPDKPS-----LNTLRA---EVDAMKM 77
            + +  G F  ++    LS     G +  +K++ VP   S     LNT+ A   EV  +K 
Sbjct: 1139 EMIGKGSFGAVF----LSLNITTGEMMAVKQIEVPSYGSQSETMLNTVEAMKSEVSTLKD 1194

Query: 78   LKGHRHVVSYIDSHAAKSPRHDGTYEVY-LLMEYCLRGGLIDFMNSRLQTRLSEFEVLKI 136
            L  H ++V Y+          +  + +Y L +EY   G +   +  R+  R  +  +  +
Sbjct: 1195 L-DHLNIVQYLG--------FEMKHNIYSLFLEYVAGGSVGSLI--RMYGRFDDKLIRHL 1243

Query: 137  MSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKNAYEFNYV 196
             + V +G+  +H+    ++HRD+K +N+L+  DG  K+ DF    G+ +  ++ Y     
Sbjct: 1244 TNQVLEGLSYLHS--QGILHRDMKADNLLLDQDGICKISDF----GISKKSEDIYS---- 1293

Query: 197  QHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYFTTP---FEKVGENAI 253
              ++    T  + APEM+D  +    + K DIW+LG  + ++     P   FE V     
Sbjct: 1294 NSEMTMRGTVFWMAPEMVDTKQGY--NAKVDIWSLGCVVLEMFAGKRPWSNFEVVTAMYK 1351

Query: 254  LQAKFQFPSYPQYTDRL-----KNLISVMLSEHPVQRPNICQVLE 293
            +      P  P+ T  L     KN ++      P +RP   Q+LE
Sbjct: 1352 IGQSKSAPPIPEDTKDLISPTAKNFLNQCFHIDPKERPTAGQLLE 1396

>TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5.406
           YHR102W
          Length = 1036

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 70/274 (25%), Positives = 122/274 (44%), Gaps = 49/274 (17%)

Query: 68  LRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTR 127
           ++ EV  +  LK   +++ Y  S+   +        ++++M+YC  G +   +      +
Sbjct: 89  VQREVQFLSSLKQFPNIIRYFGSYLKDT-------NLWIIMDYCAGGSIRTLLRP---GK 138

Query: 128 LSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPP 187
           + E  +  IM  +   +  +H     +IHRDIK  NVL++ +G  K+CDFG         
Sbjct: 139 IDEKYIGIIMREILIALQYIHK--DNVIHRDIKAANVLVTNEGKVKLCDFGV-------- 188

Query: 188 KNAYEFNYVQHDILKNTTA---QYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYFTTP 244
             A + N  Q  + + T A    + APE+I        D K+DIW+LG+  Y++     P
Sbjct: 189 --AAQLN--QTKLRRQTMAGTPYWMAPEVI--MEGAYYDTKADIWSLGITAYEIATGNPP 242

Query: 245 FEKVGENAILQAKFQFPSYP------QYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRI 298
           + ++   A+   +    S P       Y+  LK  I++ L E P +R +  + L++   I
Sbjct: 243 YCEI--EALRAMQLITKSKPARLEGRSYSTSLKEFIALCLDEDPKERLS-AEELQKTKFI 299

Query: 299 Q---GVPCP-----LPNFYLERMKHGACTPVHHS 324
           +    VP       +  + L R KH   TP  HS
Sbjct: 300 KSQRAVPTTILKELISRYLLFRDKH---TPREHS 330

>Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {ON}
           YDR490C (PKH1) - Ser/Thr protein kinase [contig 184]
           FULL
          Length = 984

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 53/191 (27%), Positives = 91/191 (47%), Gaps = 12/191 (6%)

Query: 104 VYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIEN 163
           +Y L+EY   G  +  +  +    LS+   +   + +   I  +H     ++HRDIK EN
Sbjct: 232 LYFLLEYAPNGDFLSVI--KKFGSLSQECAVYYSAQILDAIDYLHH--KGIVHRDIKPEN 287

Query: 164 VLISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMI-DLYRALPV 222
           +L+  D   K+ DFG+   ++   +    FN ++       TA+Y +PE++ D Y    V
Sbjct: 288 ILLDKDMKVKLTDFGTAR-ILEKDETTQTFNLLERSKSFVGTAEYVSPELLNDNY----V 342

Query: 223 DEKSDIWALGVFLYKVCYFTTPFEKVGENAILQA--KFQFPSYPQYTDRLKNLISVMLSE 280
           D K DIWA G  L+++     PF+   E    Q   K Q+     +   +++LI  +L +
Sbjct: 343 DYKCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPLVIRDLIKKILVK 402

