Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ADL216C2.285ON70570537100.0
Ecym_33242.285ON70670931170.0
SAKL0E07700g2.285ON71265929080.0
KLTH0G10340g2.285ON70865928000.0
Kwal_27.115372.285ON70865927970.0
NCAS0G038002.285ON72666027370.0
KLLA0E08383g2.285ON70465927060.0
ZYRO0A01870g2.285ON70770626980.0
CAGL0J03454g2.285ON69365926930.0
YNL021W (HDA1)2.285ON70665926830.0
NDAI0G006502.285ON68965926710.0
Skud_14.3082.285ON70665926710.0
TDEL0G021602.285ON71470126700.0
Suva_14.3262.285ON70665926660.0
Smik_14.3102.285ON70665926630.0
KNAG0H020102.285ON69365926490.0
KAFR0H033202.285ON70266326080.0
Kpol_1039.322.285ON65965825020.0
TPHA0C033902.285ON70165923960.0
TBLA0B069502.285ON79543518620.0
Kpol_1003.372.285ON57828412291e-161
SAKL0H25124g8.153ON4483633675e-37
TPHA0H003208.153ON4503583667e-37
KAFR0C029208.153ON4533563677e-37
AFR172C8.153ON4493353561e-35
Kpol_246.58.153ON4533563552e-35
KLTH0E06446g8.153ON4493523543e-35
NCAS0B054808.153ON4513553534e-35
TBLA0D021408.153ON4563333526e-35
KLLA0F09119g8.153ON4523333527e-35
Ecym_23468.153ON4853373529e-35
Kwal_55.207908.153ON4493523491e-34
ZYRO0G19316g8.153ON4483353482e-34
TDEL0B045808.153ON4463553463e-34
CAGL0A03322g8.153ON4504313439e-34
YGL194C (HOS2)8.153ON4523303431e-33
Smik_7.798.153ON4523303412e-33
Skud_7.798.153ON4523303402e-33
NDAI0B027108.153ON4533523393e-33
KNAG0G013508.153ON4513593375e-33
Suva_7.718.153ON4523293332e-32
Suva_14.113.8ON4333263313e-32
KLTH0F19668g3.8ON4323263304e-32
KNAG0A011603.8ON4333263285e-32
Skud_14.113.8ON4333263286e-32
NDAI0G037403.8ON4333263286e-32
TBLA0I005603.8ON4333263279e-32
TPHA0A003003.8ON4333263279e-32
NCAS0C043203.8ON4343263261e-31
Kwal_55.221423.8ON4323263261e-31
Kpol_1038.113.8ON4333263261e-31
CAGL0B01441g3.8ON4333263261e-31
AGR395W3.8ON4333263251e-31
KAFR0A086303.8ON4333263251e-31
Ecym_20103.8ON4333263251e-31
ZYRO0C03498g3.8ON4333263252e-31
SAKL0C13706g3.8ON4333263242e-31
Smik_14.23.8ON4333263224e-31
YNL330C (RPD3)3.8ON4333263224e-31
KLLA0E01981g3.8ON4323263215e-31
TDEL0A002703.8ON4333263198e-31
TDEL0C050403.362ON4541821964e-15
CAGL0D01430g3.362ON4452871956e-15
Suva_16.3963.362ON4771761931e-14
SAKL0B07854g3.362ON4891761912e-14
Ecym_82908.607ON7093001895e-14
Skud_16.3533.362ON4711761875e-14
NDAI0A051203.362ON5082081876e-14
Kwal_23.37243.362ON4732021867e-14
KLTH0F10582g3.362ON4741761867e-14
YPR068C (HOS1)3.362ON4701761869e-14
TDEL0A055208.607ON6743331861e-13
KNAG0H006303.362ON4561811822e-13
Kpol_376.153.362ON5182431832e-13
Smik_16.3093.362ON4701761813e-13
ADL339W3.362ON4372791813e-13
ZYRO0C16390g3.362ON4361781803e-13
NCAS0A111803.362ON4902021814e-13
KLLA0B09394g3.362ON4411761795e-13
TBLA0B023903.362ON5791771806e-13
KAFR0H008903.362ON4742091761e-12
ZYRO0F10780g8.607ON6683331772e-12
Ecym_34653.362ON4452311706e-12
Kpol_479.68.607ON6882981709e-12
YPL116W (HOS3)8.607ON6973311692e-11
KAFR0H027908.607ON717991645e-11
KLTH0D09592g8.607ON7052631637e-11
SAKL0H08338g8.607ON6904151637e-11
TBLA0E040808.607ON6942561621e-10
Smik_6.3158.607ON6973841611e-10
ADL265W8.607ON6942571611e-10
Suva_16.1948.607ON6993841611e-10
KNAG0J013008.607ON6773061602e-10
KLLA0F00858g8.607ON7152741583e-10
TPHA0A011208.607ON6983251573e-10
Skud_16.1648.607ON6973221548e-10
Kwal_26.85058.607ON7082571531e-09
NDAI0E024808.607ON6842981522e-09
CAGL0J06974g8.607ON6782971512e-09
TPHA0M015903.362ON4942761441e-08
NCAS0C017608.607ON700991441e-08
Smik_16.2238.78ON1226136880.076
YPL095C (EEB1)8.574ON45690752.2
Smik_16.1428.574ON45690724.8
Smik_6.2604.69ON50768716.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADL216C
         (705 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADL216C Chr4 complement(324197..326314) [2118 bp, 705 aa] {ON} S...  1433   0.0  
Ecym_3324 Chr3 complement(620836..622956) [2121 bp, 706 aa] {ON}...  1205   0.0  
SAKL0E07700g Chr5 (622822..624960) [2139 bp, 712 aa] {ON} highly...  1124   0.0  
KLTH0G10340g Chr7 complement(874566..876692) [2127 bp, 708 aa] {...  1083   0.0  
Kwal_27.11537 s27 (839198..841324) [2127 bp, 708 aa] {ON} YNL021...  1082   0.0  
NCAS0G03800 Chr7 (701547..703727) [2181 bp, 726 aa] {ON}             1058   0.0  
KLLA0E08383g Chr5 (754048..756162) [2115 bp, 704 aa] {ON} highly...  1046   0.0  
ZYRO0A01870g Chr1 complement(154507..156630) [2124 bp, 707 aa] {...  1043   0.0  
CAGL0J03454g Chr10 complement(332090..334171) [2082 bp, 693 aa] ...  1041   0.0  
YNL021W Chr14 (593227..595347) [2121 bp, 706 aa] {ON}  HDA1Putat...  1038   0.0  
NDAI0G00650 Chr7 complement(141981..144050) [2070 bp, 689 aa] {O...  1033   0.0  
Skud_14.308 Chr14 (563902..566022) [2121 bp, 706 aa] {ON} YNL021...  1033   0.0  
TDEL0G02160 Chr7 complement(424838..426982) [2145 bp, 714 aa] {O...  1033   0.0  
Suva_14.326 Chr14 (576098..578218) [2121 bp, 706 aa] {ON} YNL021...  1031   0.0  
Smik_14.310 Chr14 (555609..557729) [2121 bp, 706 aa] {ON} YNL021...  1030   0.0  
KNAG0H02010 Chr8 (354923..357004) [2082 bp, 693 aa] {ON} Anc_2.2...  1025   0.0  
KAFR0H03320 Chr8 (633105..635213) [2109 bp, 702 aa] {ON} Anc_2.2...  1009   0.0  
Kpol_1039.32 s1039 (99859..101838) [1980 bp, 659 aa] {ON} (99859...   968   0.0  
TPHA0C03390 Chr3 complement(743315..745420) [2106 bp, 701 aa] {O...   927   0.0  
TBLA0B06950 Chr2 complement(1643756..1646143) [2388 bp, 795 aa] ...   721   0.0  
Kpol_1003.37 s1003 complement(91621..92301,92861..92869,92912..9...   478   e-161
SAKL0H25124g Chr8 (2184039..2185385) [1347 bp, 448 aa] {ON} high...   145   5e-37
TPHA0H00320 Chr8 complement(62605..63957) [1353 bp, 450 aa] {ON}...   145   7e-37
KAFR0C02920 Chr3 complement(584668..586029) [1362 bp, 453 aa] {O...   145   7e-37
AFR172C Chr6 complement(754470..755819) [1350 bp, 449 aa] {ON} S...   141   1e-35
Kpol_246.5 s246 (11759..13120) [1362 bp, 453 aa] {ON} (11759..13...   141   2e-35
KLTH0E06446g Chr5 complement(594807..596156) [1350 bp, 449 aa] {...   140   3e-35
NCAS0B05480 Chr2 complement(1033624..1034979) [1356 bp, 451 aa] ...   140   4e-35
TBLA0D02140 Chr4 complement(539873..541243) [1371 bp, 456 aa] {O...   140   6e-35
KLLA0F09119g Chr6 (848467..849825) [1359 bp, 452 aa] {ON} highly...   140   7e-35
Ecym_2346 Chr2 complement(678792..680249) [1458 bp, 485 aa] {ON}...   140   9e-35
Kwal_55.20790 s55 complement(559958..561307) [1350 bp, 449 aa] {...   139   1e-34
ZYRO0G19316g Chr7 (1600375..1601721) [1347 bp, 448 aa] {ON} high...   138   2e-34
TDEL0B04580 Chr2 complement(817368..818708) [1341 bp, 446 aa] {O...   137   3e-34
CAGL0A03322g Chr1 (338516..339868) [1353 bp, 450 aa] {ON} highly...   136   9e-34
YGL194C Chr7 complement(140368..141726) [1359 bp, 452 aa] {ON}  ...   136   1e-33
Smik_7.79 Chr7 complement(134747..136105) [1359 bp, 452 aa] {ON}...   135   2e-33
Skud_7.79 Chr7 complement(146016..147374) [1359 bp, 452 aa] {ON}...   135   2e-33
NDAI0B02710 Chr2 (674610..675971) [1362 bp, 453 aa] {ON} Anc_8.153    135   3e-33
KNAG0G01350 Chr7 (300791..302146) [1356 bp, 451 aa] {ON} Anc_8.1...   134   5e-33
Suva_7.71 Chr7 complement(135837..137195) [1359 bp, 452 aa] {ON}...   132   2e-32
Suva_14.11 Chr14 complement(13144..14445) [1302 bp, 433 aa] {ON}...   132   3e-32
KLTH0F19668g Chr6 (1595709..1597007) [1299 bp, 432 aa] {ON} high...   131   4e-32
KNAG0A01160 Chr1 complement(7229..8530) [1302 bp, 433 aa] {ON} A...   130   5e-32
Skud_14.11 Chr14 complement(11451..12752) [1302 bp, 433 aa] {ON}...   130   6e-32
NDAI0G03740 Chr7 complement(900866..902167) [1302 bp, 433 aa] {O...   130   6e-32
TBLA0I00560 Chr9 (100393..101694) [1302 bp, 433 aa] {ON} Anc_3.8...   130   9e-32
TPHA0A00300 Chr1 complement(40868..42169) [1302 bp, 433 aa] {ON}...   130   9e-32
NCAS0C04320 Chr3 (887622..888926) [1305 bp, 434 aa] {ON} Anc_3.8      130   1e-31
Kwal_55.22142 s55 (1130691..1131989) [1299 bp, 432 aa] {ON} YNL3...   130   1e-31
Kpol_1038.11 s1038 complement(25267..26568) [1302 bp, 433 aa] {O...   130   1e-31
CAGL0B01441g Chr2 complement(130216..131517) [1302 bp, 433 aa] {...   130   1e-31
AGR395W Chr7 (1455659..1456960) [1302 bp, 433 aa] {ON} Syntenic ...   129   1e-31
KAFR0A08630 Chr1 (1731077..1732378) [1302 bp, 433 aa] {ON} Anc_3...   129   1e-31
Ecym_2010 Chr2 complement(12699..14000) [1302 bp, 433 aa] {ON} s...   129   1e-31
ZYRO0C03498g Chr3 (278064..279365) [1302 bp, 433 aa] {ON} highly...   129   2e-31
SAKL0C13706g Chr3 (1207800..1209101) [1302 bp, 433 aa] {ON} high...   129   2e-31
Smik_14.2 Chr14 complement(2435..3736) [1302 bp, 433 aa] {ON} YN...   128   4e-31
YNL330C Chr14 complement(18001..19302) [1302 bp, 433 aa] {ON}  R...   128   4e-31
KLLA0E01981g Chr5 complement(186177..187475) [1299 bp, 432 aa] {...   128   5e-31
TDEL0A00270 Chr1 complement(44950..46251) [1302 bp, 433 aa] {ON}...   127   8e-31
TDEL0C05040 Chr3 complement(901798..903162) [1365 bp, 454 aa] {O...    80   4e-15
CAGL0D01430g Chr4 (158990..160327) [1338 bp, 445 aa] {ON} simila...    80   6e-15
Suva_16.396 Chr16 complement(689796..691229) [1434 bp, 477 aa] {...    79   1e-14
SAKL0B07854g Chr2 complement(669743..671212) [1470 bp, 489 aa] {...    78   2e-14
Ecym_8290 Chr8 complement(589795..591924) [2130 bp, 709 aa] {ON}...    77   5e-14
Skud_16.353 Chr16 complement(647799..649214) [1416 bp, 471 aa] {...    77   5e-14
NDAI0A05120 Chr1 (1164314..1165840) [1527 bp, 508 aa] {ON} Anc_3...    77   6e-14
Kwal_23.3724 s23 (406773..408194) [1422 bp, 473 aa] {ON} YPR068C...    76   7e-14
KLTH0F10582g Chr6 (910298..911722) [1425 bp, 474 aa] {ON} simila...    76   7e-14
YPR068C Chr16 complement(682941..684353) [1413 bp, 470 aa] {ON} ...    76   9e-14
TDEL0A05520 Chr1 complement(970572..972596) [2025 bp, 674 aa] {O...    76   1e-13
KNAG0H00630 Chr8 (105506..106876) [1371 bp, 456 aa] {ON} Anc_3.3...    75   2e-13
Kpol_376.15 s376 complement(25558..27114) [1557 bp, 518 aa] {ON}...    75   2e-13
Smik_16.309 Chr16 complement(559713..561125) [1413 bp, 470 aa] {...    74   3e-13
ADL339W Chr4 (110772..112085) [1314 bp, 437 aa] {ON} Syntenic ho...    74   3e-13
ZYRO0C16390g Chr3 complement(1274651..1275961) [1311 bp, 436 aa]...    74   3e-13
NCAS0A11180 Chr1 complement(2216701..2218173) [1473 bp, 490 aa] ...    74   4e-13
KLLA0B09394g Chr2 (822629..823954) [1326 bp, 441 aa] {ON} simila...    74   5e-13
TBLA0B02390 Chr2 (558067..559806) [1740 bp, 579 aa] {ON} Anc_3.3...    74   6e-13
KAFR0H00890 Chr8 (167453..168877) [1425 bp, 474 aa] {ON} Anc_3.3...    72   1e-12
ZYRO0F10780g Chr6 complement(879680..881686) [2007 bp, 668 aa] {...    73   2e-12
Ecym_3465 Chr3 (874618..875955) [1338 bp, 445 aa] {ON} similar t...    70   6e-12
Kpol_479.6 s479 complement(10892..12958) [2067 bp, 688 aa] {ON} ...    70   9e-12
YPL116W Chr16 (329606..331699) [2094 bp, 697 aa] {ON}  HOS3Trich...    70   2e-11
KAFR0H02790 Chr8 complement(531813..533966) [2154 bp, 717 aa] {O...    68   5e-11
KLTH0D09592g Chr4 complement(792708..794825) [2118 bp, 705 aa] {...    67   7e-11
SAKL0H08338g Chr8 (716414..718486) [2073 bp, 690 aa] {ON} simila...    67   7e-11
TBLA0E04080 Chr5 complement(1026669..1028753) [2085 bp, 694 aa] ...    67   1e-10
Smik_6.315 Chr6 complement(492590..494683) [2094 bp, 697 aa] {ON...    67   1e-10
ADL265W Chr4 (237911..239995) [2085 bp, 694 aa] {ON} Syntenic ho...    67   1e-10
Suva_16.194 Chr16 (339127..341226) [2100 bp, 699 aa] {ON} YPL116...    67   1e-10
KNAG0J01300 Chr10 (232784..234817) [2034 bp, 677 aa] {ON} Anc_8....    66   2e-10
KLLA0F00858g Chr6 complement(78519..80666) [2148 bp, 715 aa] {ON...    65   3e-10
TPHA0A01120 Chr1 (216522..218618) [2097 bp, 698 aa] {ON} Anc_8.6...    65   3e-10
Skud_16.164 Chr16 (301141..303234) [2094 bp, 697 aa] {ON} YPL116...    64   8e-10
Kwal_26.8505 s26 complement(815901..818027) [2127 bp, 708 aa] {O...    64   1e-09
NDAI0E02480 Chr5 (512966..515020) [2055 bp, 684 aa] {ON} Anc_8.6...    63   2e-09
CAGL0J06974g Chr10 (667811..669847) [2037 bp, 678 aa] {ON} highl...    63   2e-09
TPHA0M01590 Chr13 complement(332934..334418) [1485 bp, 494 aa] {...    60   1e-08
NCAS0C01760 Chr3 (324446..326548) [2103 bp, 700 aa] {ON} Anc_8.6...    60   1e-08
Smik_16.223 Chr16 (406804..410484) [3681 bp, 1226 aa] {ON} YPL01...    39   0.076
YPL095C Chr16 complement(368071..369441) [1371 bp, 456 aa] {ON} ...    33   2.2  
Smik_16.142 Chr16 complement(251287..252657) [1371 bp, 456 aa] {...    32   4.8  
Smik_6.260 Chr6 (417812..419335) [1524 bp, 507 aa] {ON} YGR155W ...    32   6.1  

>ADL216C Chr4 complement(324197..326314) [2118 bp, 705 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL021W
           (HDA1)
          Length = 705

 Score = 1433 bits (3710), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 689/705 (97%), Positives = 689/705 (97%)

Query: 1   MEERTQQKRKLEEGSPDGEANGGQASRKAXXXXXXXXXXXXXXXXSYVPLKTGLCYDVRM 60
           MEERTQQKRKLEEGSPDGEANGGQASRKA                SYVPLKTGLCYDVRM
Sbjct: 1   MEERTQQKRKLEEGSPDGEANGGQASRKAIVQKRPVIVPPVRPKISYVPLKTGLCYDVRM 60

Query: 61  RYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGIDEIGELMQKIPVREA 120
           RYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGIDEIGELMQKIPVREA
Sbjct: 61  RYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGIDEIGELMQKIPVREA 120

Query: 121 TEEEILTVHSKEHVEFLKTTNTMDREQLLKETEAGDSVYYNNDSLISARLSCGGAIEACK 180
           TEEEILTVHSKEHVEFLKTTNTMDREQLLKETEAGDSVYYNNDSLISARLSCGGAIEACK
Sbjct: 121 TEEEILTVHSKEHVEFLKTTNTMDREQLLKETEAGDSVYYNNDSLISARLSCGGAIEACK 180

Query: 181 AVVEGRVKNAMAVVRPPGHHAEPGVAGGFCLFSNVAVAAQNILKNYPESVRRVMILDWDI 240
           AVVEGRVKNAMAVVRPPGHHAEPGVAGGFCLFSNVAVAAQNILKNYPESVRRVMILDWDI
Sbjct: 181 AVVEGRVKNAMAVVRPPGHHAEPGVAGGFCLFSNVAVAAQNILKNYPESVRRVMILDWDI 240

Query: 241 HHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKGEGFNCNIPWSCSGV 300
           HHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKGEGFNCNIPWSCSGV
Sbjct: 241 HHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKGEGFNCNIPWSCSGV 300

Query: 301 GDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHLTHMLKSLA 360
           GDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHLTHMLKSLA
Sbjct: 301 GDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHLTHMLKSLA 360

Query: 361 RGNMCVVLEGGYNLDSIAKSALGVAKVLIGEPPDELPQPLKQPKPEAIVTIDMGLVKEQS 420
           RGNMCVVLEGGYNLDSIAKSALGVAKVLIGEPPDELPQPLKQPKPEAIVTIDMGLVKEQS
Sbjct: 361 RGNMCVVLEGGYNLDSIAKSALGVAKVLIGEPPDELPQPLKQPKPEAIVTIDMGLVKEQS 420

Query: 421 KYWNCFKGRHGNDGINWREGAVNDSLTSKNFPLQKCCSPTTQFRRLAKEYKFVTLPLLNM 480
           KYWNCFKGRHGNDGINWREGAVNDSLTSKNFPLQKCCSPTTQFRRLAKEYKFVTLPLLNM
Sbjct: 421 KYWNCFKGRHGNDGINWREGAVNDSLTSKNFPLQKCCSPTTQFRRLAKEYKFVTLPLLNM 480

Query: 481 ELPSDTIICSPNIHTTDAIIICVHDTPEIWAQRDSLTGHIDPSTSIIVDTTVSVINWALG 540
           ELPSDTIICSPNIHTTDAIIICVHDTPEIWAQRDSLTGHIDPSTSIIVDTTVSVINWALG
Sbjct: 481 ELPSDTIICSPNIHTTDAIIICVHDTPEIWAQRDSLTGHIDPSTSIIVDTTVSVINWALG 540

Query: 541 RNYGVIDINIPQSLFEQDNYSAVLSSQEVVTYLWDSYLKTFPHLARVAFVGIGDAYSGFV 600
           RNYGVIDINIPQSLFEQDNYSAVLSSQEVVTYLWDSYLKTFPHLARVAFVGIGDAYSGFV
Sbjct: 541 RNYGVIDINIPQSLFEQDNYSAVLSSQEVVTYLWDSYLKTFPHLARVAFVGIGDAYSGFV 600

Query: 601 HLLGHRDTRSVVKCAIAFADKKQLRPLVPLVDESLGDWYFKNSLVFTSTYHPCWGTDGND 660
           HLLGHRDTRSVVKCAIAFADKKQLRPLVPLVDESLGDWYFKNSLVFTSTYHPCWGTDGND
Sbjct: 601 HLLGHRDTRSVVKCAIAFADKKQLRPLVPLVDESLGDWYFKNSLVFTSTYHPCWGTDGND 660

Query: 661 SKKPRKKFGRVLRWTCDGMNNIVEERLEEATDFILDSFEEWSESE 705
           SKKPRKKFGRVLRWTCDGMNNIVEERLEEATDFILDSFEEWSESE
Sbjct: 661 SKKPRKKFGRVLRWTCDGMNNIVEERLEEATDFILDSFEEWSESE 705

>Ecym_3324 Chr3 complement(620836..622956) [2121 bp, 706 aa] {ON}
           similar to Ashbya gossypii ADL216C
          Length = 706

 Score = 1205 bits (3117), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 575/709 (81%), Positives = 627/709 (88%), Gaps = 7/709 (0%)

Query: 1   MEERTQQKRKLEEGSPD--GEANGGQASRKAXXXXXXX--XXXXXXXXXSYVPLKTGLCY 56
           M + ++QKRKLE    D  G  N   A  K                    YVPLKTGLCY
Sbjct: 1   MNQESKQKRKLEIDGNDTIGVENMKTAVSKLTVAQQKRPIIVPVVKPKIHYVPLKTGLCY 60

Query: 57  DVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGIDEIGELMQKIP 116
           DVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSG+D+IG LM KIP
Sbjct: 61  DVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGVDDIGNLMLKIP 120

Query: 117 VREATEEEILTVHSKEHVEFLKTTNTMDREQLLKETEAGDSVYYNNDSLISARLSCGGAI 176
           +REATE+EIL VHSKEHVEFLKTTNTM REQLLKETEAGDSVYYNNDSL+SA+LSCGGAI
Sbjct: 121 IREATEDEILLVHSKEHVEFLKTTNTMSREQLLKETEAGDSVYYNNDSLVSAKLSCGGAI 180

Query: 177 EACKAVVEGRVKNAMAVVRPPGHHAEPGVAGGFCLFSNVAVAAQNILKNYPESVRRVMIL 236
           EACKAVVEGRVKNA+AVVRPPGHHAEP VAGGFCLFSNVAVAA+NILKNYPESVR+VMIL
Sbjct: 181 EACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKVMIL 240

Query: 237 DWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKGEGFNCNIPWS 296
           DWDIHHGNGTQ+AFY DNRVLYVSLHRYELG+YYPGT YGNY+Q G+GKGEGFNCNIPWS
Sbjct: 241 DWDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPGTEYGNYNQSGEGKGEGFNCNIPWS 300

Query: 297 CSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHLTHML 356
           C GVGDAEYMWAFEQ+VIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGH+THML
Sbjct: 301 CGGVGDAEYMWAFEQIVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHMTHML 360

Query: 357 KSLARGNMCVVLEGGYNLDSIAKSALGVAKVLIGEPPDELPQPLKQPKPEAIVTIDMGLV 416
           KSLA+GNMCVVLEGGYNLDSIAKSALGV KVLIGEPPDELP P KQPKPEAI TI+  ++
Sbjct: 361 KSLAKGNMCVVLEGGYNLDSIAKSALGVVKVLIGEPPDELPDPFKQPKPEAIATIET-VI 419

Query: 417 KEQSKYWNCFKGRHGNDGINWREGAVNDSLTSKNFPLQKCCSPTTQFRRLAKEYKFVTLP 476
           +EQ+KYW+CFK +HGN G+NW+E  V++SLT KNFPLQ       QFRRL+KEYKFVTLP
Sbjct: 420 REQAKYWDCFKSKHGNCGVNWKE-PVDESLTFKNFPLQSAVR-QEQFRRLSKEYKFVTLP 477

Query: 477 LLNMELPSDTIICSPNIHTTDAIIICVHDTPEIWAQRDSLTGHIDPSTSIIVDTTVSVIN 536
           LL+MEL  DTIICSPNIH TD +IICVHDTPE+WA+R+ LTG+IDPSTSIIVDTT+S+ N
Sbjct: 478 LLDMELSGDTIICSPNIHETDTLIICVHDTPEVWAKRNPLTGYIDPSTSIIVDTTLSITN 537

Query: 537 WALGRNYGVIDINIPQSLFEQDNYSAVLSSQEVVTYLWDSYLKTFPHLARVAFVGIGDAY 596
           WALGR+YG+IDINIPQSLFE DNYSAVL+SQEV++YLWD YLK F  L RVAFVGIGDAY
Sbjct: 538 WALGRSYGIIDINIPQSLFELDNYSAVLTSQEVLSYLWDHYLKFFAQLTRVAFVGIGDAY 597

Query: 597 SGFVHLLGHRDTRSVVKCAIAFADKKQLRPLVPLVDESLGDWYFKNSLVFTSTYHPCWGT 656
           SGFVHLLGHRDTRS+VKCAI+F DKKQLRPLVPLVDES+ DWYFKNSL+FTS YH CWGT
Sbjct: 598 SGFVHLLGHRDTRSIVKCAISFTDKKQLRPLVPLVDESISDWYFKNSLIFTSKYHSCWGT 657

Query: 657 DGNDSKKPRKKFGRVLRWTCDGMNNIVEERLEEATDFILDSFEEWSESE 705
           +GNDSKKPRKKFGRVL+   DGMNNI+EER EEATDFILDSFEEWS+SE
Sbjct: 658 EGNDSKKPRKKFGRVLKCNSDGMNNILEERFEEATDFILDSFEEWSDSE 706

>SAKL0E07700g Chr5 (622822..624960) [2139 bp, 712 aa] {ON} highly
           similar to uniprot|P53973 Saccharomyces cerevisiae
           YNL021W HDA1 Putative catalytic subunit of a class II
           histone deacetylase complex that also contains Hda2p and
           Hda3p Hda1p interacts with the Hda2p-Hda3p subcomplex to
           form an active tetramer deletion increases histone H2B
           H3 and H4 acetylation
          Length = 712

 Score = 1124 bits (2908), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 520/659 (78%), Positives = 589/659 (89%), Gaps = 3/659 (0%)

Query: 47  YVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGID 106
           Y  LKTGLCYDVRMRYHAKI+TSYFEYIDPHPEDPRRIYRIYKILAENGLI DPTLSG+D
Sbjct: 57  YTQLKTGLCYDVRMRYHAKIYTSYFEYIDPHPEDPRRIYRIYKILAENGLIRDPTLSGVD 116

Query: 107 EIGELMQKIPVREATEEEILTVHSKEHVEFLKTTNTMDREQLLKETEAGDSVYYNNDSLI 166
           EIGELM KIPVREAT EEIL VH+KEH+ FL+ T  M REQLLKETE GDSVY+NNDSL+
Sbjct: 117 EIGELMLKIPVREATAEEILQVHTKEHLAFLEKTPKMTREQLLKETETGDSVYFNNDSLL 176

Query: 167 SARLSCGGAIEACKAVVEGRVKNAMAVVRPPGHHAEPGVAGGFCLFSNVAVAAQNILKNY 226
           SA+LSCGGAIEACKAVVEGRVKNA+AV+RPPGHHAEP +AGGFCLFSNVAVAAQNILKNY
Sbjct: 177 SAKLSCGGAIEACKAVVEGRVKNALAVIRPPGHHAEPEIAGGFCLFSNVAVAAQNILKNY 236

Query: 227 PESVRRVMILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKG 286
           PESVRR+MILDWDIHHGNGTQKAFY DNRVLYVSLHRYELGKYYPGT +GNY+Q G+GKG
Sbjct: 237 PESVRRIMILDWDIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTVHGNYEQTGEGKG 296

Query: 287 EGFNCNIPWSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSP 346
           EGFNCNIPW   G+GDAEYMWAF+QVV+PMGREFQPDLVIISSGFDAADGDTIGQCHVSP
Sbjct: 297 EGFNCNIPWPYGGLGDAEYMWAFQQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVSP 356

Query: 347 ACYGHLTHMLKSLARGNMCVVLEGGYNLDSIAKSALGVAKVLIGEPPDELPQPLKQPKPE 406
           +CYGH+THMLKSLARGN+CVVLEGGYNLDSIAKSALGVAK+LIGEPPDELP P +QPKPE
Sbjct: 357 SCYGHMTHMLKSLARGNLCVVLEGGYNLDSIAKSALGVAKILIGEPPDELPHPTQQPKPE 416

Query: 407 AIVTIDMGLVKEQSKYWNCFKGRHGNDGINWREGAVNDSLTSKNFPLQKCCSPTTQFRRL 466
           AI TI+  +++ QSKYWNCFK  H NDG N++E  V +S  SKNFPLQ+      Q ++L
Sbjct: 417 AIETIET-VIRTQSKYWNCFKSTHSNDGCNFKE-EVTESTISKNFPLQQAIR-QEQLQQL 473

Query: 467 AKEYKFVTLPLLNMELPSDTIICSPNIHTTDAIIICVHDTPEIWAQRDSLTGHIDPSTSI 526
           ++++ FVTLPLLNME+P DT+ICSPNI+  + +++CVHDTPEIWAQR+ +TG IDPSTSI
Sbjct: 474 SEKFGFVTLPLLNMEVPQDTVICSPNIYDAETVVVCVHDTPEIWAQRNPITGTIDPSTSI 533

Query: 527 IVDTTVSVINWALGRNYGVIDINIPQSLFEQDNYSAVLSSQEVVTYLWDSYLKTFPHLAR 586
           IVDTT+ +I W+L R Y VID+NIPQSLFEQDNYSA+++SQEV+ Y+WD+YLK FP LA+
Sbjct: 534 IVDTTLDIIKWSLQRKYSVIDVNIPQSLFEQDNYSAMITSQEVLVYIWDNYLKYFPSLAK 593

Query: 587 VAFVGIGDAYSGFVHLLGHRDTRSVVKCAIAFADKKQLRPLVPLVDESLGDWYFKNSLVF 646
           VAF+G+GDAYSG VHLLGHRDTRSVVK A++F D K L+ LVPLVDESLG+WYFKNSLVF
Sbjct: 594 VAFIGVGDAYSGIVHLLGHRDTRSVVKAAVSFVDTKPLKSLVPLVDESLGNWYFKNSLVF 653

Query: 647 TSTYHPCWGTDGNDSKKPRKKFGRVLRWTCDGMNNIVEERLEEATDFILDSFEEWSESE 705
           TS  H CWGTDGN++KKPRK+FGRVL+    GMNNIVEER +EATDFILDSFEEWS+SE
Sbjct: 654 TSKNHSCWGTDGNENKKPRKRFGRVLKCDTTGMNNIVEERFQEATDFILDSFEEWSDSE 712

>KLTH0G10340g Chr7 complement(874566..876692) [2127 bp, 708 aa] {ON}
           highly similar to uniprot|P53973 Saccharomyces
           cerevisiae YNL021W HDA1 Putative catalytic subunit of a
           class II histone deacetylase complex that also contains
           Hda2p and Hda3p Hda1p interacts with the Hda2p-Hda3p
           subcomplex to form an active tetramer deletion increases
           histone H2B H3 and H4 acetylation
          Length = 708

 Score = 1083 bits (2800), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 506/659 (76%), Positives = 575/659 (87%), Gaps = 4/659 (0%)

Query: 47  YVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGID 106
           Y PLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLI+DPTLSG+D
Sbjct: 54  YTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPTLSGVD 113

Query: 107 EIGELMQKIPVREATEEEILTVHSKEHVEFLKTTNTMDREQLLKETEAGDSVYYNNDSLI 166
            IG+LM KIPVREAT+EEIL VH+KEH+EF+  T +M R+QLLKETE GDSVY+NNDS +
Sbjct: 114 SIGDLMLKIPVREATDEEILQVHTKEHLEFISKTTSMTRDQLLKETEKGDSVYFNNDSYL 173

Query: 167 SARLSCGGAIEACKAVVEGRVKNAMAVVRPPGHHAEPGVAGGFCLFSNVAVAAQNILKNY 226
           SA+LSCGGAIEACKAVVEGRVKNA+AVVRPPGHHAEP VAGGFCLFSNVAVAAQNILKNY
Sbjct: 174 SAKLSCGGAIEACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAAQNILKNY 233

Query: 227 PESVRRVMILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKG 286
           PESVR++M+LDWD+HHGNGTQKAFY D+RVLY+SLHR+ELGKYYPGT +GN D+ G+GKG
Sbjct: 234 PESVRKIMVLDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEGKG 293

Query: 287 EGFNCNIPWSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSP 346
           EGFNCNIPW   GVGD+EY+WAFEQV++PMGREF+PDLVIISSGFDAADGDT+GQCHV+P
Sbjct: 294 EGFNCNIPWPWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQCHVTP 353

Query: 347 ACYGHLTHMLKSLARGNMCVVLEGGYNLDSIAKSALGVAKVLIGEPPDELPQPLKQPKPE 406
           +CYGH+THMLKSLARGN+C VLEGGY+LDSIAKSAL VAKVLIGEPPDELP  +KQPK E
Sbjct: 354 SCYGHMTHMLKSLARGNLCAVLEGGYSLDSIAKSALAVAKVLIGEPPDELPV-VKQPKLE 412

Query: 407 AIVTIDMGLVKEQSKYWNCFKGRHGNDGINWREGAVNDSLTSKNFPLQKCCSPTTQFRRL 466
           A+  ID  ++K QSKYW CFK  HGNDG +++E A  D+  +KNFPLQ       Q R L
Sbjct: 413 AVEVID-SVIKTQSKYWKCFKSTHGNDGCSFKEQAT-DTAINKNFPLQNAIR-QQQMRLL 469

Query: 467 AKEYKFVTLPLLNMELPSDTIICSPNIHTTDAIIICVHDTPEIWAQRDSLTGHIDPSTSI 526
           A E++FVTLPL   ELP DT ICSPNI+   AII+CVHDTP IWAQR   TG IDPSTSI
Sbjct: 470 ANEFRFVTLPLFKKELPDDTAICSPNIYDASAIIVCVHDTPSIWAQRSRATGTIDPSTSI 529

Query: 527 IVDTTVSVINWALGRNYGVIDINIPQSLFEQDNYSAVLSSQEVVTYLWDSYLKTFPHLAR 586
           IVDTT+ VI WA  RNYGVIDINIPQSL EQDNYSAV+++QEV+ ++WD+YLK FP L R
Sbjct: 530 IVDTTLDVIKWASSRNYGVIDINIPQSLHEQDNYSAVITAQEVLVHIWDNYLKYFPSLNR 589

Query: 587 VAFVGIGDAYSGFVHLLGHRDTRSVVKCAIAFADKKQLRPLVPLVDESLGDWYFKNSLVF 646
           VAFV IGDA+SG VHLLGHRDTRSVVK A++F D++ LRPL+PLVDE+L DWYFKNSLVF
Sbjct: 590 VAFVAIGDAHSGVVHLLGHRDTRSVVKSAVSFVDQRPLRPLIPLVDETLADWYFKNSLVF 649

Query: 647 TSTYHPCWGTDGNDSKKPRKKFGRVLRWTCDGMNNIVEERLEEATDFILDSFEEWSESE 705
            S  H CWG DGN++KKPRKKFGRVL+   DG+NNI+EER EEATDFILD+FEEWS+SE
Sbjct: 650 ASAEHTCWGNDGNENKKPRKKFGRVLKCDSDGINNILEERFEEATDFILDTFEEWSDSE 708

>Kwal_27.11537 s27 (839198..841324) [2127 bp, 708 aa] {ON} YNL021W
           (HDA1) - histone deacetylase, shares sequence similarity
           with Rpd3p, Hos1p, Hos2p, and Hos3p [contig 27] FULL
          Length = 708

 Score = 1082 bits (2797), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 509/659 (77%), Positives = 575/659 (87%), Gaps = 4/659 (0%)

Query: 47  YVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGID 106
           Y PLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLI DPTLSG+D
Sbjct: 54  YTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIIDPTLSGVD 113

Query: 107 EIGELMQKIPVREATEEEILTVHSKEHVEFLKTTNTMDREQLLKETEAGDSVYYNNDSLI 166
           +IG+LM KIP REAT+EEIL VH+ EH+EFL  T +M REQLLKETE GDSVY+NNDS +
Sbjct: 114 DIGDLMLKIPAREATDEEILQVHTPEHLEFLSKTTSMTREQLLKETEKGDSVYFNNDSYL 173

Query: 167 SARLSCGGAIEACKAVVEGRVKNAMAVVRPPGHHAEPGVAGGFCLFSNVAVAAQNILKNY 226
           SA+LSCGGAIEAC+AVVEGRVKNA+AVVRPPGHHAEP +AGGFCLFSNVAVAAQNILKNY
Sbjct: 174 SAKLSCGGAIEACRAVVEGRVKNALAVVRPPGHHAEPDLAGGFCLFSNVAVAAQNILKNY 233

Query: 227 PESVRRVMILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKG 286
           PESV+++MILDWD+HHGNGTQKAFY D+RVLYVSLHR+ELGKYYPGT +GN D+ G+GKG
Sbjct: 234 PESVKKIMILDWDVHHGNGTQKAFYNDDRVLYVSLHRHELGKYYPGTIHGNADRVGEGKG 293

Query: 287 EGFNCNIPWSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSP 346
           EGFNCNIPW   GVGDAEY+WAFEQVV+PMGREFQPDLVIISSGFDAADGDT+GQCHV+P
Sbjct: 294 EGFNCNIPWPWKGVGDAEYIWAFEQVVLPMGREFQPDLVIISSGFDAADGDTVGQCHVTP 353

Query: 347 ACYGHLTHMLKSLARGNMCVVLEGGYNLDSIAKSALGVAKVLIGEPPDELPQPLKQPKPE 406
           +CYGH+THMLKSLARGN+C VLEGGY+LDSIAKSALGVAKVLIGEPPDELP  +KQPKPE
Sbjct: 354 SCYGHMTHMLKSLARGNICAVLEGGYSLDSIAKSALGVAKVLIGEPPDELPV-VKQPKPE 412

Query: 407 AIVTIDMGLVKEQSKYWNCFKGRHGNDGINWREGAVNDSLTSKNFPLQKCCSPTTQFRRL 466
           A+  ID  ++K QS+YW CFK  H NDG +++E  V ++L ++NFPLQ       Q R L
Sbjct: 413 AVEVID-AVIKMQSRYWQCFKSTHANDGCSFKE-PVTETLLNRNFPLQTAIR-QQQVRLL 469

Query: 467 AKEYKFVTLPLLNMELPSDTIICSPNIHTTDAIIICVHDTPEIWAQRDSLTGHIDPSTSI 526
             EY FVTLPL+  ELP DT +CSPNI+ + +II+CVHDTPEIWAQR   TG IDPSTSI
Sbjct: 470 TTEYNFVTLPLIKKELPDDTALCSPNIYDSQSIIVCVHDTPEIWAQRSRATGTIDPSTSI 529

Query: 527 IVDTTVSVINWALGRNYGVIDINIPQSLFEQDNYSAVLSSQEVVTYLWDSYLKTFPHLAR 586
           IVDTT+ VI WA  RNYGVIDINIPQSL EQDNYSAVL++QEV+ Y+WDSYLK F  L++
Sbjct: 530 IVDTTLDVIKWASKRNYGVIDINIPQSLHEQDNYSAVLTAQEVLVYIWDSYLKYFTSLSK 589

Query: 587 VAFVGIGDAYSGFVHLLGHRDTRSVVKCAIAFADKKQLRPLVPLVDESLGDWYFKNSLVF 646
           VAFV IGDAYSG VHLLGHRDTR+VVK AI+F D++ LRPLVPLVDESL DWYFKNSLVF
Sbjct: 590 VAFVSIGDAYSGVVHLLGHRDTRNVVKAAISFIDQRPLRPLVPLVDESLADWYFKNSLVF 649

Query: 647 TSTYHPCWGTDGNDSKKPRKKFGRVLRWTCDGMNNIVEERLEEATDFILDSFEEWSESE 705
            S  H CWG DG ++KKPRKKFGRVL+   DG+NNI+EER EEATDFILD+FEEWS+SE
Sbjct: 650 ASAGHTCWGNDGAENKKPRKKFGRVLKCNSDGLNNILEERFEEATDFILDTFEEWSDSE 708

>NCAS0G03800 Chr7 (701547..703727) [2181 bp, 726 aa] {ON} 
          Length = 726

 Score = 1058 bits (2737), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 493/660 (74%), Positives = 572/660 (86%), Gaps = 5/660 (0%)

Query: 46  SYVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGI 105
           SY PLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLI+DPTLSGI
Sbjct: 72  SYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGI 131

Query: 106 DEIGELMQKIPVREATEEEILTVHSKEHVEFLKTTNTMDREQLLKETEAGDSVYYNNDSL 165
           ++IG+LM KIPVR+ATEEEIL VHSKEH +F++ T+TM+RE+LLK TE GDSVY+NNDS 
Sbjct: 132 EDIGDLMLKIPVRDATEEEILEVHSKEHYDFIEKTSTMNREELLKATEKGDSVYFNNDSF 191

Query: 166 ISARLSCGGAIEACKAVVEGRVKNAMAVVRPPGHHAEPGVAGGFCLFSNVAVAAQNILKN 225
            SA+L  GG+IEACKAVVEGRVKN++AVVRPPGHHAEP  AGGFCLFSNVA+AA+NILKN
Sbjct: 192 ASAKLPVGGSIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAIAAKNILKN 251

Query: 226 YPESVRRVMILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGK 285
           YPESVRR+MILDWDIHHGNGTQKAFY D+RVLY+SLHR+ELGKYYPGT  G YDQ G+GK
Sbjct: 252 YPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTINGQYDQTGEGK 311

Query: 286 GEGFNCNIPWSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVS 345
           GEGFNCNI W   GVGDAEY+WAFEQVV+PM REFQPDLVIISSGFDAADGD+IGQCHV+
Sbjct: 312 GEGFNCNITWPVGGVGDAEYIWAFEQVVMPMAREFQPDLVIISSGFDAADGDSIGQCHVT 371

Query: 346 PACYGHLTHMLKSLARGNMCVVLEGGYNLDSIAKSALGVAKVLIGEPPDELPQPLKQPKP 405
           P+CYGH+THMLKSLA+GN+CVVLEGGYNLD+IA+SAL VAK+LIGEPPDELP PL+ PKP
Sbjct: 372 PSCYGHMTHMLKSLAKGNLCVVLEGGYNLDAIARSALSVAKILIGEPPDELPDPLRDPKP 431

Query: 406 EAIVTIDMGLVKEQSKYWNCFKGRHGNDGINWREGAVNDSLTSKNFPLQKCCSPTTQFRR 465
           EAI  ID  +++ QSKYW CFK R+GN G N+++  +N+SL SKNFPLQ+      Q   
Sbjct: 432 EAIEIID-KVIRLQSKYWKCFKRRYGNAGCNFKD-EINESLISKNFPLQQAIR-EQQLNT 488

Query: 466 LAKEYKFVTLPLLNMELPSDTIICSPNIHTTDAIIICVHDTPEIWAQRDSLTGHIDPSTS 525
           L++++KF TLPLL  ELP DT++CSPN++ +  +IIC HDTPEIWA+RD + G IDPS+S
Sbjct: 489 LSQDFKFATLPLLKPELPKDTVLCSPNVYQSKTVIICAHDTPEIWAKRDVIQGTIDPSSS 548

Query: 526 IIVDTTVSVINWALGRNYGVIDINIPQSLFEQDNYSAVLSSQEVVTYLWDSYLKTFPHLA 585
           IIVD+T+  I WA  + YGVIDINIPQ+LFEQ+NYSA+++SQEV+TY+WD+YLK FP++ 
Sbjct: 549 IIVDSTLDFIKWANEKKYGVIDINIPQNLFEQENYSAIVTSQEVLTYIWDNYLKYFPNVE 608

Query: 586 RVAFVGIGDAYSGFVHLLGHRDTRSVVKCAIAFADKKQLRPLVPLVDESLGDWYFKNSLV 645
           +VAF+GIGDAYSG VHLLGHRDTRSVVK  I F  +KQLR LVPLVDESL DWYFKNSLV
Sbjct: 609 KVAFIGIGDAYSGIVHLLGHRDTRSVVKSVINFIAQKQLRALVPLVDESLSDWYFKNSLV 668

Query: 646 FTSTYHPCWGTDGNDSKKPRKKFGRVLRWTCDGMNNIVEERLEEATDFILDSFEEWSESE 705
           F+   H  WG   N  KKPRKK+GR+LR   DG+NNIVEER EEATDFILDSFEEWS+SE
Sbjct: 669 FSDKSHTYWGDKEN--KKPRKKYGRLLRCETDGINNIVEERFEEATDFILDSFEEWSDSE 726