Query: 281 HPVQRPNICQV 291
            P QR +  Q+
Sbjct: 403 SPEQRLDASQI 413

>YHL007C Chr8 complement(95118..97937) [2820 bp, 939 aa] {ON}
           STE20Cdc42p-activated signal transducing kinase of the
           PAK (p21-activated kinase) family; involved in pheromone
           response, pseudohyphal/invasive growth, vacuole
           inheritance, down-regulation of sterol uptake; GBB motif
           binds Ste4p
          Length = 939

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 50/193 (25%), Positives = 98/193 (50%), Gaps = 25/193 (12%)

Query: 53  CLKRVHVPDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCL 112
            +K++++  +P    +  E+  MK  K H ++V++IDS+  K        +++++MEY  
Sbjct: 647 AIKQMNLEKQPKKELIINEILVMKGSK-HPNIVNFIDSYVLKG-------DLWVIMEYME 698

Query: 113 RGGLIDFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDF 172
            G L D +   +   L+E ++  +      G+  +H+    ++HRDIK +N+L+S +GD 
Sbjct: 699 GGSLTDVVTHCI---LTEGQIGAVCRETLSGLEFLHS--KGVLHRDIKSDNILLSMEGDI 753

Query: 173 KVCDFGSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALG 232
           K+ DFG  + +        E N  +  ++   T  + APE++      P   K DIW+LG
Sbjct: 754 KLTDFGFCAQI-------NELNLKRTTMVG--TPYWMAPEVVSRKEYGP---KVDIWSLG 801

Query: 233 VFLYKVCYFTTPF 245
           + + ++     P+
Sbjct: 802 IMIIEMIEGEPPY 814

>YER129W Chr5 (417281..420709) [3429 bp, 1142 aa] {ON}  SAK1Upstream
           serine/threonine kinase for the SNF1 complex; partially
           redundant with Elm1p and Tos3p; members of this family
           have functional orthology with LKB1, a mammalian kinase
           associated with Peutz-Jeghers cancer-susceptibility
           syndrome
          Length = 1142

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 75/277 (27%), Positives = 116/277 (41%), Gaps = 59/277 (21%)

Query: 14  ILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGPIQGSLACLKRVHVPDKPSLNTLRAEVD 73
           I  V  HE K  ++     F  I S ++     I+  +A +K+ H               
Sbjct: 161 IKIVDRHEKKQRKF-----FTFIKSSKISENDKIKREIAIMKKCH--------------- 200

Query: 74  AMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLI----DFMNSRLQ--TR 127
                  H+HVV  I+       R     ++YL++EYC RG +     D M S  +  + 
Sbjct: 201 -------HKHVVQLIEVLDDLKSR-----KIYLVLEYCSRGEVKWCPPDCMESDAKGPSL 248

Query: 128 LSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFG-SVSGVIRP 186
           LS  E  +I+  V  G+  +H     +IHRDIK  N+LISGDG  K+ DFG S++     
Sbjct: 249 LSFQETREILRGVVLGLEYLH--YQGIIHRDIKPANLLISGDGTVKISDFGVSLAASSTN 306

Query: 187 PKNAYEFNYVQHDILKNTTAQYRAPEMI--------------DLYRALPVDEKSDIWALG 232
             ++ E            T  + APEM               +L+R   +    DIWA+G
Sbjct: 307 SSDSSESLDELELAKTVGTPAFFAPEMCLGEDAFTRYNLTKENLFRGSCISFMIDIWAVG 366

Query: 233 VFLYKVCY----FTTPFEKVGENAILQAKFQFPSYPQ 265
           V LY + +    F + FE      I+    +FP++ +
Sbjct: 367 VTLYCLLFGMLPFFSDFELKLFEKIVNDPLKFPTFKE 403

>ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {ON}
           weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 943

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 70/279 (25%), Positives = 119/279 (42%), Gaps = 54/279 (19%)

Query: 23  KIIQYLTSGGFAQIYSCEVLSPGPIQGSLACLKRVHV-------PDKPSLNTLRAEVDAM 75
           K  + + +G F  +Y          +G  A  K+V+         D+  +  ++ EV  +
Sbjct: 30  KRTEVIGTGKFGVVY----------KGHHARTKQVYAIKVLNLDSDEDEVEDVQREVQFL 79

Query: 76  KMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLK 135
             +K   ++  Y  S+   +        +++++EYC  G L   +      ++ E  +  
Sbjct: 80  ASMKQTPNITHYYGSYLKDT-------TLWIIIEYCAGGSLRTLLRP---GKIDEKYIGI 129