>KLLA0E08383g Chr5 (754048..756162) [2115 bp, 704 aa] {ON} highly
           similar to uniprot|P53973 Saccharomyces cerevisiae
           YNL021W HDA1 Putative catalytic subunit of a class II
           histone deacetylase complex that also contains Hda2p and
           Hda3p Hda1p interacts with the Hda2p-Hda3p subcomplex to
           form an active tetramer deletion increases histone H2B
           H3 and H4 acetylation
          Length = 704

 Score = 1046 bits (2706), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/659 (72%), Positives = 570/659 (86%), Gaps = 3/659 (0%)

Query: 47  YVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGID 106
           Y  LKTG+CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYR+YKILAENGLI+DPTLSG D
Sbjct: 49  YSLLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLIQDPTLSGAD 108

Query: 107 EIGELMQKIPVREATEEEILTVHSKEHVEFLKTTNTMDREQLLKETEAGDSVYYNNDSLI 166
            IG+LM K+PVREA EEEIL VHS++H++F+  T  ++RE LLKETE GDSVY+NNDS +
Sbjct: 109 SIGDLMVKVPVREAEEEEILQVHSRQHLDFISQTEQLERESLLKETEGGDSVYFNNDSYL 168

Query: 167 SARLSCGGAIEACKAVVEGRVKNAMAVVRPPGHHAEPGVAGGFCLFSNVAVAAQNILKNY 226
           SA+LSCGGAIEACKAVVEGRVKN++AVVRPPGHHAEP +AGGFCLFSNVAVAA N+LK+Y
Sbjct: 169 SAKLSCGGAIEACKAVVEGRVKNSIAVVRPPGHHAEPEIAGGFCLFSNVAVAAANMLKSY 228

Query: 227 PESVRRVMILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKG 286
           PESVR++MI+DWDIHHGNGTQKAFY D+RVLYVSLHRY+LGKYYPGT +GNYDQ G+GKG
Sbjct: 229 PESVRKIMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPGTIHGNYDQTGEGKG 288

Query: 287 EGFNCNIPWSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSP 346
           EGFNCNI W   GVGDAEYMWAFEQV++PMGREF+PDLV+ISSGFDAADGDTIGQCHV+P
Sbjct: 289 EGFNCNITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLISSGFDAADGDTIGQCHVTP 348

Query: 347 ACYGHLTHMLKSLARGNMCVVLEGGYNLDSIAKSALGVAKVLIGEPPDELPQPLKQPKPE 406
           ACYGH+THML SLA+GN+CVVLEGGYNLDSIAKSALGV KVL+GEPPDELP P KQP PE
Sbjct: 349 ACYGHMTHMLLSLAKGNLCVVLEGGYNLDSIAKSALGVCKVLVGEPPDELPAPKKQPTPE 408

Query: 407 AIVTIDMGLVKEQSKYWNCFKGRHGNDGINWREGAVNDSLTSKNFPLQKCCSPTTQFRRL 466
           A   I+  +++ QSKYW+CFK RHGNDGIN+++ A+  +L ++NFPLQ       Q  +L
Sbjct: 409 AKKMIET-VIRTQSKYWSCFKNRHGNDGINFKD-AITSTLDTRNFPLQNAIR-EYQVSQL 465

Query: 467 AKEYKFVTLPLLNMELPSDTIICSPNIHTTDAIIICVHDTPEIWAQRDSLTGHIDPSTSI 526
           + ++ FV LP+L++ LP++T++C+  I  ++ +++ VHDTPEIW++RD+ TG IDPS+SI
Sbjct: 466 SSQFNFVQLPILDLNLPANTMLCTSGIQDSETLVVIVHDTPEIWSERDTQTGIIDPSSSI 525

Query: 527 IVDTTVSVINWALGRNYGVIDINIPQSLFEQDNYSAVLSSQEVVTYLWDSYLKTFPHLAR 586
           IVD  + +INWA+ R YG+IDINIPQ+LFE  NY  V SSQE++ YLWD+YLK F +L +
Sbjct: 526 IVDNALKMINWAMDRRYGIIDINIPQTLFEHANYPGVASSQEILIYLWDNYLKFFQNLQK 585

Query: 587 VAFVGIGDAYSGFVHLLGHRDTRSVVKCAIAFADKKQLRPLVPLVDESLGDWYFKNSLVF 646
           VAF+GIGDAY G VHLLGHRDTRSVVKCAI+F DKK L+ +VPL+DE+LGDWYFKNSLVF
Sbjct: 586 VAFIGIGDAYGGIVHLLGHRDTRSVVKCAISFLDKKPLKVMVPLIDETLGDWYFKNSLVF 645

Query: 647 TSTYHPCWGTDGNDSKKPRKKFGRVLRWTCDGMNNIVEERLEEATDFILDSFEEWSESE 705
           TS+ H CWG+  N++KK RKK+GRVL+  CDGM NI +ER EEATDFILDSFEEWSESE
Sbjct: 646 TSSTHSCWGSTANENKKLRKKYGRVLKADCDGMTNIFDERFEEATDFILDSFEEWSESE 704

>ZYRO0A01870g Chr1 complement(154507..156630) [2124 bp, 707 aa] {ON}
           highly similar to uniprot|P53973 Saccharomyces
           cerevisiae YNL021W HDA1 Putative catalytic subunit of a
           class II histone deacetylase complex that also contains
           Hda2p and Hda3p Hda1p interacts with the Hda2p-Hda3p
           subcomplex to form an active tetramer deletion increases
           histone H2B H3 and H4 acetylation
          Length = 707

 Score = 1043 bits (2698), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 504/706 (71%), Positives = 581/706 (82%), Gaps = 9/706 (1%)

Query: 2   EERTQQKRKLEEGSPDG--EANGGQASRKAXXXXXXXXXXXXXXXXSYVPLKTGLCYDVR 59
           +E    KRKLEE SP+G  E     AS                    Y PLKTGLCYDVR
Sbjct: 9   QEDEGSKRKLEE-SPNGPVEKKPNVASVSNGRQKRQIIVPACEPKIHYTPLKTGLCYDVR 67

Query: 60  MRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGIDEIGELMQKIPVRE 119
           MRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLI DPTLSG D+IGELM KIPVRE
Sbjct: 68  MRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGEDDIGELMLKIPVRE 127

Query: 120 ATEEEILTVHSKEHVEFLKTTNTMDREQLLKETEAGDSVYYNNDSLISARLSCGGAIEAC 179
           AT EE+L VH+KEH+EF++ T+ M+RE+LLKETE GDSVY+N+DS  +A+L CGGAIEAC
Sbjct: 128 ATVEELLQVHTKEHLEFIEKTSQMNREELLKETETGDSVYFNSDSYSAAKLPCGGAIEAC 187

Query: 180 KAVVEGRVKNAMAVVRPPGHHAEPGVAGGFCLFSNVAVAAQNILKNYPESVRRVMILDWD 239
           KAVVEGRVKNA+AV+RPPGHHAEP +AGGFCLFSNVAVAAQNILKNYPESVRR++ILDWD
Sbjct: 188 KAVVEGRVKNALAVIRPPGHHAEPEMAGGFCLFSNVAVAAQNILKNYPESVRRILILDWD 247

Query: 240 IHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKGEGFNCNIPWSCSG 299
           IHHGNGTQKAFY D+RVLY+SLHR+ELGKYYPGT +G YDQ G+GKGEGFNCNI W   G
Sbjct: 248 IHHGNGTQKAFYNDDRVLYISLHRFELGKYYPGTIHGQYDQTGEGKGEGFNCNITWPVGG 307

Query: 300 VGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHLTHMLKSL 359
           VGDAEYM AFEQ+V+PM RE++PDLVIISSGFDAADGDTIGQCHVSP+CYGH+THMLKSL
Sbjct: 308 VGDAEYMLAFEQIVMPMAREYRPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHMLKSL 367

Query: 360 ARGNMCVVLEGGYNLDSIAKSALGVAKVLIGEPPDELPQPLKQPKPEAIVTIDMGLVKEQ 419
           ARGN+CV LEGGYNLD+IA SAL VAK+LIGEPP+ELP P K PK EAI  ID  ++  Q
Sbjct: 368 ARGNLCVALEGGYNLDAIATSALSVAKILIGEPPEELPDPSKNPKLEAIEMIDK-VIHVQ 426

Query: 420 SKYWNCFKGRHGNDGINWREGAVNDSLTSKNFPLQKCCSPTTQFRRLAKEYKFVTLPLLN 479
           SKYW CF+ R GN G N++E  V +SL +KNFPLQK      QF +L KEY FVTLP+  
Sbjct: 427 SKYWKCFR-RLGNSGCNFKE-PVTESLITKNFPLQKAIR-QEQFHQLEKEYGFVTLPVPK 483

Query: 480 MELPSDTIICSPNIHTTDAIIICVHDTPEIWAQRDSLTGHIDPSTSIIVDTTVSVINWAL 539
           +ELP DT++CSP++     +II VHDTPEIWA+RD +TG IDPSTSI VD+ +  I W+L
Sbjct: 484 LELPEDTVLCSPDVFQESTVIIFVHDTPEIWAKRDVITGMIDPSTSITVDSPLDFIKWSL 543

Query: 540 GRNYGVIDINIPQSLFEQDNYSAVLSSQEVVTYLWDSYLKTFPHLARVAFVGIGDAYSGF 599
            R YGVID+NIPQSLFEQDNYSA+++SQEV+ YLWD+++K FP L++VAFVG+GDAYSG 
Sbjct: 544 ARKYGVIDVNIPQSLFEQDNYSAMITSQEVLIYLWDNFVKYFPSLSKVAFVGVGDAYSGI 603

Query: 600 VHLLGHRDTRSVVKCAIAFADKKQLRPLVPLVDESLGDWYFKNSLVFTSTYHPCWGTDGN 659
           VHLLGHRDTRSVVK  I F  +KQL+PLVPLVDESLGDWYFKNSLVF+   +PCW    N
Sbjct: 604 VHLLGHRDTRSVVKAVINFVGRKQLKPLVPLVDESLGDWYFKNSLVFSDRNNPCWVD--N 661

Query: 660 DSKKPRKKFGRVLRWTCDGMNNIVEERLEEATDFILDSFEEWSESE 705
           ++KKPR+KFGRVLR   DG+NN +EER +EATDFILDSFEEWS+SE
Sbjct: 662 ENKKPRRKFGRVLRCESDGINNNMEERFDEATDFILDSFEEWSDSE 707

>CAGL0J03454g Chr10 complement(332090..334171) [2082 bp, 693 aa]
           {ON} highly similar to uniprot|P53973 Saccharomyces
           cerevisiae YNL021w HDA1 histone deacetylase A
          Length = 693

 Score = 1041 bits (2693), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 484/659 (73%), Positives = 565/659 (85%), Gaps = 5/659 (0%)

Query: 47  YVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGID 106
           Y PLKTG+CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLI DPTLSG++
Sbjct: 40  YTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVN 99

Query: 107 EIGELMQKIPVREATEEEILTVHSKEHVEFLKTTNTMDREQLLKETEAGDSVYYNNDSLI 166
           +IG+LM KIP+R AT EEIL VHSKEH+EF++ T  M+RE+LLKETE GDSVY+NNDS  
Sbjct: 100 DIGDLMLKIPIRAATAEEILEVHSKEHLEFIEKTEKMNREELLKETEKGDSVYFNNDSYA 159

Query: 167 SARLSCGGAIEACKAVVEGRVKNAMAVVRPPGHHAEPGVAGGFCLFSNVAVAAQNILKNY 226
           ++RL CGGAIEACKAVVEGRVKN++AVVRPPGHHAEP  AGGFCLFSNVAVAA+NILKNY
Sbjct: 160 TSRLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPEAAGGFCLFSNVAVAAKNILKNY 219

Query: 227 PESVRRVMILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKG 286
           PESVRR++ILDWD+HHGNGTQKAFY D+RVLY+SLHR+ELGKYYPGT  G YDQ G+GKG
Sbjct: 220 PESVRRILILDWDVHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTIQGQYDQIGEGKG 279

Query: 287 EGFNCNIPWSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSP 346
           +GFNCNI W   GVGDAEYMWAFEQVV+PMGREFQPDLVIISSGFDAADGDTIGQCHV+P
Sbjct: 280 KGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVTP 339

Query: 347 ACYGHLTHMLKSLARGNMCVVLEGGYNLDSIAKSALGVAKVLIGEPPDELPQPLKQPKPE 406
           +CYGH+THMLKSLARGN+CVVLEGGYNLD+IA SAL VAK+LIGEPPDELP PL++PK E
Sbjct: 340 SCYGHMTHMLKSLARGNLCVVLEGGYNLDAIAISALSVAKILIGEPPDELPDPLREPKAE 399

Query: 407 AIVTIDMGLVKEQSKYWNCFKGRHGNDGINWREGAVNDSLTSKNFPLQKCCSPTTQFRRL 466
           A+  ID  ++  QSKYW CF  R+GN G+   E  V   + SK+FPLQ       QF +L
Sbjct: 400 ALEIIDK-VISLQSKYWKCFGKRYGNLGLP-SENVVKALMMSKSFPLQTAIR-QEQFHQL 456

Query: 467 AKEYKFVTLPLLNMELPSDTIICSPNIHTTDAIIICVHDTPEIWAQRDSLTGHIDPSTSI 526
           ++++ FVTLPLLNME+P D++ICSPN+     I++ VHDTPEIWA+R+ +TG IDPSTS+
Sbjct: 457 SEDFGFVTLPLLNMEVPQDSVICSPNLFNETTILVVVHDTPEIWAKRNVITGTIDPSTSL 516

Query: 527 IVDTTVSVINWALGRNYGVIDINIPQSLFEQDNYSAVLSSQEVVTYLWDSYLKTFPHLAR 586
           +VD+    I W L R YG++DINIPQSLFEQ+NY+AVL+SQE++ Y+WD+YLK FP L +
Sbjct: 517 VVDSGAEFIKWGLERKYGIMDINIPQSLFEQENYTAVLTSQEILIYIWDNYLKFFPSLTK 576

Query: 587 VAFVGIGDAYSGFVHLLGHRDTRSVVKCAIAFADKKQLRPLVPLVDESLGDWYFKNSLVF 646
           VAF+GIGDA +G VHLLGHRDTRSVVK  ++F  KK L+PLVPLV+ESLGDWYFKNSLVF
Sbjct: 577 VAFIGIGDASAGIVHLLGHRDTRSVVKSVVSFIGKKSLKPLVPLVNESLGDWYFKNSLVF 636

Query: 647 TSTYHPCWGTDGNDSKKPRKKFGRVLRWTCDGMNNIVEERLEEATDFILDSFEEWSESE 705
           T   H CWG   N+++KPRKKFGRVLR   +GMNNI+EERLEE+TDFILDSFEEWS+SE
Sbjct: 637 TDHSHSCWGD--NENRKPRKKFGRVLRCDAEGMNNIIEERLEESTDFILDSFEEWSDSE 693

>YNL021W Chr14 (593227..595347) [2121 bp, 706 aa] {ON}  HDA1Putative
           catalytic subunit of a class II histone deacetylase
           complex that also contains Hda2p and Hda3p; Hda1p
           interacts with the Hda2p-Hda3p subcomplex to form an
           active tetramer; deletion increases histone H2B, H3 and
           H4 acetylation
          Length = 706

 Score = 1038 bits (2683), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 480/659 (72%), Positives = 563/659 (85%), Gaps = 5/659 (0%)

Query: 47  YVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGID 106
           Y PLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLI DPTLSG+D
Sbjct: 53  YSPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVD 112

Query: 107 EIGELMQKIPVREATEEEILTVHSKEHVEFLKTTNTMDREQLLKETEAGDSVYYNNDSLI 166
           ++G+LM KIPVR AT EEIL VH+KEH+EF+++T  M RE+LLKETE GDSVY+NNDS  
Sbjct: 113 DLGDLMLKIPVRAATSEEILEVHTKEHLEFIESTEKMSREELLKETEKGDSVYFNNDSYA 172

Query: 167 SARLSCGGAIEACKAVVEGRVKNAMAVVRPPGHHAEPGVAGGFCLFSNVAVAAQNILKNY 226
           SARL CGGAIEACKAVVEGRVKN++AVVRPPGHHAEP  AGGFCLFSNVAVAA+NILKNY
Sbjct: 173 SARLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNY 232

Query: 227 PESVRRVMILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKG 286
           PESVRR+MILDWDIHHGNGTQK+FY D++VLYVSLHR+E+GKYYPGT  G YDQ G+GKG
Sbjct: 233 PESVRRIMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQTGEGKG 292

Query: 287 EGFNCNIPWSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSP 346
           EGFNCNI W   GVGDAEYMWAFEQVV+PMGREF+PDLVIISSGFDAADGDTIGQCHV+P
Sbjct: 293 EGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTP 352

Query: 347 ACYGHLTHMLKSLARGNMCVVLEGGYNLDSIAKSALGVAKVLIGEPPDELPQPLKQPKPE 406
           +CYGH+THMLKSLARGN+CVVLEGGYNLD+IA+SAL VAKVLIGEPPDELP PL  PKPE
Sbjct: 353 SCYGHMTHMLKSLARGNLCVVLEGGYNLDAIARSALSVAKVLIGEPPDELPDPLSDPKPE 412

Query: 407 AIVTIDMGLVKEQSKYWNCFKGRHGNDGINWREGAVNDSLTSKNFPLQKCCSPTTQFRRL 466
            I  ID  +++ QSKYWNCF+ RH N G N+ E  +NDS+ SKNFPLQK      Q   L
Sbjct: 413 VIEMID-KVIRLQSKYWNCFRRRHANSGCNFNE-PINDSIISKNFPLQKAIRQQQQ-HYL 469

Query: 467 AKEYKFVTLPLLNMELPSDTIICSPNIHTTDAIIICVHDTPEIWAQRDSLTGHIDPSTSI 526
           + E+ FVTLPL++M+LP +T++C+PNI  ++ III VHDT +IWA+R+ ++G ID S+S+
Sbjct: 470 SDEFNFVTLPLVSMDLPDNTVLCTPNISESNTIIIVVHDTSDIWAKRNVISGTIDLSSSV 529

Query: 527 IVDTTVSVINWALGRNYGVIDINIPQSLFEQDNYSAVLSSQEVVTYLWDSYLKTFPHLAR 586
           I+D ++  I W L R YG+ID+NIP +LFE DNYS +++SQEV+ YLWD+Y+K FP +A+
Sbjct: 530 IIDNSLDFIKWGLDRKYGIIDVNIPLTLFEPDNYSGMITSQEVLIYLWDNYIKYFPSVAK 589

Query: 587 VAFVGIGDAYSGFVHLLGHRDTRSVVKCAIAFADKKQLRPLVPLVDESLGDWYFKNSLVF 646
           +AF+GIGD+YSG VHLLGHRDTR+V K  I F   KQL+PLVPLVDE+L +WYFKNSL+F
Sbjct: 590 IAFIGIGDSYSGIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLSEWYFKNSLIF 649

Query: 647 TSTYHPCWGTDGNDSKKPRKKFGRVLRWTCDGMNNIVEERLEEATDFILDSFEEWSESE 705
           ++  H CW    N+S+KPRKKFGRVLR   DG+NNI+EER EEATDFILDSFEEWS+ E
Sbjct: 650 SNNSHQCWKE--NESRKPRKKFGRVLRCDTDGLNNIIEERFEEATDFILDSFEEWSDEE 706

>NDAI0G00650 Chr7 complement(141981..144050) [2070 bp, 689 aa] {ON}
           Anc_2.285 YNL021W
          Length = 689

 Score = 1033 bits (2671), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 483/659 (73%), Positives = 568/659 (86%), Gaps = 5/659 (0%)

Query: 47  YVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGID 106
           Y PLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLI+DPTLSGID
Sbjct: 36  YTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGID 95

Query: 107 EIGELMQKIPVREATEEEILTVHSKEHVEFLKTTNTMDREQLLKETEAGDSVYYNNDSLI 166
           +IG+LM KIPVREAT EEIL VHSKEH++F+++T+ M+REQLLK TE+GDSVY+N+DS  
Sbjct: 96  DIGDLMLKIPVREATSEEILEVHSKEHLDFIESTSKMNREQLLKATESGDSVYFNSDSYA 155

Query: 167 SARLSCGGAIEACKAVVEGRVKNAMAVVRPPGHHAEPGVAGGFCLFSNVAVAAQNILKNY 226
           SA+L  GGAIEACKAVVEGRVKNA+AVVRPPGHHAEP  AGGFCLFSNVA+AA+NILKNY
Sbjct: 156 SAKLPVGGAIEACKAVVEGRVKNALAVVRPPGHHAEPEAAGGFCLFSNVAIAAKNILKNY 215

Query: 227 PESVRRVMILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKG 286
           PESVR+++ILDWDIHHGNGTQKAFY D+R+LYVSLHR+++GKYYPGT +G YDQ G+GKG
Sbjct: 216 PESVRKILILDWDIHHGNGTQKAFYDDDRILYVSLHRFKMGKYYPGTIHGRYDQTGEGKG 275

Query: 287 EGFNCNIPWSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSP 346
           EGFNCNI W   GVGDAEYMWAFEQ+V+PMGREFQPDLVIIS+GFDAADGDTIGQCHV+P
Sbjct: 276 EGFNCNITWPVGGVGDAEYMWAFEQIVMPMGREFQPDLVIISAGFDAADGDTIGQCHVTP 335

Query: 347 ACYGHLTHMLKSLARGNMCVVLEGGYNLDSIAKSALGVAKVLIGEPPDELPQPLKQPKPE 406
           +CYGH+THMLKSLARGNM VVLEGGYNLDSIA SAL VAK+LIGEPPDELP   + PKPE
Sbjct: 336 SCYGHMTHMLKSLARGNMAVVLEGGYNLDSIAISALSVAKILIGEPPDELPDVTRDPKPE 395

Query: 407 AIVTIDMGLVKEQSKYWNCFKGRHGNDGINWREGAVNDSLTSKNFPLQKCCSPTTQFRRL 466
            I  ID  +++ QSKYW CFK + GN G +++E  +N+S+ +KNFPLQ       Q R L
Sbjct: 396 VIEMIDK-VLRIQSKYWKCFKSKFGNAGCDFQE-QINNSIATKNFPLQSAIR-QQQVRNL 452

Query: 467 AKEYKFVTLPLLNMELPSDTIICSPNIHTTDAIIICVHDTPEIWAQRDSLTGHIDPSTSI 526
           +KE+ F  LP+   ELP DTI+CS NI+ ++ IIICVHDTPEIWA+RD++ G IDPS+SI
Sbjct: 453 SKEFNFSELPIYKSELPEDTILCSSNIYESNTIIICVHDTPEIWAKRDAIQGTIDPSSSI 512

Query: 527 IVDTTVSVINWALGRNYGVIDINIPQSLFEQDNYSAVLSSQEVVTYLWDSYLKTFPHLAR 586
           IVD+++ +I WA+ R YGVIDINIPQ+L EQ+NY +++++QEV+  LWD+YLK FP++ +
Sbjct: 513 IVDSSLDMIKWAIERKYGVIDINIPQNLLEQENYYSIITAQEVLINLWDNYLKYFPNVNK 572

Query: 587 VAFVGIGDAYSGFVHLLGHRDTRSVVKCAIAFADKKQLRPLVPLVDESLGDWYFKNSLVF 646
           +AFVGIGDAYSG VHLLGHRDTRSVVK  I F  +KQL+PLVPLVDESLG+WYFKNSLVF
Sbjct: 573 IAFVGIGDAYSGIVHLLGHRDTRSVVKAVINFVGQKQLKPLVPLVDESLGEWYFKNSLVF 632

Query: 647 TSTYHPCWGTDGNDSKKPRKKFGRVLRWTCDGMNNIVEERLEEATDFILDSFEEWSESE 705
           ++  H  WG   N  KKPRKK+GRVLR   DG++NI+EER EEATDFILDSFEEWS+SE
Sbjct: 633 SNKNHIYWGDKEN--KKPRKKYGRVLRCDTDGISNIMEERFEEATDFILDSFEEWSDSE 689

>Skud_14.308 Chr14 (563902..566022) [2121 bp, 706 aa] {ON} YNL021W
           (REAL)
          Length = 706

 Score = 1033 bits (2671), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/659 (72%), Positives = 561/659 (85%), Gaps = 5/659 (0%)

Query: 47  YVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGID 106
           Y PLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLI DPTLSG+D
Sbjct: 53  YSPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVD 112

Query: 107 EIGELMQKIPVREATEEEILTVHSKEHVEFLKTTNTMDREQLLKETEAGDSVYYNNDSLI 166
           +IG+LM KIPVR AT EEIL VH+KEH+EF+++T  M REQLLKETE GDSVY+NNDS  
Sbjct: 113 DIGDLMLKIPVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDSYA 172

Query: 167 SARLSCGGAIEACKAVVEGRVKNAMAVVRPPGHHAEPGVAGGFCLFSNVAVAAQNILKNY 226
           SARL CGGAIEACKAVVEGRVKN++AVVRPPGHHAEP  AGGFCLFSNVAVAA+NILKNY
Sbjct: 173 SARLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNY 232

Query: 227 PESVRRVMILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKG 286
           PESVRR+MILDWDIHHGNGTQK+FY D++VLYVSLHR+E+GKYYPGT  G YDQ G+GKG
Sbjct: 233 PESVRRIMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQTGEGKG 292

Query: 287 EGFNCNIPWSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSP 346
           EGFNCNI W   GVGDAEYMWAFEQVV+PMGREF+PDLVIISSGFDAADGDTIGQCHVSP
Sbjct: 293 EGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVSP 352

Query: 347 ACYGHLTHMLKSLARGNMCVVLEGGYNLDSIAKSALGVAKVLIGEPPDELPQPLKQPKPE 406
           +CYGH+THMLKSLARGN+CVVLEGGYNLD+IA+SAL VAKVLIGEPPDELP  L  PKPE
Sbjct: 353 SCYGHMTHMLKSLARGNLCVVLEGGYNLDAIARSALSVAKVLIGEPPDELPDSLSDPKPE 412

Query: 407 AIVTIDMGLVKEQSKYWNCFKGRHGNDGINWREGAVNDSLTSKNFPLQKCCSPTTQFRRL 466
            I  ID  +++ QSKYWNCF+ RH N G N+ E  +NDS+ SKNFPLQK      Q + L
Sbjct: 413 VIEMID-KVIRLQSKYWNCFRRRHANSGCNFNE-PINDSIISKNFPLQKAIR-QQQLQYL 469

Query: 467 AKEYKFVTLPLLNMELPSDTIICSPNIHTTDAIIICVHDTPEIWAQRDSLTGHIDPSTSI 526
           + E+ FVTLPL+NM LP +T +C+PN+  ++A+++ VHDT ++WA+R+ ++G ID S+S+
Sbjct: 470 SNEFSFVTLPLINMGLPDNTALCTPNVFESNALLVVVHDTSDVWAKRNVISGTIDLSSSV 529

Query: 527 IVDTTVSVINWALGRNYGVIDINIPQSLFEQDNYSAVLSSQEVVTYLWDSYLKTFPHLAR 586
           I+D  +  I W L R YG+ID+NIP +LFE DNYS +++SQEV+ YLWD+Y+K FP++A+
Sbjct: 530 IIDNCIDFIKWGLDRKYGIIDVNIPLTLFEADNYSGMITSQEVLIYLWDNYIKYFPNVAK 589

Query: 587 VAFVGIGDAYSGFVHLLGHRDTRSVVKCAIAFADKKQLRPLVPLVDESLGDWYFKNSLVF 646
           +AF+GIGD++SG VHLLGHRDTR+V K  I F   KQL+PLVPLVDE+L +WYFKNSL+F
Sbjct: 590 IAFIGIGDSHSGIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLSEWYFKNSLIF 649

Query: 647 TSTYHPCWGTDGNDSKKPRKKFGRVLRWTCDGMNNIVEERLEEATDFILDSFEEWSESE 705
           ++  H CW    N+S+KPRKKFGRVLR   DG++N +EER EEATDFILDSFEEWS+ E
Sbjct: 650 SNNSHQCWKE--NESRKPRKKFGRVLRCDTDGLSNTIEERFEEATDFILDSFEEWSDDE 706

>TDEL0G02160 Chr7 complement(424838..426982) [2145 bp, 714 aa] {ON}
           Anc_2.285 YNL021W
          Length = 714

 Score = 1033 bits (2670), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/701 (70%), Positives = 569/701 (81%), Gaps = 6/701 (0%)

Query: 6   QQKRKLEEGSPDGEANGGQASR-KAXXXXXXXXXXXXXXXXSYVPLKTGLCYDVRMRYHA 64
           Q KRK+EE +   +    Q +R +                  Y PLKT LCYDVRMRYHA
Sbjct: 19  QVKRKMEEQNDGLDPKKSQLARTQNGAAGKRVIVPACAPNLHYTPLKTALCYDVRMRYHA 78

Query: 65  KIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGIDEIGELMQKIPVREATEEE 124
           KIFTSYFEYIDPHPEDPRRIYR+YKILAENGLI DPTLSGIDEIG+LM KIPVREAT+EE
Sbjct: 79  KIFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSGIDEIGDLMLKIPVREATDEE 138

Query: 125 ILTVHSKEHVEFLKTTNTMDREQLLKETEAGDSVYYNNDSLISARLSCGGAIEACKAVVE 184
           IL VHSKE++EF++ ++ M RE+LLKETE GDSVY+NNDS +SA+LSCGG I+ACKAVVE
Sbjct: 139 ILEVHSKENLEFVERSSRMKREELLKETEKGDSVYFNNDSYVSAKLSCGGVIDACKAVVE 198

Query: 185 GRVKNAMAVVRPPGHHAEPGVAGGFCLFSNVAVAAQNILKNYPESVRRVMILDWDIHHGN 244
           GRVKNA+AVVRPPGHHAEP   GGFCLFSNVAVAAQNILK YPESVRR++ILDWDIHHGN
Sbjct: 199 GRVKNALAVVRPPGHHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRRILILDWDIHHGN 258

Query: 245 GTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKGEGFNCNIPWSCSGVGDAE 304
           GTQKAFY D RVLY+SLHR+E+GKYYPGT  G YDQ G+GKGEGFNCNI W   GVGDAE
Sbjct: 259 GTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKGEGFNCNITWPVGGVGDAE 318

Query: 305 YMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHLTHMLKSLARGNM 364
           YM AFEQ+V+PM REFQPDLVIISSGFDAADGDTIGQCHV+P+CYG +THMLKSLARGN+
Sbjct: 319 YMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGQMTHMLKSLARGNL 378

Query: 365 CVVLEGGYNLDSIAKSALGVAKVLIGEPPDELPQPLKQPKPEAIVTIDMGLVKEQSKYWN 424
           CV LEGGYNLD+IA SAL VAKVLIGEPPDELP P K PK EAI  ID  ++  QSKYW 
Sbjct: 379 CVALEGGYNLDAIAISALSVAKVLIGEPPDELPDPTKDPKLEAIEMIDT-VIHTQSKYWK 437

Query: 425 CFKGRHGNDGINWREGAVNDSLTSKNFPLQKCCSPTTQFRRLAKEYKFVTLPLLNMELPS 484
           CF+ + GN G N+ E  V +++ SK+FPLQ       QFR+L+KEY FVTLP+  +E+P 
Sbjct: 438 CFQRKFGNAGCNFSE-PVTETVISKSFPLQTAIR-QEQFRQLSKEYGFVTLPISKLEIPD 495

Query: 485 DTIICSPNIHTTDAIIICVHDTPEIWAQRDSLTGHIDPSTSIIVDTTVSVINWALGRNYG 544
           D+++CSP +     I+I VHDTPEIWA+RD +TG IDPSTSIIVD+ +    W + R YG
Sbjct: 496 DSVLCSPEVFQQSTIVIIVHDTPEIWAKRDVITGVIDPSTSIIVDSPLDFTKWCMNRKYG 555

Query: 545 VIDINIPQSLFEQDNYSAVLSSQEVVTYLWDSYLKTFPHLARVAFVGIGDAYSGFVHLLG 604
           VID+NIPQSLFEQDNYSA+++SQEV+ Y+WD+Y+K FP LA+VAFVG GDAY+G VHLLG
Sbjct: 556 VIDVNIPQSLFEQDNYSAMITSQEVLLYIWDNYIKYFPSLAKVAFVGFGDAYAGIVHLLG 615

Query: 605 HRDTRSVVKCAIAFADKKQLRPLVPLVDESLGDWYFKNSLVFTSTYHPCWGTDGNDSKKP 664
           HRDTR+ VK  ++F  +KQL+PLVPLVDESL DWYFKNSL+FT   HPCW    N+SKKP
Sbjct: 616 HRDTRATVKAVVSFIGRKQLKPLVPLVDESLSDWYFKNSLIFTDKNHPCWA--DNESKKP 673

Query: 665 RKKFGRVLRWTCDGMNNIVEERLEEATDFILDSFEEWSESE 705
           RKKFGRVLR   DG+N+ +EER EEATDFILD FEEWS+SE
Sbjct: 674 RKKFGRVLRCDTDGLNSNMEERFEEATDFILDLFEEWSDSE 714

>Suva_14.326 Chr14 (576098..578218) [2121 bp, 706 aa] {ON} YNL021W
           (REAL)
          Length = 706

 Score = 1031 bits (2666), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 475/659 (72%), Positives = 558/659 (84%), Gaps = 5/659 (0%)

Query: 47  YVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGID 106
           Y PL+TGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLI DPTLSG+D
Sbjct: 53  YTPLRTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVD 112

Query: 107 EIGELMQKIPVREATEEEILTVHSKEHVEFLKTTNTMDREQLLKETEAGDSVYYNNDSLI 166
           ++G+LM KIPVR AT EEIL VH+KEH+EF+++T  M REQLLKETE GDSVY+NNDS  
Sbjct: 113 DLGDLMLKIPVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDSYA 172

Query: 167 SARLSCGGAIEACKAVVEGRVKNAMAVVRPPGHHAEPGVAGGFCLFSNVAVAAQNILKNY 226
           SARL CGGAIEACKAVVEGRVKN++AVVRPPGHHAEP  AGGFCLFSNVAVAA+NILKNY
Sbjct: 173 SARLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNY 232

Query: 227 PESVRRVMILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKG 286
           PESVRR+MILDWDIHHGNGTQK+FY D++VLY+SLHR+E+GKYYPGT  G YDQ G+GKG
Sbjct: 233 PESVRRIMILDWDIHHGNGTQKSFYQDDQVLYISLHRFEIGKYYPGTIQGQYDQTGEGKG 292

Query: 287 EGFNCNIPWSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSP 346
           EGFNCNI W   GVGDAEYMWAFEQVV+PMGREF+PDLVIISSGFDAADGDTIGQCHV+P
Sbjct: 293 EGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTP 352

Query: 347 ACYGHLTHMLKSLARGNMCVVLEGGYNLDSIAKSALGVAKVLIGEPPDELPQPLKQPKPE 406
           +CYGH+THMLKSLARGN+CVVLEGGYNLD+IA SAL VAKVLIGEPPDELP PL  PKPE
Sbjct: 353 SCYGHMTHMLKSLARGNLCVVLEGGYNLDAIAISALSVAKVLIGEPPDELPDPLSDPKPE 412

Query: 407 AIVTIDMGLVKEQSKYWNCFKGRHGNDGINWREGAVNDSLTSKNFPLQKCCSPTTQFRRL 466
            I  ID  +V+ QSKYWNCF+ RH N G N+ E  +NDS+ SKNFPLQK      Q   L
Sbjct: 413 VIEMID-KVVRLQSKYWNCFRRRHANSGCNFNE-PINDSIISKNFPLQKAIR-QQQLHYL 469

Query: 467 AKEYKFVTLPLLNMELPSDTIICSPNIHTTDAIIICVHDTPEIWAQRDSLTGHIDPSTSI 526
           + E+ FVTLPL+NMELP + ++C+PN+  +  +++ VHDT ++WA+R+ ++G ID S+S+
Sbjct: 470 SDEFNFVTLPLINMELPDNIVLCTPNVSESSTLLVVVHDTSDVWAKRNVISGTIDLSSSV 529

Query: 527 IVDTTVSVINWALGRNYGVIDINIPQSLFEQDNYSAVLSSQEVVTYLWDSYLKTFPHLAR 586
           ++D  +  I W L R YG+ID+NIP +LFE DNYS +++SQEV+ YLWD+Y+K FP +A+
Sbjct: 530 VIDNCLDFIKWGLDRKYGIIDVNIPLTLFEADNYSGMITSQEVLIYLWDNYIKYFPAVAK 589

Query: 587 VAFVGIGDAYSGFVHLLGHRDTRSVVKCAIAFADKKQLRPLVPLVDESLGDWYFKNSLVF 646
           +A++GIGD+YSG VHLLGHRDTR+V K  I F   KQL+PLVPLVDE+L +WYFKNSLVF
Sbjct: 590 IAYIGIGDSYSGIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLTEWYFKNSLVF 649

Query: 647 TSTYHPCWGTDGNDSKKPRKKFGRVLRWTCDGMNNIVEERLEEATDFILDSFEEWSESE 705
           T+  H CW    N+S+KPRKKFGRVLR   DG++N VEER EEATDFILDSFEEWS+ E
Sbjct: 650 TNNSHQCWKE--NESRKPRKKFGRVLRCDTDGLSNTVEERFEEATDFILDSFEEWSDEE 706

>Smik_14.310 Chr14 (555609..557729) [2121 bp, 706 aa] {ON} YNL021W
           (REAL)
          Length = 706

 Score = 1030 bits (2663), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/659 (72%), Positives = 558/659 (84%), Gaps = 5/659 (0%)

Query: 47  YVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGID 106
           Y PLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLI DPTLSG+D
Sbjct: 53  YSPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVD 112

Query: 107 EIGELMQKIPVREATEEEILTVHSKEHVEFLKTTNTMDREQLLKETEAGDSVYYNNDSLI 166
           ++G+LM KIPVR AT EEIL VH+KEH+EF+++T  M REQLLKETE GDSVY+NNDS  
Sbjct: 113 DLGDLMLKIPVRAATSEEILEVHTKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDSYA 172

Query: 167 SARLSCGGAIEACKAVVEGRVKNAMAVVRPPGHHAEPGVAGGFCLFSNVAVAAQNILKNY 226
           SARL CGGAIEACKAVVEGRVKN++AVVRPPGHHAEP  AGGFCLFSNVAVAA+NILKNY
Sbjct: 173 SARLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNY 232

Query: 227 PESVRRVMILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKG 286
           PESVRR+MILDWDIHHGNGTQK+FY D++VLYVSLHR+E+GKYYPGT  G YDQ G+GKG
Sbjct: 233 PESVRRIMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKG 292

Query: 287 EGFNCNIPWSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSP 346
           EGFNCNI W   GVGDAEYMWAFEQVV+PMGREF+PDLVIISSGFDAADGDTIGQCHV+P
Sbjct: 293 EGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTP 352

Query: 347 ACYGHLTHMLKSLARGNMCVVLEGGYNLDSIAKSALGVAKVLIGEPPDELPQPLKQPKPE 406
           +CYGH+THMLKSLARGN+CVVLEGGYNLD+IA+SAL VAKVLIGEPPDELP     PKPE
Sbjct: 353 SCYGHMTHMLKSLARGNLCVVLEGGYNLDAIARSALSVAKVLIGEPPDELPDSSSDPKPE 412

Query: 407 AIVTIDMGLVKEQSKYWNCFKGRHGNDGINWREGAVNDSLTSKNFPLQKCCSPTTQFRRL 466
            I  ID  +++ QSKYWNCF+ RH N G N+ E  +NDS+ SKNFPLQK      Q   L
Sbjct: 413 VIEMID-KVIRLQSKYWNCFRRRHANSGCNFNE-PINDSIVSKNFPLQKAIRQQQQ-HYL 469

Query: 467 AKEYKFVTLPLLNMELPSDTIICSPNIHTTDAIIICVHDTPEIWAQRDSLTGHIDPSTSI 526
           + E+  VTLPL+NM+LP +T++C+PN++ +  +++ VHDT +IWA+R+ ++G ID S+S+
Sbjct: 470 SDEFNLVTLPLINMDLPDNTVLCTPNVYESTTLLVVVHDTSDIWAKRNVISGTIDLSSSV 529

Query: 527 IVDTTVSVINWALGRNYGVIDINIPQSLFEQDNYSAVLSSQEVVTYLWDSYLKTFPHLAR 586
           I+D  +  I W L R YG+ID+NIP SLFE DNYS +++SQEV+ YLWD+Y+K FP +A+
Sbjct: 530 IIDNCLDFIKWGLDRKYGIIDVNIPLSLFEPDNYSGMITSQEVLIYLWDNYIKYFPAVAK 589

Query: 587 VAFVGIGDAYSGFVHLLGHRDTRSVVKCAIAFADKKQLRPLVPLVDESLGDWYFKNSLVF 646
           +AFVGIGD+YSG VHLLGHRDTR+V K  I F   KQL+PLVPLVDE+L +WYFKNSL+F
Sbjct: 590 IAFVGIGDSYSGIVHLLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLSEWYFKNSLIF 649

Query: 647 TSTYHPCWGTDGNDSKKPRKKFGRVLRWTCDGMNNIVEERLEEATDFILDSFEEWSESE 705
           ++  H CW    N+S+KPRKKFGRVLR   DG+NN +EER EEATDFILDSFEEWS+ E
Sbjct: 650 SNNSHQCWKE--NESRKPRKKFGRVLRCDTDGLNNTIEERFEEATDFILDSFEEWSDEE 706

>KNAG0H02010 Chr8 (354923..357004) [2082 bp, 693 aa] {ON} Anc_2.285
           YNL021W
          Length = 693

 Score = 1025 bits (2649), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/659 (71%), Positives = 557/659 (84%), Gaps = 3/659 (0%)

Query: 47  YVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGID 106
           Y PLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLI DP LSGID
Sbjct: 38  YTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLITDPMLSGID 97

Query: 107 EIGELMQKIPVREATEEEILTVHSKEHVEFLKTTNTMDREQLLKETEAGDSVYYNNDSLI 166
           +IG+LM KIPVREAT +E+L VHSKEH+EF+++   M  ++LLK TE GDSVY+NNDS  
Sbjct: 98  DIGDLMLKIPVREATSQEVLEVHSKEHLEFIESVTKMSHDELLKSTETGDSVYFNNDSSS 157

Query: 167 SARLSCGGAIEACKAVVEGRVKNAMAVVRPPGHHAEPGVAGGFCLFSNVAVAAQNILKNY 226
           SA+LSCGGAIEACKAVVEGRVKNA AVVRPPGHH+EP  AGGFCLFSNVAVA++NIL+NY
Sbjct: 158 SAKLSCGGAIEACKAVVEGRVKNAFAVVRPPGHHSEPESAGGFCLFSNVAVASKNILRNY 217

Query: 227 PESVRRVMILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKG 286
           PESVRR+MILDWDIHHGNGTQKAFY D+RVLY+SLHR+ELGKYYPGT+ G+YD+ G+GKG
Sbjct: 218 PESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTAQGHYDKTGEGKG 277

Query: 287 EGFNCNIPWSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSP 346
           EGFNCNI W   GVGDAEYMWAFEQVV+PM REF+PDLVIIS+GFDAADGDTIGQCHVSP
Sbjct: 278 EGFNCNITWPVGGVGDAEYMWAFEQVVMPMSREFRPDLVIISAGFDAADGDTIGQCHVSP 337

Query: 347 ACYGHLTHMLKSLARGNMCVVLEGGYNLDSIAKSALGVAKVLIGEPPDELPQPLKQPKPE 406
           +CYGH+THMLKSLA GN+CVVLEGGYNLD+IA+SAL VAKVLIGEPP+EL  P+K PKPE
Sbjct: 338 SCYGHMTHMLKSLANGNLCVVLEGGYNLDAIARSALSVAKVLIGEPPEELLDPVKDPKPE 397

Query: 407 AIVTIDMGLVKEQSKYWNCFKGRHGNDGINWREGAVNDSLTSKNFPLQKCCSPTTQFRRL 466
           AI  I+  +++ QSKYW CF+ RHGN G  + E  + +S+++ NFPLQ       QF  L
Sbjct: 398 AIEIIN-KVIRLQSKYWKCFQRRHGNSGCTF-EKHMTESISTDNFPLQSAIR-QQQFSAL 454

Query: 467 AKEYKFVTLPLLNMELPSDTIICSPNIHTTDAIIICVHDTPEIWAQRDSLTGHIDPSTSI 526
           +KE+ FV  PL  M+L  DT+ICSP ++  D III V DTPEIWA+RD + G IDPS SI
Sbjct: 455 SKEFGFVKFPLFEMKLSDDTVICSPEVYNKDTIIILVRDTPEIWAKRDVIQGTIDPSASI 514

Query: 527 IVDTTVSVINWALGRNYGVIDINIPQSLFEQDNYSAVLSSQEVVTYLWDSYLKTFPHLAR 586
           I D  ++ I WA+ RNYGVID+NIPQSLFEQDNYSA++++QEV++++WD+Y++ F   ++
Sbjct: 515 ITDAALAFIKWAMERNYGVIDVNIPQSLFEQDNYSAMITAQEVMSFMWDNYIRFFGSASK 574

Query: 587 VAFVGIGDAYSGFVHLLGHRDTRSVVKCAIAFADKKQLRPLVPLVDESLGDWYFKNSLVF 646
           +AFVG+GDA SG VHLLGHRDTRS VK  I F  +K L+PL+PLVDE+LGDWYFKNSLVF
Sbjct: 575 IAFVGVGDACSGIVHLLGHRDTRSKVKSVINFIAQKTLKPLIPLVDETLGDWYFKNSLVF 634

Query: 647 TSTYHPCWGTDGNDSKKPRKKFGRVLRWTCDGMNNIVEERLEEATDFILDSFEEWSESE 705
           +   H CWG + N++KKPRKKFGRVLR   DG+ NI+EER EEATDF+LDSFEEWSES+
Sbjct: 635 SDKNHACWGDNENENKKPRKKFGRVLRCNSDGLTNIIEERFEEATDFMLDSFEEWSESD 693

>KAFR0H03320 Chr8 (633105..635213) [2109 bp, 702 aa] {ON} Anc_2.285
           YNL021W
          Length = 702