Query: 136 IMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKNAYEFNY 195
           IM  V   +  +H     +IHRDIK  NVLI+ +G  K+CDFG           A + N 
Sbjct: 130 IMREVLIALKYIHK--DNVIHRDIKAANVLITNEGHVKLCDFGV----------AAQLN- 176

Query: 196 VQHDILKNTTA---QYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYFTTPFEKVGENA 252
            Q  + + T A    + APE+I     +  D K DIW+LG+  Y++     P+  V   A
Sbjct: 177 -QSSLKRQTMAGTPYWMAPEVI--MEGVSYDTKVDIWSLGITTYEIATGNPPYCDV--EA 231

Query: 253 ILQAKFQFPSYP------QYTDRLKNLISVMLSEHPVQR 285
           +   +    S P       Y+  LK  I++ L E P +R
Sbjct: 232 LRAMQLITKSKPPRLEGRHYSPMLKEFIALCLDEDPKER 270

>ZYRO0G15290g Chr7 complement(1237119..1241582) [4464 bp, 1487 aa]
            {ON} similar to uniprot|Q01389 Saccharomyces cerevisiae
            YJL095W BCK1 Mitogen-activated protein (MAP) kinase
            kinase kinase acting in the protein kinase C signaling
            pathway which controls cell integrity upon activation by
            Pkc1p phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1487

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 59/228 (25%), Positives = 103/228 (45%), Gaps = 34/228 (14%)

Query: 26   QYLTSGGFAQIYSCEVLSPGPIQGSLACLKRVHVPDKPSLN--------TLRAEVDAMKM 77
            + +  G F  ++ C  ++     G +  +K+V VP   S N         LRAEV  +K 
Sbjct: 1186 EMIGKGSFGAVFLCLNVT----TGEMMAVKQVEVPRYGSQNEAIISTVEALRAEVSTLKD 1241

Query: 78   LKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTRLSEFEVLKIM 137
            L  H ++V Y+          D  Y ++L  EY   G +   +  R+  +  E  +  + 
Sbjct: 1242 LD-HLNIVQYLGFEVK-----DSIYSLFL--EYVAGGSVGSLI--RMYGKFDEKLIKHLT 1291

Query: 138  SHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPPKNAYEFNYVQ 197
              V +G+  +H+    ++HRD+K +N+L+  DG  K+ DF    G+ R  K+ Y      
Sbjct: 1292 IQVLRGLSYLHSR--GILHRDMKADNLLLDQDGVCKISDF----GISRKSKDIYS----N 1341

Query: 198  HDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVCYFTTPF 245
             ++    T  + APEM+D  +      K DIW+LG  + ++     P+
Sbjct: 1342 SEMTMRGTVFWMAPEMVDTKQGYSA--KVDIWSLGCVVLEMFAGKRPW 1387

>KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52
           YDR507C
          Length = 1125

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 61/236 (25%), Positives = 104/236 (44%), Gaps = 38/236 (16%)

Query: 68  LRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDFMNSRLQTR 127
           +  E+  MK+L  H +V+   D     S        +Y+++EY  +G L + +  R    
Sbjct: 75  IEREIVIMKLL-NHANVLRLYDVWETNS-------NLYMVLEYAEKGELFNLLVER--GP 124

Query: 128 LSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGSVSGVIRPP 187
           L E E ++    +  GI   HAL   ++HRD+K EN+L+    + K+ DFG  +      
Sbjct: 125 LPENEAIRFFRQIIIGISYCHAL--GIVHRDLKPENLLLDTKYNIKIADFGMAA------ 176

Query: 188 KNAYEFNYVQHDILKNTTA---QYRAPEMIDLYRALPVDE-KSDIWALGVFLYKVCYFTT 243
                      D L  T+     Y APE++     +P     SD+W+ GV LY +     
Sbjct: 177 -------LETEDKLLETSCGSPHYAAPEIVS---GIPYHGFASDVWSCGVILYALLTGRL 226

Query: 244 PFEKVGEN------AILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLE 293
           PF++   N       +   +F+ P   + +   +NLIS +L  +P +R     +L+
Sbjct: 227 PFDEEDGNIRNLLLKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILK 282

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.129    0.369 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 73,589,551
Number of extensions: 3088027
Number of successful extensions: 12687
Number of sequences better than 10.0: 1868
Number of HSP's gapped: 11762
Number of HSP's successfully gapped: 1927
Length of query: 750
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 633
Effective length of database: 40,065,477
Effective search space: 25361446941
Effective search space used: 25361446941
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 70 (31.6 bits)