 Score = 1009 bits (2608), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/663 (70%), Positives = 552/663 (83%), Gaps = 9/663 (1%)

Query: 47  YVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGID 106
           Y+PLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLI D  LSG+D
Sbjct: 45  YIPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDTMLSGVD 104

Query: 107 EIGELMQKIPVREATEEEILTVHSKEHVEFLKTTNTMDREQLLKETEAGDSVYYNNDSLI 166
           +IG++M KIPVREAT +EIL VHS+EH+EFL++T TM+RE LLKETE GDSVY+NNDS +
Sbjct: 105 DIGDIMLKIPVREATADEILEVHSREHLEFLESTTTMNREVLLKETEKGDSVYFNNDSYM 164

Query: 167 SARLSCGGAIEACKAVVEGRVKNAMAVVRPPGHHAEPGVAGGFCLFSNVAVAAQNILKNY 226
           SA+LSCGGAIEACKAVVEG+VKNA+AVVRPPGHH+EP  +GGFCLFSNVAVAA+NILKNY
Sbjct: 165 SAKLSCGGAIEACKAVVEGKVKNALAVVRPPGHHSEPESSGGFCLFSNVAVAAKNILKNY 224

Query: 227 PESVRRVMILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKG 286
           PESVR++MILDWDIHHGNGTQKAFY D RVLYVSLHR+E GKYYPGT  G YDQCG+GKG
Sbjct: 225 PESVRKIMILDWDIHHGNGTQKAFYQDERVLYVSLHRFEAGKYYPGTVQGQYDQCGEGKG 284

Query: 287 EGFNCNIPWSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSP 346
           EGFNCNI W   GVGDAEYMWAFEQ+V+PMGREFQPDLVIISSGFDAADGD IGQCHV+P
Sbjct: 285 EGFNCNITWPTGGVGDAEYMWAFEQIVMPMGREFQPDLVIISSGFDAADGDVIGQCHVTP 344

Query: 347 ACYGHLTHMLKSLARGNMCVVLEGGYNLDSIAKSALGVAKVLIGEPPDELPQPLKQPKPE 406
           +CYGH+THMLKSLARGN+ VVLEGGYNLDSIA SAL VAK LIGEPPDELP PLK PKPE
Sbjct: 345 SCYGHMTHMLKSLARGNLVVVLEGGYNLDSIAISALSVAKTLIGEPPDELPDPLKDPKPE 404

Query: 407 AIVTIDMGLVKEQSKYWNCFKGRHGNDGINWREGAVNDSLTSKNFPLQKCCSPTTQFRRL 466
           A+  I   ++K QSKYW CFK RHGN  IN+ E A +D+L +K FPLQ       Q+  L
Sbjct: 405 ALEMI-YKVIKIQSKYWKCFKRRHGNYNINFSEVA-SDTLATKTFPLQTAIR-QQQYYNL 461

Query: 467 AKEYKFVTLPLLNMELPSDTIICSPNIHTTDAIIICVHDTPEIWAQRDSLTGHIDPSTSI 526
            KEY FV  P  N++LP D I+CSPNIHT + +II VHDTP+IW ++D ++  +DP +SI
Sbjct: 462 FKEYDFVKFPTANLKLPDDLILCSPNIHTAETVIIIVHDTPQIWLEKDIISNTVDPCSSI 521

Query: 527 IVDTTVSVINWALGRNYGVIDINIPQSLF----EQDNYSAVLSSQEVVTYLWDSYLKTFP 582
           I+D+T+  + WA  R YG+ID+NIPQSL       DNYS+++++QE++ +LWD+++K   
Sbjct: 522 IIDSTLDFLKWAHNRKYGIIDVNIPQSLIYGDENPDNYSSLINAQEILLFLWDNHIKFLN 581

Query: 583 HLARVAFVGIGDAYSGFVHLLGHRDTRSVVKCAIAFADKKQLRPLVPLVDESLGDWYFKN 642
            + ++AF+G+GD+ SG VHLLGHRDT+  VK  I F   KQL+PLVPLVDESL DWYFKN
Sbjct: 582 EVNKIAFIGVGDSVSGVVHLLGHRDTKERVKAVINFMADKQLKPLVPLVDESLSDWYFKN 641

Query: 643 SLVFTSTYHPCWGTDGNDSKKPRKKFGRVLRWTCDGMNNIVEERLEEATDFILDSFEEWS 702
           SLVF++  HPCWG   N  KKPRKK+GRVLR   DG+N+ +EER +EATDFILDSFEEWS
Sbjct: 642 SLVFSNRTHPCWGDKEN--KKPRKKYGRVLRCDTDGLNSTIEERFDEATDFILDSFEEWS 699

Query: 703 ESE 705
           +SE
Sbjct: 700 DSE 702

>Kpol_1039.32 s1039 (99859..101838) [1980 bp, 659 aa] {ON}
           (99859..101838) [1980 nt, 660 aa]
          Length = 659

 Score =  968 bits (2502), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/658 (67%), Positives = 545/658 (82%), Gaps = 5/658 (0%)

Query: 46  SYVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGI 105
           SY PLKTGLCYDVRMRYHAKI+TSY+EYIDPHPEDPRRIYRIYKILAENGLI DP LSGI
Sbjct: 6   SYTPLKTGLCYDVRMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDPALSGI 65

Query: 106 DEIGELMQKIPVREATEEEILTVHSKEHVEFLKTTNTMDREQLLKETEAGDSVYYNNDSL 165
           D+IG+LM KIPVREAT EEIL VH KE +E+L+ T  ++R++LL +TE GDSVY+NNDS 
Sbjct: 66  DDIGDLMCKIPVREATSEEILEVHPKEQLEYLEKTQYLNRDELLSKTELGDSVYFNNDSY 125

Query: 166 ISARLSCGGAIEACKAVVEGRVKNAMAVVRPPGHHAEPGVAGGFCLFSNVAVAAQNILKN 225
            SA+LSCGGAIEACKA+V+G+VKN++A+VRPPGHH+EP VAGGFCLFSNVAVA +NILKN
Sbjct: 126 FSAKLSCGGAIEACKAIVDGKVKNSLAIVRPPGHHSEPEVAGGFCLFSNVAVATKNILKN 185

Query: 226 YPESVRRVMILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGK 285
           YP+ V++VMI+DWDIHHGNGTQKAFY D+RVLYVSLHR+ELGKYYPGT +G YDQ G+GK
Sbjct: 186 YPDKVKKVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGEGK 245

Query: 286 GEGFNCNIPWSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVS 345
           GEGFNCNIPWS  G+GDAEY+WAFEQ+V+PMGREF+PDLVI+SSGFDAADGDTIG+CHV+
Sbjct: 246 GEGFNCNIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKCHVT 305

Query: 346 PACYGHLTHMLKSLARGNMCVVLEGGYNLDSIAKSALGVAKVLIGEPPDELPQPLKQPKP 405
           P+CYGH+THMLKSLA G +CVVLEGGYNLD+IA+SAL VAKVLIGEPPDELP P K PKP
Sbjct: 306 PSCYGHMTHMLKSLANGKLCVVLEGGYNLDAIARSALAVAKVLIGEPPDELPAPDKDPKP 365

Query: 406 EAIVTIDMGLVKEQSKYWNCFKGRHGNDGINWREGAVNDSLTSKNFPLQKCCSPTTQFRR 465
           EAI  ID  ++  +SKYW CFK +  N    ++ G +++S  +K FP+Q       Q + 
Sbjct: 366 EAIEMIDR-VIDLKSKYWKCFKRQITNSNCEYK-GPISESFFAKKFPIQDAIR-AQQIQY 422

Query: 466 LAKEYKFVTLPLLNMELPSDTIICSPNIHTTDAIIICVHDTPEIWAQRDSLTGHIDPSTS 525
           L  +Y  V LPL+N  LP DT++CS +I  ++  II VHDTPEIW++RD++ G ID S S
Sbjct: 423 LTNDYNMVPLPLMNSNLPEDTVMCSTDILQSNVAIIYVHDTPEIWSKRDAIAGVIDSSAS 482

Query: 526 IIVDTTVSVINWALGRNYGVIDINIPQSLFEQDNYSAVLSSQEVVTYLWDSYLKTFPHLA 585
           + +D ++   +WAL R YG+ID+NIPQ+L+EQDNYSA L++QEV+  LWD+ LK FP++ 
Sbjct: 483 LYMDASLQFYDWALDRGYGIIDVNIPQTLYEQDNYSASLTAQEVLIKLWDNNLKYFPNVN 542

Query: 586 RVAFVGIGDAYSGFVHLLGHRDTRSVVKCAIAFADKKQLRPLVPLVDESLGDWYFKNSLV 645
           ++A++G+G+AYSG VHLLGHRDTRSVVK  I F  KK L+ LVPLV+ESL DWYFK SL+
Sbjct: 543 KIAYIGVGEAYSGLVHLLGHRDTRSVVKSVIGFVGKKPLKALVPLVEESLADWYFKTSLL 602

Query: 646 FTSTYHPCWGTDGNDSKKPRKKFGRVLRWTCDGMNNIVEERLEEATDFILDSFEEWSE 703
           F    H CWG   NDSKKPRK++GRVLR   DG+ +++EER EEATDFI+DS +EW+E
Sbjct: 603 FADKNHSCWGE--NDSKKPRKRYGRVLRCDSDGIFSLIEERFEEATDFIIDSLDEWTE 658

>TPHA0C03390 Chr3 complement(743315..745420) [2106 bp, 701 aa] {ON}
           Anc_2.285 YNL021W
          Length = 701

 Score =  927 bits (2396), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/659 (66%), Positives = 529/659 (80%), Gaps = 7/659 (1%)

Query: 47  YVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGID 106
           Y PLKTG+CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLI DP+L+G+ 
Sbjct: 48  YTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPSLTGVS 107

Query: 107 EIGELMQKIPVREATEEEILTVHSKEHVEFLKTTNTMDREQLLKETEAGDSVYYNNDSLI 166
           +IG+LM KIPVREAT+EEIL VH++EH++FL++T  M RE+LL +TE GDSVY NNDS I
Sbjct: 108 DIGDLMLKIPVREATKEEILDVHTEEHMQFLESTEKMTREELLSKTEKGDSVYLNNDSYI 167

Query: 167 SARLSCGGAIEACKAVVEGRVKNAMAVVRPPGHHAEPGVAGGFCLFSNVAVAAQNILKNY 226
           SARLSCGGAIEACKAVVEGRVKNA+A+VRPPGHHAEP  AGGFCLFSNV+VAA++ILK Y
Sbjct: 168 SARLSCGGAIEACKAVVEGRVKNALAIVRPPGHHAEPQAAGGFCLFSNVSVAAKSILKTY 227

Query: 227 PESVRRVMILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKG 286
           PESVR+++I+DWDIHHGNGTQKAFY D+ VLY+SLHR+ELGK+YPG   GNYD+ GDGKG
Sbjct: 228 PESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPGFPEGNYDKVGDGKG 287

Query: 287 EGFNCNIPWSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSP 346
           +GFNCNI W   GVGD EY+WAFEQ+VIPM REF+PDLVI+SSGFDAA GDTIGQCHV+P
Sbjct: 288 KGFNCNITWPVKGVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFDAAHGDTIGQCHVTP 347

Query: 347 ACYGHLTHMLKSLARGNMCVVLEGGYNLDSIAKSALGVAKVLIGEPPDELPQPLKQPKPE 406
            CYG++THMLKSLARGN+CVVLEGGYNLDSI+ SAL VAK+LIGEPPDE+P+  + PKP 
Sbjct: 348 NCYGYMTHMLKSLARGNLCVVLEGGYNLDSISNSALAVAKILIGEPPDEIPESDRDPKPG 407

Query: 407 AIVTIDMGLVKEQSKYWNCFKGRHGNDGINWREGAVNDSLTSKNFPLQKCCSPTTQFRRL 466
            +  I+  +++ QSKYW CF+ + GN G  + E A+ +S   K FPLQ       Q    
Sbjct: 408 VLEMINK-VIRVQSKYWKCFRRKFGNFGGEY-ENAI-ESQIPKMFPLQDAIR-NAQLSHY 463

Query: 467 AKEYKFVTLPLLNMELPSDTIICSPNIHTTDAIIICVHDTPEIWAQRDSLTGHIDPSTSI 526
             ++  ++L L N+ LP ++IICS N     ++ + +HDTPE+W  RD +TG IDPSTSI
Sbjct: 464 YDDFGMISLSLPNLNLPKNSIICSSNFFKAKSLCVLLHDTPEVWGNRDIITGIIDPSTSI 523

Query: 527 IVDTTVSVINWALGRNYGVIDINIPQSLFEQDNYSAVLSSQEVVTYLWDSYLKTFPHLAR 586
           I D+++  INWA+ R   VIDINIP+S FE DNYS+ L SQ+V+  LWD++ K    L +
Sbjct: 524 IFDSSLKFINWAIERETAVIDINIPRSAFEADNYSSNLLSQDVMISLWDNHFKYIESLEK 583

Query: 587 VAFVGIGDAYSGFVHLLGHRDTRSVVKCAIAFADKKQLRPLVPLVDESLGDWYFKNSLVF 646
           + F+GIG+A SG VHLLG RDTR+V K AI F     L+P+VP +DESLGDWYFKNSLVF
Sbjct: 584 LCFIGIGEATSGIVHLLGKRDTRTVTKAAINFVGSSSLKPIVPSLDESLGDWYFKNSLVF 643

Query: 647 TSTYHPCWGTDGNDSKKPRKKFGRVLRWTCDGMNNIVEERLEEATDFILDSFEEWSESE 705
           T  +H CW     + KKPRKK+GRVLR   DG++NI+EER EEATDFILD+F+EWS++E
Sbjct: 644 TDHFHGCW---SENDKKPRKKYGRVLRCDTDGIHNIIEERFEEATDFILDAFDEWSDTE 699

>TBLA0B06950 Chr2 complement(1643756..1646143) [2388 bp, 795 aa]
           {ON} Anc_2.285 YNL021W
          Length = 795

 Score =  721 bits (1862), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/435 (77%), Positives = 377/435 (86%), Gaps = 3/435 (0%)

Query: 47  YVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGID 106
           YVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLI DPTLSG+D
Sbjct: 54  YVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVD 113

Query: 107 EIGELMQKIPVREATEEEILTVHSKEHVEFLKTTNTMDREQLLKETEAGDSVYYNNDSLI 166
            IG+LM K+P+REAT  EIL VHS EH ++L+ T+  +REQLLKETE GDSVY+NNDS  
Sbjct: 114 NIGDLMLKLPIREATMNEILEVHSIEHFKYLEKTSNDNREQLLKETENGDSVYFNNDSFQ 173

Query: 167 SARLSCGGAIEACKAVVEGRVKNAMAVVRPPGHHAEPGVAGGFCLFSNVAVAAQNILKNY 226
           SA+LSCGGAIEACKAVVEGRVKNAMAVVRPPGHH+EP  AGGFCLFSNVAVA +NILKNY
Sbjct: 174 SAKLSCGGAIEACKAVVEGRVKNAMAVVRPPGHHSEPESAGGFCLFSNVAVATKNILKNY 233

Query: 227 PESVRRVMILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKG 286
           PESVR+V+ILDWDIHHGNGTQKAFY D+ VLY+SLHR+ELGKYYPGT  G YDQ G+GKG
Sbjct: 234 PESVRKVLILDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPGTIQGQYDQTGEGKG 293

Query: 287 EGFNCNIPWSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSP 346
           EGFNCNI W    VGDAEYMWAFEQVV+PM REFQPDLVIISSGFDAADGDTIGQCHVSP
Sbjct: 294 EGFNCNITWPIGAVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFDAADGDTIGQCHVSP 353

Query: 347 ACYGHLTHMLKSLARGNMCVVLEGGYNLDSIAKSALGVAKVLIGEPPDELPQPLKQPKPE 406
           +CYGH+THMLKSLARGN+CVVLEGGYNLD+IA+SAL V+K+LIGEPPDELP PLK PKPE
Sbjct: 354 SCYGHMTHMLKSLARGNLCVVLEGGYNLDAIARSALSVSKILIGEPPDELPDPLKDPKPE 413

Query: 407 AIVTIDMGLVKEQSKYWNCFKGRHGNDGINWREGAVNDSLTSKNFPLQKCCSPTTQFRRL 466
            I  ID  +++ QSKYW CF+ RHGN G N++E ++NDSL SKNFPLQ       Q ++L
Sbjct: 414 VIEMID-KIIRLQSKYWKCFRRRHGNLGCNFKE-SINDSLISKNFPLQTAIR-NFQSKKL 470

Query: 467 AKEYKFVTLPLLNME 481
             E  F+TLP+ N +
Sbjct: 471 FDELNFLTLPIKNFQ 485

 Score =  302 bits (773), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 136/224 (60%), Positives = 176/224 (78%), Gaps = 2/224 (0%)

Query: 482 LPSDTIICSPNIHTTDAIIICVHDTPEIWAQRDSLTGHIDPSTSIIVDTTVSVINWALGR 541
           L  +TI+CSP I  +  +++ VHD+P++W +RD  TG +D S++II+D+T+  I W+L R
Sbjct: 574 LNENTILCSPAIIRSKTLVVLVHDSPDLWTKRDVSTGVVDLSSTIIIDSTLDFIKWSLDR 633

Query: 542 NYGVIDINIPQSLFEQDNYSAVLSSQEVVTYLWDSYLKTFPHLARVAFVGIGDAYSGFVH 601
           NYGVIDINIPQ+LFEQDNYS++L++QE +   WD+YLK FP++ ++ F+G GDA++G VH
Sbjct: 634 NYGVIDINIPQTLFEQDNYSSILAAQETLLSFWDNYLKYFPYIEKIVFIGFGDAHAGIVH 693

Query: 602 LLGHRDTRSVVKCAIAFADKKQLRPLVPLVDESLGDWYFKNSLVFTSTYHPCWGTDGNDS 661
           LLGHRDTRSVVK  I F  KK L+ LVPLVDE+L DWYFKNSLVFT   HP W    N++
Sbjct: 694 LLGHRDTRSVVKSVINFLGKKPLKALVPLVDETLSDWYFKNSLVFTDKNHPFWA--DNEN 751

Query: 662 KKPRKKFGRVLRWTCDGMNNIVEERLEEATDFILDSFEEWSESE 705
           KKPRKKFGRVLR   DG+ N++EER +EATDFILDSFEEWS+ E
Sbjct: 752 KKPRKKFGRVLRSQQDGIANLIEERFDEATDFILDSFEEWSDEE 795

>Kpol_1003.37 s1003
           complement(91621..92301,92861..92869,92912..93958) [1737
           bp, 578 aa] {ON}
           complement(91621..92301,92861..92869,92912..93958) [1737
           nt, 579 aa]
          Length = 578

 Score =  478 bits (1229), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 214/284 (75%), Positives = 249/284 (87%)

Query: 47  YVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGID 106
           Y PLKTGLCYDVRMRYHAKIFTS FEYIDPHPEDPRR+YRIYKILAENGLI+D  LSG+D
Sbjct: 66  YTPLKTGLCYDVRMRYHAKIFTSNFEYIDPHPEDPRRVYRIYKILAENGLIKDENLSGLD 125

Query: 107 EIGELMQKIPVREATEEEILTVHSKEHVEFLKTTNTMDREQLLKETEAGDSVYYNNDSLI 166
           +IG++M KIPVR ATEEEIL VH++EH++F++   +  RE+L+K TE  DSVYYNNDS  
Sbjct: 126 DIGDIMLKIPVRTATEEEILAVHTREHLDFIENIESQSREELIKLTEKADSVYYNNDSYY 185

Query: 167 SARLSCGGAIEACKAVVEGRVKNAMAVVRPPGHHAEPGVAGGFCLFSNVAVAAQNILKNY 226
           SA+LSCGG IEAC+AVVEGRVKN++A+VRPPGHHAEP  AGGFCLFSNV+VAA++IL+ Y
Sbjct: 186 SAKLSCGGVIEACRAVVEGRVKNSLAIVRPPGHHAEPQAAGGFCLFSNVSVAARSILRTY 245

Query: 227 PESVRRVMILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKG 286
           PESVR+++ILDWDIHHGNGTQKAFY D  VLY+SLHRYE   +YPGT +G YDQ G+GKG
Sbjct: 246 PESVRKILILDWDIHHGNGTQKAFYEDENVLYISLHRYESTAFYPGTIHGRYDQVGEGKG 305

Query: 287 EGFNCNIPWSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSG 330
           EGFNCNI W   GVGDAEYMWAFE VV+P+GREF+PDLVI+SSG
Sbjct: 306 EGFNCNITWPVGGVGDAEYMWAFEHVVMPLGREFRPDLVIVSSG 349

 Score =  236 bits (602), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 116/279 (41%), Positives = 170/279 (60%), Gaps = 6/279 (2%)

Query: 427 KGRHGNDGINWREGAVNDSLTSKNFPLQKCCSPTTQFRRLAKEYKFVTLPLLNMELPSDT 486
           KG   N  I W  G V D+     +  +    P    R    +   V+     M+     
Sbjct: 304 KGEGFNCNITWPVGGVGDA--EYMWAFEHVVMPLG--REFRPDLVIVSSGXXXMKPHEKL 359

Query: 487 IICSPNIHTTDAIIICVHDTPEIWAQRDSLTGHIDPSTSIIVDTTVSVINWALGRNYGVI 546
           ++ S  I   + ++I VHDTPE+W  RD +TG +DPSTS+++DT++  I WA  RNY ++
Sbjct: 360 VLASQKIFKAETLVILVHDTPELWGDRDIITGVLDPSTSVLIDTSMKFIKWAADRNYSIL 419

Query: 547 DINIPQSLFEQDNYSAVLSSQEVVTYLWDSYLKTFPHLARVAFVGIGDAYSGFVHLLGHR 606
           DINIP+S  E++ +S+  ++ E++  LWD++L+    L ++ F+GIG++Y G VHL+G R
Sbjct: 420 DINIPKSNLEKETFSSSKAANEIMLSLWDNHLQYISTLTKICFIGIGESYQGIVHLIGER 479

Query: 607 DTRSVVKCAIAFADKKQLRPLVPLVDESLGDWYFKNSLVFTSTYHPCWGTDGNDSKKPRK 666
           D R + K  I F     L+ L    DE++ DWYFKNSLVFT+  H CW    ++ K+PRK
Sbjct: 480 DLRVLSKAVINFVGNFPLKSLSSNFDETMVDWYFKNSLVFTNDSHNCWKE--SEEKRPRK 537

Query: 667 KFGRVLRWTCDGMNNIVEERLEEATDFILDSFEEWSESE 705
           KFGRVL+   DG+ +I+ ER +EATDFILD+FEEWS+ E
Sbjct: 538 KFGRVLKSDSDGIISIINERFDEATDFILDAFEEWSDEE 576

>SAKL0H25124g Chr8 (2184039..2185385) [1347 bp, 448 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194C HOS2 Histone deacetylase required for gene
           activation via specific deacetylation of lysines in H3
           and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 448

 Score =  145 bits (367), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 103/363 (28%), Positives = 180/363 (49%), Gaps = 35/363 (9%)

Query: 46  SYVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGI 105
           +Y+P + G  Y   + YH     S + Y   HP  P R+     +++  GL         
Sbjct: 13  TYLPYEFGSTYSPHVSYHFNSDVSQYHYGVRHPMKPFRLMLTDHLVSSYGL--------- 63

Query: 106 DEIGELMQKIPVREATEEEILTVHSKEHVEFLK-----TTNTMDREQLLKETEAGDSVYY 160
               ++M     REAT +E+L  HS +++EFL      T + M R  L K    GD    
Sbjct: 64  ---HKIMDLYETREATRDELLEFHSADYIEFLSKVSPDTLSKMPRGSLEK-FNIGDDCPI 119

Query: 161 NNDSLISARLSCGGAIEACKAVVEGRVKNAMAVVRPPG-HHAEPGVAGGFCLFSNVAVAA 219
                  + L  G +++A + ++ G  ++ +A+    G HHA+     GFC  +++ +A 
Sbjct: 120 FQGIFEYSSLYAGASLDASRKLIAG--QSEIAINWSGGLHHAKKAKPSGFCYVNDIVLAI 177

Query: 220 QNILKNYPESVRRVMILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYD 279
            N+L+ +P    RV+ +D D+HHG+G Q+AFY  +RV  VS H+Y  G+++PGT  G++D
Sbjct: 178 LNLLRFHP----RVLYVDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GDFD 230

Query: 280 QCGDGKGEGFNCNIPWSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTI 339
           + G  +G+ F  N+P    G+ D  Y+  F+ ++ P+   ++P ++I   G D+   D +
Sbjct: 231 EIGCSRGKHFALNVPLD-DGIDDDSYINLFKSIMDPLITSYKPTVIIQQCGADSLGHDRL 289

Query: 340 GQCHVSPACYGHLTHMLKSLARGNMCVVLEGGYNLDSIAK-----SALGVAKVLIGEPPD 394
           G  +++   +G     +KS     M VV  GGY   ++++     + L    +L  E P+
Sbjct: 290 GCFNLNIRAHGECVKFVKSFGIP-MLVVGGGGYTPRNVSRLWTYETGLLNDVLLPQEIPE 348

Query: 395 ELP 397
            +P
Sbjct: 349 NIP 351

>TPHA0H00320 Chr8 complement(62605..63957) [1353 bp, 450 aa] {ON}
           Anc_8.153 YGL194C
          Length = 450

 Score =  145 bits (366), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 103/358 (28%), Positives = 177/358 (49%), Gaps = 33/358 (9%)

Query: 50  LKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGIDEIG 109
            + G  Y  R+ YH     S + Y   HP  P R      +++  GL             
Sbjct: 19  FEFGSTYSPRVSYHYNPKVSNYHYGVKHPMKPFRFMLTDHLVSSYGL------------H 66

Query: 110 ELMQKIPVREATEEEILTVHSKEHVEFLKTTNTMDREQLLKET----EAGDSVYYNNDSL 165
            +M     REAT+EE+L  HS+++VEFL   +  +  ++ + T      GD      +  
Sbjct: 67  NIMDLYETREATKEELLQFHSEDYVEFLSKVSPDNISKMPRGTFDKYNIGDDCPIFQNIY 126

Query: 166 ISARLSCGGAIEACKAVVEGRVKNAMAVVRPPG-HHAEPGVAGGFCLFSNVAVAAQNILK 224
              +L  G +++A + ++    ++ +A+    G HHA+     GFC  +++ +A  N+L+
Sbjct: 127 EYCKLYAGASLDASRKLIND--QSDIAINWSGGLHHAKKSNPSGFCYVNDIVLATLNLLR 184

Query: 225 NYPESVRRVMILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDG 284
            +P    RV+ +D D+HHG+G Q+AFY  +RV  VS H+Y  G+++PGT  GNYD+ G  
Sbjct: 185 YHP----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GNYDEIGCA 237

Query: 285 KGEGFNCNIPWSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHV 344
           +G+ F  N+P +  G+ D  Y+  F+ V+ P+   F+P  +I   G D+   D +G  ++
Sbjct: 238 EGKHFAMNVPLN-DGIDDDSYINLFKSVMEPIITSFKPTAIIQQCGADSLGHDRLGCFNL 296

Query: 345 SPACYGHLTHMLKSLARGNMCVVLEGGY---NLDSIAKSALGVAK--VLIGEPPDELP 397
           +   +G     ++S     M VV  GGY   N+  +     G+    +L  E P+++P
Sbjct: 297 NIKAHGECVKFIRSFGIP-MVVVGGGGYTPRNVSRLYAYETGILNNVLLQSELPEDMP 353

>KAFR0C02920 Chr3 complement(584668..586029) [1362 bp, 453 aa] {ON}
           Anc_8.153 YGL194C
          Length = 453

 Score =  145 bits (367), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 105/356 (29%), Positives = 177/356 (49%), Gaps = 35/356 (9%)

Query: 53  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGIDEIGELM 112
           G  Y  R+ YH     S + Y   HP  P R+     +++  GL             ++M
Sbjct: 23  GSSYTPRVSYHFNPKVSNYHYGVNHPMKPFRLMLTDHLVSSYGL------------HKIM 70

Query: 113 QKIPVREATEEEILTVHSKEHVEFLK-----TTNTMDREQLLKETEAGDSVYYNNDSLIS 167
                REAT+EE+   HS ++++FL+     T N + R  L K     D   + N    S
Sbjct: 71  DLYETREATKEEMSQFHSSDYLDFLEKISPDTLNKIPRGTLEKFNIGSDCPIFENIYDYS 130

Query: 168 ARLSCGGAIEACKAVVEGRVKNAMAVVRPPG-HHAEPGVAGGFCLFSNVAVAAQNILKNY 226
             L  G +++A + ++ G  ++ +A+    G HHA+     GFC  +++ ++  N+L+ +
Sbjct: 131 T-LYTGASLDASRKLING--QSEIAINWSGGLHHAKKNNPSGFCYINDIVLSILNLLRYH 187

Query: 227 PESVRRVMILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKG 286
           P    RV+ +D D+HHG+G Q+AFY  +RV  +S H+Y  G+++PGT  GNYD+ G   G
Sbjct: 188 P----RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKYN-GEFFPGT--GNYDEIGCSGG 240

Query: 287 EGFNCNIPWSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSP 346
           + F  N+P +  G+ D  Y+  F+ ++ P+   +QP ++I   G D+   D +G  +++ 
Sbjct: 241 KHFAMNVPLN-DGIDDDSYIKLFKSIIDPLITSYQPTVIIQQCGADSLGHDRLGCFNLNI 299

Query: 347 ACYGHLTHMLKSLARGNMCVVLEGGY---NLDSIAKSALGVAK--VLIGEPPDELP 397
             +G     + S     M VV  GGY   N+  +     G+    +L  E P+ELP
Sbjct: 300 KAHGECVKFVSSFGIP-MLVVGGGGYTPRNVSRLWAYETGILNNVLLPKELPEELP 354

>AFR172C Chr6 complement(754470..755819) [1350 bp, 449 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL194C
           (HOS2)
          Length = 449

 Score =  141 bits (356), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 92/335 (27%), Positives = 170/335 (50%), Gaps = 28/335 (8%)

Query: 50  LKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGIDEIG 109
            + G  Y  R+ YH     S + Y   HP  P R+     +++  GL             
Sbjct: 18  FEFGASYTPRVSYHYNSRVSQYHYGVRHPMKPFRLMLTDHLVSRYGL------------H 65

Query: 110 ELMQKIPVREATEEEILTVHSKEHVEFLKTTNTMDREQL----LKETEAGDSVYYNNDSL 165
           ++M     R AT+EE+L  H++++V+FL      +  +L    L++   GD         
Sbjct: 66  KVMDLYETRAATKEEVLAFHAQDYVDFLSHVAPENLNKLPRGSLEKFNIGDDCPIFQGLF 125

Query: 166 ISARLSCGGAIEACKAVVEGRVKNAMAVVRPPG-HHAEPGVAGGFCLFSNVAVAAQNILK 224
             + L  G +++A + ++ G  ++ +A+    G HHA+     GFC  +++ +A  N+L+
Sbjct: 126 EYSMLYAGASLDASRKLING--QSEIAINWSGGLHHAKKSNPSGFCYVNDIVLAILNLLR 183

Query: 225 NYPESVRRVMILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDG 284
            +P    RV+ +D D+HHG+G Q+AFY  +RV  VS H+Y  G+++PGT  G+ D+ G  
Sbjct: 184 YHP----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GDLDEIGCS 236

Query: 285 KGEGFNCNIPWSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHV 344
           +G+ F+ N+P +  G+ D  Y+  F+ ++ P+   ++P ++I   G D+   D +G  ++
Sbjct: 237 RGKHFSLNVPLN-DGIDDDSYINLFKSIIDPLVTSYKPTVIIQQCGADSLGHDRLGCFNL 295

Query: 345 SPACYGHLTHMLKSLARGNMCVVLEGGYNLDSIAK 379
           +   +G     +KS     +CV   GGY   ++++
Sbjct: 296 NIRAHGECVKFVKSFGIPMLCVG-GGGYTPRNVSR 329

>Kpol_246.5 s246 (11759..13120) [1362 bp, 453 aa] {ON}
           (11759..13120) [1362 nt, 454 aa]
          Length = 453

 Score =  141 bits (355), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 103/356 (28%), Positives = 176/356 (49%), Gaps = 35/356 (9%)

Query: 53  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGIDEIGELM 112
           G  Y  R+ YH     S + Y   HP  P R+     +++  GL             ++M
Sbjct: 25  GSAYCPRVSYHFNPKVSNYHYGVKHPMKPFRLMLTDHLVSSYGL------------HKIM 72

Query: 113 QKIPVREATEEEILTVHSKEHVEFLKTT-----NTMDREQLLKETEAGDSVYYNNDSLIS 167
                R AT++E+L  HS ++V FL+       + M R  L K     D   + N    S
Sbjct: 73  DLYETRSATKDELLDFHSDDYVSFLQKVTPENLSKMPRGTLEKYNIGDDCPIFQNLYDYS 132

Query: 168 ARLSCGGAIEACKAVVEGRVKNAMAVVRPPG-HHAEPGVAGGFCLFSNVAVAAQNILKNY 226
           A L  G +++A + ++    ++ +A+    G HHA+     GFC  +++ +A  N+L+ +
Sbjct: 133 A-LYAGASLDASRKLINN--QSDIAINWSGGLHHAKKTNPSGFCYVNDIVLAILNLLRYH 189

Query: 227 PESVRRVMILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKG 286
           P    RV+ +D D+HHG+G Q+AFY  +RV  +S H+Y  G+++PGT  GNYD+ G  +G
Sbjct: 190 P----RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKYN-GEFFPGT--GNYDEIGCAQG 242

Query: 287 EGFNCNIPWSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSP 346
           + F  N+P    G+ D  Y+  F+ ++ P+   ++P ++I   G D+   D +G  +++ 
Sbjct: 243 KHFAMNVPLE-DGIDDDSYINLFKSIIDPLITSYKPTVIIQQCGADSLGHDRLGCFNLNI 301

Query: 347 ACYGHLTHMLKSLARGNMCVVLEGGY---NLDSIAKSALGVAK--VLIGEPPDELP 397
             +G     ++S     M VV  GGY   N+  +     GV    +L  E P+++P
Sbjct: 302 KAHGECVKFIRSFGIP-MLVVGGGGYTPRNVSRLWTYETGVLNNVLLPAELPEDIP 356

>KLTH0E06446g Chr5 complement(594807..596156) [1350 bp, 449 aa] {ON}
           highly similar to uniprot|P53096 Saccharomyces
           cerevisiae YGL194C HOS2 Histone deacetylase required for
           gene activation via specific deacetylation of lysines in
           H3 and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 449

 Score =  140 bits (354), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 98/352 (27%), Positives = 173/352 (49%), Gaps = 29/352 (8%)

Query: 53  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGIDEIGELM 112
           G  Y+  + YH     S F Y   HP  P R+     +++  GL             ++M
Sbjct: 21  GAPYEPNVSYHFNSDVSQFHYGVRHPMKPFRLMLTDHLVSSYGL------------HKIM 68

Query: 113 QKIPVREATEEEILTVHSKEHVEFLKTTNTMDREQL----LKETEAGDSVYYNNDSLISA 168
                R AT EE+   H+ ++VEFL   +  +  +L    L++   GD           +
Sbjct: 69  DLYETRPATREELCEFHADDYVEFLAKVSPDNLSKLPRGTLEKFNIGDDCPIFQGLYQYS 128

Query: 169 RLSCGGAIEACKAVVEGRVKNAMAVVRPPG-HHAEPGVAGGFCLFSNVAVAAQNILKNYP 227
            L  G +++A + ++ G  ++ +A+    G HHA+     GFC  +++ ++  N+L+ +P
Sbjct: 129 TLYAGASLDATRKLING--QSEIAINWSGGLHHAKKSSPSGFCYVNDIVLSVLNLLRYHP 186

Query: 228 ESVRRVMILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKGE 287
               RV+ +D D+HHG+G Q+AFY  +RV  VS H+Y  G+++PGT  GN D+ G  +G+
Sbjct: 187 ----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GNLDETGCSRGK 239

Query: 288 GFNCNIPWSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPA 347
            F  N+P    G+ D  Y+  F+ ++ P+   F+P ++I   G D+   D +G  +++  
Sbjct: 240 HFALNVPLE-DGIDDDSYINLFKSIIDPLITSFKPTVIIQQCGADSLGHDRLGCFNLNVK 298

Query: 348 CYGHLTHMLKSLARGNMCVVLEGGYNLDSIAKSALGVAKVLIG-EPPDELPQ 398
            +G     +KS     M V+  GGY   ++++       +L G   P E+P+
Sbjct: 299 AHGECVRFVKSFGIP-MLVLGGGGYTPRNVSRLWTYETALLNGVSVPQEIPE 349

>NCAS0B05480 Chr2 complement(1033624..1034979) [1356 bp, 451 aa]
           {ON} Anc_8.153
          Length = 451

 Score =  140 bits (353), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 98/355 (27%), Positives = 176/355 (49%), Gaps = 33/355 (9%)

Query: 53  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGIDEIGELM 112
           G  Y  R+ YH     S + Y   HP  P R+     +++  GL             ++M
Sbjct: 23  GSSYTPRVSYHFNPKVSNYHYGVRHPMKPFRLMLTDHLVSSYGL------------HKIM 70

Query: 113 QKIPVREATEEEILTVHSKEHVEFLKTTNTMDREQL----LKETEAGDSVYYNNDSLISA 168
                REAT EE+   HS++++EFL      +  ++    L++   GD      +    +
Sbjct: 71  DLYETREATREEMSQFHSQDYIEFLSKVTPENLSKMPRGTLEKFNIGDDCPIFQNIYDYS 130

Query: 169 RLSCGGAIEACKAVVEGRVKNAMAVVRPPG-HHAEPGVAGGFCLFSNVAVAAQNILKNYP 227
            L  G +++A + ++    ++ +A+    G HHA+     GFC  +++ ++  N+L+ +P
Sbjct: 131 TLYTGASLDASRKLIND--QSDIAINWSGGLHHAKKNNPSGFCYVNDIVLSILNLLRYHP 188

Query: 228 ESVRRVMILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKGE 287
               RV+ +D D+HHG+G Q+AFY  +RV  +S H++  G+++PGT  G++D+ G  KG+
Sbjct: 189 ----RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKFN-GEFFPGT--GDFDEIGCAKGK 241

Query: 288 GFNCNIPWSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPA 347
            F  N+P    G+ D  Y+  F+ ++ P+   ++P ++I   G D+   D +G  +++  
Sbjct: 242 HFAMNVPLE-DGIDDDSYINLFKSIIDPLITAYKPTVIIQQCGADSLGHDRLGCFNLNIK 300

Query: 348 CYGHLTHMLKSLARGNMCVVLEGGY---NLDSIAKSALGVAK--VLIGEPPDELP 397
            +G     +KS     M VV  GGY   N+  +     GV    +L  E P+E+P
Sbjct: 301 AHGECVKFVKSFGIP-MLVVGGGGYTPRNVSRLWTYETGVLNNVLLPSEIPEEIP 354

>TBLA0D02140 Chr4 complement(539873..541243) [1371 bp, 456 aa] {ON}
           Anc_8.153 YGL194C
          Length = 456

 Score =  140 bits (352), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 96/333 (28%), Positives = 170/333 (51%), Gaps = 30/333 (9%)

Query: 53  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGIDEIGELM 112
           G  Y  R+ YH     S + +   HP  P R+           ++ D  +SG   + ++M
Sbjct: 23  GSTYAPRVSYHFNPKVSSYHFGVRHPMKPFRL-----------MLTDHLVSGYG-LHKIM 70

Query: 113 QKIPVREATEEEILTVHSKEHVEFLK-----TTNTMDREQLLKETEAGDSVYYNNDSLIS 167
                R+A+++E+L  H+ +++ FLK       N M R  L K     D   ++N    S
Sbjct: 71  DLYETRKASDDELLEFHTDDYINFLKKVNPDNVNKMPRGTLDKFNIGDDCPIFHNLYEYS 130

Query: 168 ARLSCGGAIEACKAVVEGRVKNAMAVVRPPG-HHAEPGVAGGFCLFSNVAVAAQNILKNY 226
           + L  G +++A + ++ G  ++ +A+    G HHA+     GFC  +++ ++  N+L+ +
Sbjct: 131 S-LYTGASLDASRKLLNG--QSDIAINWSGGLHHAKKTSPSGFCYINDIVLSILNLLRFH 187

Query: 227 PESVRRVMILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKG 286
           P    RV+ +D D+HHG+G Q+AFY  +RV  VS H+Y  G+++PGT  GNYD+ G   G
Sbjct: 188 P----RVLYIDIDLHHGDGVQEAFYTTDRVYTVSFHKYN-GEFFPGT--GNYDETGCSNG 240

Query: 287 EGFNCNIPWSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSP 346
           + F  N+P    G+ D  Y+  F+ ++ P+   + P ++I   G D+   D +G  +++ 
Sbjct: 241 KHFALNVPLK-DGIDDDSYINLFKSIIDPLITSYNPTVIIQQCGADSLGHDRLGCFNLNI 299

Query: 347 ACYGHLTHMLKSLARGNMCVVLEGGYNLDSIAK 379
             +G     +KS     M VV  GGY   ++++
Sbjct: 300 KAHGECVKFVKSFGIP-MLVVGGGGYTPKNVSR 331

>KLLA0F09119g Chr6 (848467..849825) [1359 bp, 452 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194C HOS2 Histone deacetylase required for gene
           activation via specific deacetylation of lysines in H3
           and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 452

 Score =  140 bits (352), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 96/333 (28%), Positives = 166/333 (49%), Gaps = 30/333 (9%)

Query: 53  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGIDEIGELM 112
           G  Y  R+ YH     S + Y   HP  P R+     +++  GL             ++M
Sbjct: 24  GTSYSPRVSYHFNSKVSQYHYGVKHPMKPFRLMLTDHLVSAYGL------------HKVM 71

Query: 113 QKIPVREATEEEILTVHSKEHVEFLK-----TTNTMDREQLLKETEAGDSVYYNNDSLIS 167
                R AT++E+   HS+++V FL      T N + R  L ++   GD           
Sbjct: 72  DLYETRSATKDELTKFHSEDYVNFLAKVTPDTLNKLPRGSL-EKFNIGDDCPIFQGMFDY 130

Query: 168 ARLSCGGAIEACKAVVEGRVKNAMAVVRPPG-HHAEPGVAGGFCLFSNVAVAAQNILKNY 226
           A L  G +++A + ++ G  ++ +A+    G HHA+     GFC  +++ +A  N+L+ +
Sbjct: 131 AALYAGASLDASRKLLNG--QSEIAINWSGGLHHAKKNNPSGFCYVNDIVLAIVNLLRYH 188

Query: 227 PESVRRVMILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKG 286
           P    RV+ +D D+HHG+G Q+AFY  +RV  VS H+Y  G+++PGT  G+ D+ G  +G
Sbjct: 189 P----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GDLDEIGCSRG 241

Query: 287 EGFNCNIPWSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSP 346
           + F  N+P    G+ D  Y+  F+ ++ P+   F+P ++I   G D+   D +G  +++ 
Sbjct: 242 KHFALNVPLQ-DGIEDDSYINLFKSIIDPVITSFRPSVIIQQCGADSLGHDRLGCFNLNI 300

Query: 347 ACYGHLTHMLKSLARGNMCVVLEGGYNLDSIAK 379
             +G     +KS     M VV  GGY   ++++
Sbjct: 301 KAHGECVRFVKSFGVP-MLVVGGGGYTPRNVSR 332

>Ecym_2346 Chr2 complement(678792..680249) [1458 bp, 485 aa] {ON}
           similar to Ashbya gossypii AFR172C
          Length = 485

 Score =  140 bits (352), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 92/337 (27%), Positives = 170/337 (50%), Gaps = 28/337 (8%)

Query: 48  VPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGIDE 107
           +P + G  Y  ++ YH     S + Y   HP  P R+     +++  GL           
Sbjct: 52  LPFEFGSSYSPQVSYHFNPKVSQYHYGVRHPMKPFRLMLTDHLVSCYGL----------- 100

Query: 108 IGELMQKIPVREATEEEILTVHSKEHVEFLKTTNTMDREQL----LKETEAGDSVYYNND 163
             ++M     REAT+EE+L  H+ +++EFL      +  +L    L++   GD       
Sbjct: 101 -HKIMDLYETREATKEELLEFHAPDYIEFLSHVTPENLNKLPRGSLEKFNIGDDCPIFQG 159

Query: 164 SLISARLSCGGAIEACKAVVEGRVKNAMAVVRPPG-HHAEPGVAGGFCLFSNVAVAAQNI 222
               + L  G +++A + ++    ++ +A+    G HHA+     GFC  +++ +A  ++
Sbjct: 160 MFDYSILYAGASLDAARKLINN--QSEIAINWSGGLHHAKKSNPSGFCYVNDIVLAIISL 217

Query: 223 LKNYPESVRRVMILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCG 282
           L+ +P    RV+ +D D+HHG+G Q+AFY  +RV  VS H+Y  G+++PGT  G+ D+ G
Sbjct: 218 LRYHP----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GDLDEIG 270

Query: 283 DGKGEGFNCNIPWSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQC 342
             KG+ F+ N+P    G+ D  Y+  F+ ++ P+   ++P ++I   G D+   D +G  
Sbjct: 271 CSKGKKFSLNVPLQ-DGIDDDSYINLFKSIIDPLVTSYKPTVIIQQCGADSLGHDRLGCF 329

Query: 343 HVSPACYGHLTHMLKSLARGNMCVVLEGGYNLDSIAK 379
           +++   +G     +KS     +CV   GGY   ++++
Sbjct: 330 NLNIKAHGECVKFVKSFGIPILCVG-GGGYTPRNVSR 365

>Kwal_55.20790 s55 complement(559958..561307) [1350 bp, 449 aa] {ON}
           YGL194C (HOS2) - (putative) histone deacetylase [contig
           139] FULL
          Length = 449

 Score =  139 bits (349), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 99/352 (28%), Positives = 174/352 (49%), Gaps = 29/352 (8%)

Query: 53  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGIDEIGELM 112
           G  +   + YH     S F Y   HP  P R+     +++  GL             ++M
Sbjct: 21  GASHQPAVSYHFNDDVSQFHYGVKHPMKPFRLMLTDHLVSSYGL------------HKIM 68

Query: 113 QKIPVREATEEEILTVHSKEHVEFLKTTNTMDREQL----LKETEAGDSVYYNNDSLISA 168
                R AT EE+   HS+++VEFL   +  +  +L    L++   GD           +
Sbjct: 69  DLYETRPATREELCEFHSEDYVEFLARVSPDNLAKLPRGSLEKFNIGDDCPIFQGLYQYS 128

Query: 169 RLSCGGAIEACKAVVEGRVKNAMAVVRPPG-HHAEPGVAGGFCLFSNVAVAAQNILKNYP 227
            L  G +++A + ++ G  ++ +A+    G HHA+     GFC  +++ ++  N+L+ +P
Sbjct: 129 TLYAGASLDATRKLING--QSEIAINWSGGLHHAKKSNPSGFCYVNDIVLSVLNLLRYHP 186

Query: 228 ESVRRVMILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKGE 287
               RV+ +D D+HHG+G Q+AFY  +RV  VS H+Y  G+++PGT  GN D+ G  +G+
Sbjct: 187 ----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GNLDEIGCSRGK 239

Query: 288 GFNCNIPWSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPA 347
            F  N+P    G+ D  Y+  F+ ++ P+   F+P ++I   G D+   D +G  +++  
Sbjct: 240 HFALNVPLD-DGIDDDSYINLFKSIIDPLITSFKPTVIIQQCGADSLGHDRLGCFNLNVK 298

Query: 348 CYGHLTHMLKSLARGNMCVVLEGGYNLDSIAKSALGVAKVLIGE-PPDELPQ 398
            +G     +KS     M VV  GGY   ++++       +L G   P+E+P+
Sbjct: 299 AHGECVKYVKSFGLP-MLVVGGGGYTPRNVSRLWAYETGLLNGVLLPEEIPE 349

>ZYRO0G19316g Chr7 (1600375..1601721) [1347 bp, 448 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194C HOS2 Histone deacetylase required for gene
           activation via specific deacetylation of lysines in H3
           and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 448

 Score =  138 bits (348), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 92/335 (27%), Positives = 169/335 (50%), Gaps = 28/335 (8%)

Query: 50  LKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGIDEIG 109
            + G  Y  R+ YH     S + Y   HP  P R+     +++  GL             
Sbjct: 17  FQFGSSYCPRVSYHFNPKVSNYHYGTKHPMKPFRLMLTDHLVSSYGL------------H 64

Query: 110 ELMQKIPVREATEEEILTVHSKEHVEFLKTTNTMDREQL----LKETEAGDSVYYNNDSL 165
           ++M     R AT EE+   HS+E+V+F+K     +  +L    L++   GD      +  
Sbjct: 65  KIMDLYETRVATWEEMTAFHSEEYVDFMKRVTPENLNKLPRGTLEKFNIGDDCPIFPNLY 124

Query: 166 ISARLSCGGAIEACKAVVEGRVKNAMAVVRPPG-HHAEPGVAGGFCLFSNVAVAAQNILK 224
             + L  G +++A + ++    ++ +A+    G HHA+     GFC  +++ +A  N+L+
Sbjct: 125 DYSSLYAGASLDASRKLIND--QSDIAINWSGGLHHAKKSNPSGFCYVNDIVLATLNLLR 182

Query: 225 NYPESVRRVMILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDG 284
            +P    RV+ +D D+HHG+G Q+AFY  +RV  VS H+Y  G+++PGT  GN+D+ G  
Sbjct: 183 YHP----RVLYIDIDLHHGDGVQEAFYTTDRVYTVSFHKYN-GEFFPGT--GNHDEVGCA 235

Query: 285 KGEGFNCNIPWSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHV 344
           +G+ F  N+P    G+ D  Y+  F+ ++ P+   ++P +++   G D+   D +G  ++
Sbjct: 236 RGKHFALNVPLQ-DGIDDDSYINLFKSIIDPLITSYKPTVIVQQCGADSLGHDRLGCFNL 294

Query: 345 SPACYGHLTHMLKSLARGNMCVVLEGGYNLDSIAK 379
           +   +G   + ++S     M VV  GGY   ++++
Sbjct: 295 NVKAHGECVNFVRSFGLP-MLVVGGGGYTPRNVSR 328

>TDEL0B04580 Chr2 complement(817368..818708) [1341 bp, 446 aa] {ON}
           Anc_8.153 YGL194C
          Length = 446

 Score =  137 bits (346), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 99/355 (27%), Positives = 174/355 (49%), Gaps = 33/355 (9%)

Query: 53  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGIDEIGELM 112
           G  Y  R+ YH     S + Y   HP  P R+     +++  GL             ++M
Sbjct: 21  GSAYCPRVSYHFNPKVSNYHYGVRHPMKPFRLLLTDHLVSSYGL------------HKIM 68

Query: 113 QKIPVREATEEEILTVHSKEHVEFLKTTNTMDREQL----LKETEAGDSVYYNNDSLISA 168
                R AT EEI   H++++++FL      +  ++    L++   GD      +     
Sbjct: 69  DLYETRVATSEEIAEFHTQDYIDFLHKVTPENLSKMPRGTLEKFNIGDDCPIFQNLFNYC 128

Query: 169 RLSCGGAIEACKAVVEGRVKNAMAVVRPPG-HHAEPGVAGGFCLFSNVAVAAQNILKNYP 227
           +L  G +++A + ++    ++ +A+    G HHA+     GFC  +++ +A  N+L+ +P
Sbjct: 129 KLYAGASLDAARKLIND--QSDIAINWSGGLHHAKKSNPSGFCYVNDIVLAILNLLRYHP 186

Query: 228 ESVRRVMILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKGE 287
               RV+ +D D+HHG+G Q+AFY  +RV  VS H+Y  G+++PGT  GN+D+ G   G+
Sbjct: 187 ----RVLYIDIDLHHGDGVQEAFYTTDRVYTVSFHKYN-GEFFPGT--GNHDEVGCANGK 239

Query: 288 GFNCNIPWSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPA 347
            F  N+P    G+ D  Y+  F+ ++ P+   ++P ++I   G D+   D IG  +++  
Sbjct: 240 HFAMNVPLE-DGIDDDSYINLFKSIMDPLITSYKPTVIIQQCGADSLGHDRIGCFNLTIK 298

Query: 348 CYGHLTHMLKSLARGNMCVVLEGGY---NLDSIAKSALGVAK--VLIGEPPDELP 397
            +G     ++S     M VV  GGY   N+  +     GV    +L  E P+E+P
Sbjct: 299 GHGECVKFIRSFGIP-MLVVGGGGYTPRNVSRLWAYETGVLNNVLLSKELPEEIP 352

>CAGL0A03322g Chr1 (338516..339868) [1353 bp, 450 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194c HOS2 or uniprot|P32561 Saccharomyces cerevisiae
           YNL330c RPD3
          Length = 450

 Score =  136 bits (343), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 115/431 (26%), Positives = 202/431 (46%), Gaps = 40/431 (9%)

Query: 53  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGIDEIGELM 112
           G  Y  R+ YH     S++ Y   HP  P R+           ++ D  +SG   + ++M
Sbjct: 21  GSNYAPRVSYHINPEVSHYHYGVRHPMKPFRL-----------MLTDHLVSGYG-LHKIM 68

Query: 113 QKIPVREATEEEILTVHSKEHVEFLKTTNTMDREQL----LKETEAGDSVYYNNDSLISA 168
                R+AT EE+   HS+++V FL      +  +L    L++   GD      +    +
Sbjct: 69  DLYKTRKATAEEMEEFHSEDYVNFLSKVTPENLSKLPRGTLEKFNIGDDCPIFPNIFQYS 128

Query: 169 RLSCGGAIEACKAVVEGRVKNAMAVVRPPG-HHAEPGVAGGFCLFSNVAVAAQNILKNYP 227
            L  G +++A + ++    ++ +A+    G HHA+     GFC  +++ +A  N+L+ +P
Sbjct: 129 SLYTGASLDASRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYINDIVLAILNLLRYHP 186

Query: 228 ESVRRVMILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKGE 287
               RV+ +D D+HHG+G Q+AFY  +RV  +S H+Y  G+++PGT  G  D+ G   G+
Sbjct: 187 ----RVLYIDIDLHHGDGVQEAFYTTDRVYTISFHKYN-GEFFPGT--GKNDETGCADGK 239

Query: 288 GFNCNIPWSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPA 347
            F  N+P    G+ D  Y+  F+ ++ P+   F+P +++   G D+   D +G  +++  
Sbjct: 240 HFAMNVPLE-DGIDDDSYINLFKSIIDPLITTFKPTVILQQCGADSLGHDRLGCFNLNIK 298

Query: 348 CYGHLTHMLKSLARGNMCVVLEGGY---NLDSIAKSALGVA-KVLIGEPPDELPQ--PLK 401
            +G     ++S     M VV  GGY   N+  +     G+   VL+   P+ELP   P K
Sbjct: 299 AHGECVKFVRSFGIP-MLVVGGGGYTPRNVSRLWTYETGILNNVLL---PEELPDNLPFK 354

Query: 402 Q---PKPEAIVTIDMGLVKEQSKYWNCFKGRHGNDGINWREGAVNDSLTSKNFPLQKCCS 458
           +   P       +D       SK +         + I + +GA +  + ++N P Q    
Sbjct: 355 ESFGPDYSLYPVLDNLYENRNSKKFLEDIRIRCLENIRFLQGAPSVRMDAENIPTQDISG 414

Query: 459 PTTQFRRLAKE 469
            T +   L KE
Sbjct: 415 LTEEEEELIKE 425

>YGL194C Chr7 complement(140368..141726) [1359 bp, 452 aa] {ON}
           HOS2Histone deacetylase required for gene activation via
           specific deacetylation of lysines in H3 and H4 histone
           tails; subunit of the Set3 complex, a meiotic-specific
           repressor of sporulation specific genes that contains
           deacetylase activity
          Length = 452

 Score =  136 bits (343), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 90/330 (27%), Positives = 163/330 (49%), Gaps = 28/330 (8%)

Query: 55  CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGIDEIGELMQK 114
            Y  R+ YH     S++ Y   HP  P R+     +++  GL             ++M  
Sbjct: 23  AYSPRVSYHFNSKVSHYHYGVKHPMKPFRLMLTDHLVSSYGL------------HKIMDL 70

Query: 115 IPVREATEEEILTVHSKEHVEFLKTTNTMDREQL----LKETEAGDSVYYNNDSLISARL 170
              R AT +E+L  HS+++V FL   +  +  +L    L+    GD      +      L
Sbjct: 71  YETRSATRDELLQFHSEDYVNFLSKVSPENANKLPRGTLENFNIGDDCPIFQNLYDYTTL 130

Query: 171 SCGGAIEACKAVVEGRVKNAMAVVRPPG-HHAEPGVAGGFCLFSNVAVAAQNILKNYPES 229
             G +++A + ++    ++ +A+    G HHA+     GFC  +++ ++  N+L+ +P  
Sbjct: 131 YTGASLDATRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP-- 186

Query: 230 VRRVMILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKGEGF 289
             R++ +D D+HHG+G Q+AFY  +RV  +S H+Y  G+++PGT  G+  + G  KG+ F
Sbjct: 187 --RILYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPGT--GDLTEIGCDKGKHF 241

Query: 290 NCNIPWSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACY 349
             N+P    G+ D  Y+  F+ +V P+   F+P L++   G D+   D +G  +++   +
Sbjct: 242 ALNVPLE-DGIDDDSYINLFKSIVDPLIMTFKPTLIVQQCGADSLGHDRLGCFNLNIKAH 300

Query: 350 GHLTHMLKSLARGNMCVVLEGGYNLDSIAK 379
           G     +KS     M VV  GGY   ++++
Sbjct: 301 GECVKFVKSFGLP-MLVVGGGGYTPRNVSR 329

>Smik_7.79 Chr7 complement(134747..136105) [1359 bp, 452 aa] {ON}
           YGL194C (REAL)
          Length = 452

 Score =  135 bits (341), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 90/330 (27%), Positives = 163/330 (49%), Gaps = 28/330 (8%)

Query: 55  CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGIDEIGELMQK 114
            Y  R+ YH     S++ Y   HP  P R+     +++  GL             ++M  
Sbjct: 23  AYSPRVSYHFNSKVSHYHYGVKHPMKPFRLMLTDHLVSSYGL------------HKIMDL 70

Query: 115 IPVREATEEEILTVHSKEHVEFLKTTNTMDREQL----LKETEAGDSVYYNNDSLISARL 170
              R AT +E+L  HS+++V FL   +  +  +L    L+    GD      +      L
Sbjct: 71  YETRSATRDELLQFHSEDYVNFLSKVSPDNANKLPRGTLENFNIGDDCPIFQNLYDYTTL 130

Query: 171 SCGGAIEACKAVVEGRVKNAMAVVRPPG-HHAEPGVAGGFCLFSNVAVAAQNILKNYPES 229
             G +++A + ++    ++ +A+    G HHA+     GFC  +++ ++  N+L+ +P  
Sbjct: 131 YTGASLDATRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP-- 186

Query: 230 VRRVMILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKGEGF 289
             R++ +D D+HHG+G Q+AFY  +RV  +S H+Y  G+++PGT  G+  + G  KG+ F
Sbjct: 187 --RILYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPGT--GDLTEIGCDKGKHF 241

Query: 290 NCNIPWSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACY 349
             N+P    G+ D  Y+  F+ +V P+   F+P L++   G D+   D +G  +++   +
Sbjct: 242 ALNVPLE-DGIDDDSYINLFKSIVDPLIITFKPTLIVQQCGADSLGHDRLGCFNLNIKAH 300

Query: 350 GHLTHMLKSLARGNMCVVLEGGYNLDSIAK 379
           G     +KS     M VV  GGY   ++++
Sbjct: 301 GECVKFVKSFGLP-MLVVGGGGYTPRNVSR 329

>Skud_7.79 Chr7 complement(146016..147374) [1359 bp, 452 aa] {ON}
           YGL194C (REAL)
          Length = 452

 Score =  135 bits (340), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 89/330 (26%), Positives = 163/330 (49%), Gaps = 28/330 (8%)

Query: 55  CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGIDEIGELMQK 114
            Y  R+ YH     S++ Y   HP  P R+     +++  GL             ++M  
Sbjct: 23  AYSPRVSYHFNPKVSHYHYGVKHPMKPFRLMLTDHLVSSYGL------------HKIMDL 70

Query: 115 IPVREATEEEILTVHSKEHVEFLKTTNTMDREQL----LKETEAGDSVYYNNDSLISARL 170
              R AT +E+L  HS++++ FL   +  +  +L    L+    GD      +      L
Sbjct: 71  YETRSATRDELLEFHSEDYINFLSKVSPDNSNKLPRGTLENFNIGDDCPIFQNLYDYTTL 130

Query: 171 SCGGAIEACKAVVEGRVKNAMAVVRPPG-HHAEPGVAGGFCLFSNVAVAAQNILKNYPES 229
             G +++A + ++    ++ +A+    G HHA+     GFC  +++ ++  N+L+ +P  
Sbjct: 131 YTGASLDATRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP-- 186

Query: 230 VRRVMILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKGEGF 289
             R++ +D D+HHG+G Q+AFY  +RV  +S H+Y  G+++PGT  G+  + G  KG+ F
Sbjct: 187 --RILYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPGT--GDLTEIGCDKGKHF 241

Query: 290 NCNIPWSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACY 349
             N+P    G+ D  Y+  F+ +V P+   F+P L++   G D+   D +G  +++   +
Sbjct: 242 ALNVPLE-DGIDDDSYINLFKSIVDPLIMTFKPTLIVQQCGADSLGHDRLGCFNLNIKAH 300

Query: 350 GHLTHMLKSLARGNMCVVLEGGYNLDSIAK 379
           G     +KS     M VV  GGY   ++++
Sbjct: 301 GECVKFVKSFGLP-MLVVGGGGYTPRNVSR 329

>NDAI0B02710 Chr2 (674610..675971) [1362 bp, 453 aa] {ON} Anc_8.153
          Length = 453

 Score =  135 bits (339), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 95/352 (26%), Positives = 176/352 (50%), Gaps = 35/352 (9%)

Query: 56  YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGIDEIGELMQKI 115
           Y  R+ YH     S + Y   HP  P R+     +++  GL             ++M   
Sbjct: 28  YTPRVSYHFNPKVSNYHYGVKHPMKPFRLMLTDHLVSSYGL------------HKIMDLY 75

Query: 116 PVREATEEEILTVHSKEHVEFLKTTNTMDREQL----LKETEAGDSVYYNNDSLISARLS 171
             R AT EE++  HS+++++FL      +  ++    L++   GD      +    + L 
Sbjct: 76  ETRPATNEEMVQFHSEDYLDFLSKVTPENLSKMPRGTLEKFNIGDDCPIFQNLYDYSTLY 135

Query: 172 CGGAIEACKAVVEGRVKNAMAVVRPPG-HHAEPGVAGGFCLFSNVAVAAQNILKNYPESV 230
            G +++A + ++    ++ +A+    G HHA+     GFC  +++ ++  N+L+ +P   
Sbjct: 136 TGASLDATRKLIND--QSDIAINWSGGLHHAKKNNPSGFCYINDIVLSIVNLLRYHP--- 190

Query: 231 RRVMILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKGEGFN 290
            RV+ +D D+HHG+G Q+AFY  +RV  +S H++  G+++PGT  G+YD+ G  KG+ F 
Sbjct: 191 -RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKFN-GEFFPGT--GDYDETGCAKGKHFA 246

Query: 291 CNIPWSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYG 350
            N+P    G+ D  Y+  F+ ++ P+   ++P +++   G D+   D +G  +++   +G
Sbjct: 247 MNVPLE-DGIDDDSYINLFKSIMDPLITSYKPTVIVQQCGADSLGHDRLGCFNLNIKGHG 305

Query: 351 HLTHMLKSLARGNMCVVLEGGY---NLDSIAKSALGVA-KVLIGEPPDELPQ 398
                +KS     M VV  GGY   N+  +     G+   VL+   P+ELP+
Sbjct: 306 ECVKFIKSFGIP-MLVVGGGGYTPRNVSRLWTYETGILNNVLL---PNELPE 353

>KNAG0G01350 Chr7 (300791..302146) [1356 bp, 451 aa] {ON} Anc_8.153
           YGL194C
          Length = 451

 Score =  134 bits (337), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 100/359 (27%), Positives = 177/359 (49%), Gaps = 33/359 (9%)

Query: 50  LKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGIDEIG 109
            + G    +R+ YH     S++ Y   HP  P R+           ++ D  +SG   + 
Sbjct: 19  FELGAARPLRVSYHFNPKVSHYHYGVKHPMKPFRL-----------MLTDHLVSGYG-MH 66

Query: 110 ELMQKIPVREATEEEILTVHSKEHVEFLKTTNTMDREQL----LKETEAGDSVYYNNDSL 165
           ++M     R AT +E+   H++++V FL+  +  +  +L    L++   GD      +  
Sbjct: 67  KVMDLYETRAATNDELTEFHTEDYVHFLQKVSPDNLGKLPRGTLEKFNIGDDCPIFQNLY 126

Query: 166 ISARLSCGGAIEACKAVVEGRVKNAMAVVRPPG-HHAEPGVAGGFCLFSNVAVAAQNILK 224
             A L  G +++A + ++ G  ++ +A+    G HHA+     GFC  +++ ++  N+L+
Sbjct: 127 DYATLYTGASLDATRKLING--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSIVNLLR 184

Query: 225 NYPESVRRVMILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDG 284
            +P    RV+ +D D+HHG+G Q+AFY  +RV  +S H+Y  G ++PGT  G+ D+ G  
Sbjct: 185 YHP----RVLYIDIDLHHGDGVQEAFYTTDRVYTISFHKYN-GDFFPGT--GDIDETGCD 237

Query: 285 KGEGFNCNIPWSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHV 344
            GE F  N+P    G+ D  Y+  F+ V+ P+   + P ++I   G D+   D +G  ++
Sbjct: 238 AGERFALNVPLE-DGIDDDSYINLFKSVIGPLITAYNPTVIIQQCGADSLGHDRLGCFNL 296

Query: 345 SPACYGHLTHMLKSLARGNMCVVLEGGY---NLDSIAKSALGVAKVLIGEPPDELPQPL 400
           +   +G     +KS     M VV  GGY   N+  +     GV   +I   P +LP+ L
Sbjct: 297 NIKAHGECVKFVKSFGIP-MLVVGGGGYTPRNVSRLWAYETGVLNDVI--LPKDLPEGL 352

>Suva_7.71 Chr7 complement(135837..137195) [1359 bp, 452 aa] {ON}
           YGL194C (REAL)
          Length = 452

 Score =  132 bits (333), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 88/329 (26%), Positives = 162/329 (49%), Gaps = 28/329 (8%)

Query: 56  YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGIDEIGELMQKI 115
           Y  R+ YH     S++ Y   HP  P R+     +++  GL             ++M   
Sbjct: 24  YSPRVSYHFNPKASHYHYGVKHPMKPIRLMLTDHLVSSYGL------------HKIMDLY 71

Query: 116 PVREATEEEILTVHSKEHVEFLKTTNTMDREQL----LKETEAGDSVYYNNDSLISARLS 171
             R AT++E+   H++++V FL   +  +  +L    L+    GD      +      L 
Sbjct: 72  ETRSATKDELFEFHTEDYVNFLSKVSPENVNKLPRGTLENFNIGDDCPIFQNLYDYTTLY 131

Query: 172 CGGAIEACKAVVEGRVKNAMAVVRPPG-HHAEPGVAGGFCLFSNVAVAAQNILKNYPESV 230
            G  ++A + ++    ++ +A+    G HHA+     GFC  +++ ++  N+L+ +P   
Sbjct: 132 TGATLDATRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP--- 186

Query: 231 RRVMILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKGEGFN 290
            RV+ +D D+HHG+G Q+AFY  +RV  +S H+Y  G+++PGT  G+  + G  KG+ F 
Sbjct: 187 -RVLYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPGT--GDLTEIGCDKGKHFA 242

Query: 291 CNIPWSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYG 350
            N+P    G+ D  Y+  F+ +V P+   F+P +++   G D+   D +G  +++   +G
Sbjct: 243 LNVPLE-DGIDDDSYINLFKSIVDPLITTFKPTVIVQQCGADSLGHDRLGCFNLNIKAHG 301

Query: 351 HLTHMLKSLARGNMCVVLEGGYNLDSIAK 379
                +KS     M VV  GGY   ++++
Sbjct: 302 ECVKFVKSFGLP-MLVVGGGGYTPKNVSR 329

>Suva_14.11 Chr14 complement(13144..14445) [1302 bp, 433 aa] {ON}
           YNL330C (REAL)
          Length = 433

 Score =  132 bits (331), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 92/326 (28%), Positives = 160/326 (49%), Gaps = 28/326 (8%)

Query: 59  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGIDEIGELMQKIPVR 118
           R+ Y        + Y   HP  P RI   + ++   GL +             M+    +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 119 EATEEEILTVHSKEHVEFLKTTNTMDREQLLKET---EAGDSVYYNNDSLISARLSCGGA 175
            AT++E+   H+ E+++FL      + E   +E+     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 176 IEACKAVVEGRVKNAMAVVRPPG-HHAEPGVAGGFCLFSNVAVAAQNILKNYPESVRRVM 234
           +E    +  G+    +AV    G HHA+   A GFC  +++ +    +L+ +P    RV+
Sbjct: 128 MEGAARLNRGKCD--VAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 235 ILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKGEGFNCNIP 294
            +D D+HHG+G ++AFY  +RV+  S H+Y  G+++PGT  G     G GKG+ ++ N+P
Sbjct: 182 YVDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDVGVGKGKNYSVNVP 237

Query: 295 WSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHLTH 354
               G+ DA Y   FE VV  +   +QP  V++ +G D+  GD +G  ++S   + +  +
Sbjct: 238 LR-DGIDDATYRAVFEPVVKRIMDWYQPSAVVLQTGGDSLSGDRLGCFNLSMEGHANCVN 296

Query: 355 MLKSLARGNMCVVLEGGYNLDSIAKS 380
            +KS     M VV  GGY + ++A++
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>KLTH0F19668g Chr6 (1595709..1597007) [1299 bp, 432 aa] {ON} highly
           similar to uniprot|P32561 Saccharomyces cerevisiae
           YNL330C RPD3 Histone deacetylase regulates transcription
           and silencing
          Length = 432

 Score =  131 bits (330), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 92/326 (28%), Positives = 159/326 (48%), Gaps = 28/326 (8%)

Query: 59  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGIDEIGELMQKIPVR 118
           R+ Y      S + Y   HP  P RI   + ++   GL +             M+    +
Sbjct: 20  RVAYFYDSDVSNYSYGASHPMKPARIRMAHSLVMNYGLYKK------------MEIYRAK 67

Query: 119 EATEEEILTVHSKEHVEFLKTTNTMDREQLLKET---EAGDSVYYNNDSLISARLSCGGA 175
            AT++E+   HS E+++FL      + E   KE+     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHSDEYIDFLSRVTPDNLEMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 176 IEACKAVVEGRVKNAMAVVRPPG-HHAEPGVAGGFCLFSNVAVAAQNILKNYPESVRRVM 234
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    RV+
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 235 ILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKGEGFNCNIP 294
            +D D+HHG+G ++AFY  +RV+  S H+Y  G+++PGT  G     G GKG+ ++ N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYSVNVP 237

Query: 295 WSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHLTH 354
               G+ D  Y   FE V+  +   +QP  V++  G D+  GD +G  ++S   + +  +
Sbjct: 238 LR-DGIDDTTYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 355 MLKSLARGNMCVVLEGGYNLDSIAKS 380
            +KS     M VV  GGY + ++A++
Sbjct: 297 YVKSFGI-PMLVVGGGGYTMRNVART 321

>KNAG0A01160 Chr1 complement(7229..8530) [1302 bp, 433 aa] {ON}
           Anc_3.8 YNL330C
          Length = 433

 Score =  130 bits (328), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 92/326 (28%), Positives = 158/326 (48%), Gaps = 28/326 (8%)

Query: 59  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGIDEIGELMQKIPVR 118
           R+ Y        + Y   HP  P RI   + ++   GL +             M+    +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 119 EATEEEILTVHSKEHVEFLKTTNTMDREQLLKET---EAGDSVYYNNDSLISARLSCGGA 175
            AT++E+   H+ E+++FL      + E   KE+     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 176 IEACKAVVEGRVKNAMAVVRPPG-HHAEPGVAGGFCLFSNVAVAAQNILKNYPESVRRVM 234
           +E+   +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    RV+
Sbjct: 128 MESAARLNRGKCD--IAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 235 ILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKGEGFNCNIP 294
            +D D+HHG+G ++AFY  +RV+  S H+Y  G+++PGT  G     G GKG+ +  N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGKGQNYAVNVP 237

Query: 295 WSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHLTH 354
               G+ DA Y   FE VV  +   +QP  V++  G D+  GD +G  ++S   +    +
Sbjct: 238 LR-DGIDDATYRSVFEPVVGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHASCVN 296

Query: 355 MLKSLARGNMCVVLEGGYNLDSIAKS 380
            +KS     M VV  GGY + ++A++
Sbjct: 297 YVKSF-NIPMMVVGGGGYTMRNVART 321

>Skud_14.11 Chr14 complement(11451..12752) [1302 bp, 433 aa] {ON}
           YNL330C (REAL)
          Length = 433

 Score =  130 bits (328), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 91/326 (27%), Positives = 158/326 (48%), Gaps = 28/326 (8%)

Query: 59  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGIDEIGELMQKIPVR 118
           R+ Y        + Y   HP  P RI   + ++   GL +             M+    +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 119 EATEEEILTVHSKEHVEFLKTTNTMDREQLLKET---EAGDSVYYNNDSLISARLSCGGA 175
            AT++E+   H+ E+++FL      + E   +E+     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 176 IEACKAVVEGRVKNAMAVVRPPG-HHAEPGVAGGFCLFSNVAVAAQNILKNYPESVRRVM 234
           +E    +  G+    +AV    G HHA+   A GFC  +++ +    +L+ +P    RV+
Sbjct: 128 MEGAARLNRGKCD--VAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 235 ILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKGEGFNCNIP 294
            +D D+HHG+G ++AFY  +RV+  S H+Y  G+++PGT  G     G G G+ +  N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYSTDRVMTCSFHKY--GEFFPGT--GELRDIGVGTGKNYAVNVP 237

Query: 295 WSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHLTH 354
               G+ DA Y   FE V+  +   +QP  V++  G D+  GD +G  ++S   +G+  +
Sbjct: 238 LR-DGIDDATYRSVFEPVIKKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHGNCVN 296

Query: 355 MLKSLARGNMCVVLEGGYNLDSIAKS 380
            +KS     M VV  GGY + ++A++
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>NDAI0G03740 Chr7 complement(900866..902167) [1302 bp, 433 aa] {ON}
           Anc_3.8
          Length = 433

 Score =  130 bits (328), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 92/326 (28%), Positives = 158/326 (48%), Gaps = 28/326 (8%)

Query: 59  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGIDEIGELMQKIPVR 118
           R+ Y        + Y   HP  P RI   + ++   GL +             M+    +
Sbjct: 20  RVAYFYDADVGNYAYGSGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 119 EATEEEILTVHSKEHVEFLKTTNTMDREQLLKET---EAGDSVYYNNDSLISARLSCGGA 175
            AT++E+   H+ E+++FL      + E   KE+     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLELFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 176 IEACKAVVEGRVKNAMAVVRPPG-HHAEPGVAGGFCLFSNVAVAAQNILKNYPESVRRVM 234
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    RV+
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 235 ILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKGEGFNCNIP 294
            +D D+HHG+G ++AFY  +RV+  S H+Y  G+++PGT  G     G GKG+ +  N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYSTDRVMTCSFHKY--GEFFPGT--GELRDVGVGKGKYYAVNVP 237

Query: 295 WSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHLTH 354
               G+ DA Y   FE VV  +   +QP  V++  G D+  GD +G  ++S   + +  +
Sbjct: 238 LR-DGIDDATYRNVFEPVVKRIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANCVN 296

Query: 355 MLKSLARGNMCVVLEGGYNLDSIAKS 380
            +KS     M VV  GGY + ++A++
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>TBLA0I00560 Chr9 (100393..101694) [1302 bp, 433 aa] {ON} Anc_3.8
           YNL330C
          Length = 433

 Score =  130 bits (327), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 89/326 (27%), Positives = 158/326 (48%), Gaps = 28/326 (8%)

Query: 59  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGIDEIGELMQKIPVR 118
           R+ Y        + Y   HP  P RI   + ++   GL ++            M+    +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKN------------MEIYRAK 67

Query: 119 EATEEEILTVHSKEHVEFLKTTNTMDREQLLKET---EAGDSVYYNNDSLISARLSCGGA 175
            AT++E+   H+ E+++FL      + +   KE+     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 176 IEACKAVVEGRVKNAMAVVRPPG-HHAEPGVAGGFCLFSNVAVAAQNILKNYPESVRRVM 234
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    RV+
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCFLNDIVLGIIELLRYHP----RVL 181

Query: 235 ILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKGEGFNCNIP 294
            +D D+HHG+G ++AFY  +RV+  S H+Y  G+++PGT  G     G G G+ +  N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGNGKNYAVNVP 237

Query: 295 WSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHLTH 354
               G+ DA Y   FE V+  +   +QP  V++  G D+  GD +G  ++S   + +  +
Sbjct: 238 LR-DGIDDATYRSVFEPVISKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANCVN 296

Query: 355 MLKSLARGNMCVVLEGGYNLDSIAKS 380
            +KS     M VV  GGY + ++A++
Sbjct: 297 FVKSFNI-PMMVVGGGGYTMRNVART 321

>TPHA0A00300 Chr1 complement(40868..42169) [1302 bp, 433 aa] {ON}
           Anc_3.8 YNL330C
          Length = 433

 Score =  130 bits (327), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 90/326 (27%), Positives = 158/326 (48%), Gaps = 28/326 (8%)

Query: 59  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGIDEIGELMQKIPVR 118
           R+ Y        + Y   HP  P RI   + ++   GL +             M+    +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLVMNYGLYKK------------MEIYRAK 67

Query: 119 EATEEEILTVHSKEHVEFLKTTNTMDREQLLKET---EAGDSVYYNNDSLISARLSCGGA 175
            AT++E+   H+ E+++FL      + +   KE+     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLFEYCSISGGGS 127

Query: 176 IEACKAVVEGRVKNAMAVVRPPG-HHAEPGVAGGFCLFSNVAVAAQNILKNYPESVRRVM 234
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    RV+
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 235 ILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKGEGFNCNIP 294
            +D D+HHG+G ++AFY  +RV+  S H+Y  G+++PGT  G     G GKG+ +  N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDVGIGKGKNYAVNVP 237

Query: 295 WSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHLTH 354
               G+ DA Y   FE V+  +   +QP  V++  G D+  GD +G  ++S   + +  +
Sbjct: 238 LR-DGMDDATYRSVFESVISKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 355 MLKSLARGNMCVVLEGGYNLDSIAKS 380
            +KS     M VV  GGY + ++A++
Sbjct: 297 FVKSFNI-PMMVVGGGGYTMRNVART 321

>NCAS0C04320 Chr3 (887622..888926) [1305 bp, 434 aa] {ON} Anc_3.8
          Length = 434

 Score =  130 bits (326), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 91/326 (27%), Positives = 158/326 (48%), Gaps = 28/326 (8%)

Query: 59  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGIDEIGELMQKIPVR 118
           R+ Y        + Y   HP  P RI   + ++   GL +             M+    +
Sbjct: 21  RVAYFYDADVGNYAYGSGHPMKPHRIRMTHSLVMNYGLYKK------------MEIYRAK 68

Query: 119 EATEEEILTVHSKEHVEFLKTTNTMDREQLLKET---EAGDSVYYNNDSLISARLSCGGA 175
            AT++E+   H+ E+++FL      + E   KE+     GD     +       +S GG+
Sbjct: 69  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 128

Query: 176 IEACKAVVEGRVKNAMAVVRPPG-HHAEPGVAGGFCLFSNVAVAAQNILKNYPESVRRVM 234
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    RV+
Sbjct: 129 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRFHP----RVL 182

Query: 235 ILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKGEGFNCNIP 294
            +D D+HHG+G ++AFY  +RV+  S H+Y  G+++PGT  G     G GKG+ +  N+P
Sbjct: 183 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYAVNVP 238

Query: 295 WSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHLTH 354
               G+ DA Y   FE V+  +   +QP  V++  G D+  GD +G  ++S   + +  +
Sbjct: 239 LR-DGIDDATYRNVFEPVIKRIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANCVN 297

Query: 355 MLKSLARGNMCVVLEGGYNLDSIAKS 380
            +KS     M VV  GGY + ++A++
Sbjct: 298 YVKSFGI-PMMVVGGGGYTMRNVART 322

>Kwal_55.22142 s55 (1130691..1131989) [1299 bp, 432 aa] {ON} YNL330C
           (RPD3) - histone deacetylase [contig 124] FULL
          Length = 432

 Score =  130 bits (326), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 91/326 (27%), Positives = 159/326 (48%), Gaps = 28/326 (8%)

Query: 59  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGIDEIGELMQKIPVR 118
           R+ Y      S + Y   HP  P RI   + ++   GL +             M+    +
Sbjct: 20  RVAYFYDSDVSNYSYGASHPMKPARIRMAHSLVMNYGLYKK------------MEIYRAK 67

Query: 119 EATEEEILTVHSKEHVEFLKTTNTMDREQLLKET---EAGDSVYYNNDSLISARLSCGGA 175
            AT++E+   H+ E+++FL      + E   KE+     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 176 IEACKAVVEGRVKNAMAVVRPPG-HHAEPGVAGGFCLFSNVAVAAQNILKNYPESVRRVM 234
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    RV+
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 235 ILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKGEGFNCNIP 294
            +D D+HHG+G ++AFY  +RV+  S H+Y  G+++PGT  G     G GKG+ +  N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYAVNVP 237

Query: 295 WSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHLTH 354
               G+ D+ Y   FE V+  +   +QP  V++  G D+  GD +G  ++S   + +  +
Sbjct: 238 LR-DGIDDSTYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 355 MLKSLARGNMCVVLEGGYNLDSIAKS 380
            +KS     M VV  GGY + ++A++
Sbjct: 297 YVKSFGI-PMLVVGGGGYTMRNVART 321

>Kpol_1038.11 s1038 complement(25267..26568) [1302 bp, 433 aa] {ON}
           complement(25267..26568) [1302 nt, 434 aa]
          Length = 433

 Score =  130 bits (326), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 90/326 (27%), Positives = 158/326 (48%), Gaps = 28/326 (8%)

Query: 59  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGIDEIGELMQKIPVR 118
           R+ Y        + Y   HP  P RI   + ++   GL +             M+    +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLVMNYGLYKK------------MEIYRAK 67

Query: 119 EATEEEILTVHSKEHVEFLKTTNTMDREQLLKET---EAGDSVYYNNDSLISARLSCGGA 175
            AT++E+   H+ E+++FL      + +   KE+     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 176 IEACKAVVEGRVKNAMAVVRPPG-HHAEPGVAGGFCLFSNVAVAAQNILKNYPESVRRVM 234
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    RV+
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 235 ILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKGEGFNCNIP 294
            +D D+HHG+G ++AFY  +RV+  S H+Y  G+++PGT  G     G GKG+ +  N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKNYAVNVP 237

Query: 295 WSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHLTH 354
               G+ DA Y   FE V+  +   +QP  V++  G D+  GD +G  ++S   + +  +
Sbjct: 238 LR-DGIDDATYRAVFESVISKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 355 MLKSLARGNMCVVLEGGYNLDSIAKS 380
            +KS     M VV  GGY + ++A++
Sbjct: 297 FVKSFGIPLM-VVGGGGYTMRNVART 321

>CAGL0B01441g Chr2 complement(130216..131517) [1302 bp, 433 aa] {ON}
           highly similar to uniprot|P32561 Saccharomyces
           cerevisiae YNL330c RPD3 histone deacetylase B or
           uniprot|P53096 Saccharomyces cerevisiae YGL194c HOS2
          Length = 433

 Score =  130 bits (326), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 91/326 (27%), Positives = 158/326 (48%), Gaps = 28/326 (8%)

Query: 59  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGIDEIGELMQKIPVR 118
           R+ Y        + Y   HP  P RI   + ++   GL +             M+    +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 119 EATEEEILTVHSKEHVEFLKTTNTMDREQLLKET---EAGDSVYYNNDSLISARLSCGGA 175
            AT++E+   H+ E+++FL      + E   KE+     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 176 IEACKAVVEGRVKNAMAVVRPPG-HHAEPGVAGGFCLFSNVAVAAQNILKNYPESVRRVM 234
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    RV+
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 235 ILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKGEGFNCNIP 294
            +D D+HHG+G ++AFY  +RV+  S H+Y  G+++PGT  G     G GKG+ +  N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGKGKYYAVNVP 237

Query: 295 WSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHLTH 354
               G+ DA Y   FE V+  +   +QP  V++  G D+  GD +G  ++S   + +  +
Sbjct: 238 LR-DGIDDATYRSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHANCVN 296

Query: 355 MLKSLARGNMCVVLEGGYNLDSIAKS 380
            +KS     M VV  GGY + ++A++
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>AGR395W Chr7 (1455659..1456960) [1302 bp, 433 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL330C (RPD3)
          Length = 433

 Score =  129 bits (325), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 90/326 (27%), Positives = 159/326 (48%), Gaps = 28/326 (8%)

Query: 59  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGIDEIGELMQKIPVR 118
           R+ Y        + Y   HP  P RI   + ++   GL +             M+    +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 119 EATEEEILTVHSKEHVEFLKTTNTMDREQLLKET---EAGDSVYYNNDSLISARLSCGGA 175
            AT++E+   H+ E+++FL      + +   KE+     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 176 IEACKAVVEGRVKNAMAVVRPPG-HHAEPGVAGGFCLFSNVAVAAQNILKNYPESVRRVM 234
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    RV+
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 235 ILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKGEGFNCNIP 294
            +D D+HHG+G ++AFY  +RV+  S H+Y  G+++PGT  G     G GKG+ ++ N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYSVNVP 237

Query: 295 WSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHLTH 354
               G+ DA Y   FE V+  +   +QP  V++  G D+  GD +G  ++S   + +  +
Sbjct: 238 LR-DGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 355 MLKSLARGNMCVVLEGGYNLDSIAKS 380
            +KS     M VV  GGY + ++A++
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>KAFR0A08630 Chr1 (1731077..1732378) [1302 bp, 433 aa] {ON} Anc_3.8
           YNL330C
          Length = 433

 Score =  129 bits (325), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 90/326 (27%), Positives = 158/326 (48%), Gaps = 28/326 (8%)

Query: 59  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGIDEIGELMQKIPVR 118
           R+ Y        + Y   HP  P RI   + ++   GL +             M+    +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 119 EATEEEILTVHSKEHVEFLKTTNTMDREQLLKET---EAGDSVYYNNDSLISARLSCGGA 175
            AT++E+   H+ E+++FL      + +   KE+     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 176 IEACKAVVEGRVKNAMAVVRPPG-HHAEPGVAGGFCLFSNVAVAAQNILKNYPESVRRVM 234
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    RV+
Sbjct: 128 MEGAARLNRGKCD--IAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 235 ILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKGEGFNCNIP 294
            +D D+HHG+G ++AFY  +RV+  S H+Y  G+++PGT  G     G GKG+ +  N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGKGKNYAVNVP 237

Query: 295 WSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHLTH 354
               G+ DA Y   FE V+  +   +QP  V++  G D+  GD +G  ++S   + +  +
Sbjct: 238 LR-DGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANCVN 296

Query: 355 MLKSLARGNMCVVLEGGYNLDSIAKS 380
            +KS     M VV  GGY + ++A++
Sbjct: 297 YVKSFNI-PMMVVGGGGYTMRNVART 321

>Ecym_2010 Chr2 complement(12699..14000) [1302 bp, 433 aa] {ON}
           similar to Ashbya gossypii AGR395W
          Length = 433

 Score =  129 bits (325), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 90/326 (27%), Positives = 159/326 (48%), Gaps = 28/326 (8%)

Query: 59  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGIDEIGELMQKIPVR 118
           R+ Y        + Y   HP  P RI   + ++   GL +             M+    +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 119 EATEEEILTVHSKEHVEFLKTTNTMDREQLLKET---EAGDSVYYNNDSLISARLSCGGA 175
            AT++E+   H+ E+++FL      + +   KE+     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 176 IEACKAVVEGRVKNAMAVVRPPG-HHAEPGVAGGFCLFSNVAVAAQNILKNYPESVRRVM 234
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    RV+
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 235 ILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKGEGFNCNIP 294
            +D D+HHG+G ++AFY  +RV+  S H+Y  G+++PGT  G     G GKG+ ++ N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYSVNVP 237

Query: 295 WSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHLTH 354
               G+ DA Y   FE V+  +   +QP  V++  G D+  GD +G  ++S   + +  +
Sbjct: 238 LR-DGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 355 MLKSLARGNMCVVLEGGYNLDSIAKS 380
            +KS     M VV  GGY + ++A++
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>ZYRO0C03498g Chr3 (278064..279365) [1302 bp, 433 aa] {ON} highly
           similar to uniprot|P32561 Saccharomyces cerevisiae
           YNL330C RPD3 Histone deacetylase regulates transcription
           and silencing
          Length = 433

 Score =  129 bits (325), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 90/326 (27%), Positives = 158/326 (48%), Gaps = 28/326 (8%)

Query: 59  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGIDEIGELMQKIPVR 118
           R+ Y        + Y   HP  P RI   + ++   GL +             M+    +
Sbjct: 20  RVAYFYDADVGNYNYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 119 EATEEEILTVHSKEHVEFLKTTNTMDREQLLKET---EAGDSVYYNNDSLISARLSCGGA 175
            AT++E+   H+ E+++FL      + +   KE+     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 176 IEACKAVVEGRVKNAMAVVRPPG-HHAEPGVAGGFCLFSNVAVAAQNILKNYPESVRRVM 234
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    RV+
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKTEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 235 ILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKGEGFNCNIP 294
            +D D+HHG+G ++AFY  +RV+  S H+Y  G+++PGT  G     G GKG+ +  N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYAVNVP 237

Query: 295 WSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHLTH 354
               G+ DA Y   FE VV  +   +QP  V++  G D+  GD +G  ++S   + +  +
Sbjct: 238 LR-DGIDDATYKSVFEPVVSRIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSIRGHANCVN 296

Query: 355 MLKSLARGNMCVVLEGGYNLDSIAKS 380
            +KS     M +V  GGY + ++A++
Sbjct: 297 FVKSFGL-PMMIVGGGGYTMRNVART 321

>SAKL0C13706g Chr3 (1207800..1209101) [1302 bp, 433 aa] {ON} highly
           similar to uniprot|P32561 Saccharomyces cerevisiae
           YNL330C RPD3 Histone deacetylase regulates transcription
           and silencing
          Length = 433

 Score =  129 bits (324), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 90/326 (27%), Positives = 158/326 (48%), Gaps = 28/326 (8%)

Query: 59  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGIDEIGELMQKIPVR 118
           R+ Y        + Y   HP  P RI   + ++   GL +             M+    +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 119 EATEEEILTVHSKEHVEFLKTTNTMDREQLLKET---EAGDSVYYNNDSLISARLSCGGA 175
            AT++E+   H+ E+++FL      +     KE+     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLNMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 176 IEACKAVVEGRVKNAMAVVRPPG-HHAEPGVAGGFCLFSNVAVAAQNILKNYPESVRRVM 234
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    RV+
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 235 ILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKGEGFNCNIP 294
            +D D+HHG+G ++AFY  +RV+  S H+Y  G+++PGT  G     G GKG+ ++ N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYSVNVP 237

Query: 295 WSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHLTH 354
               G+ DA Y   FE V+  +   +QP  V++  G D+  GD +G  ++S   + +  +
Sbjct: 238 LR-DGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMKGHANCVN 296

Query: 355 MLKSLARGNMCVVLEGGYNLDSIAKS 380
            +KS     M VV  GGY + ++A++
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>Smik_14.2 Chr14 complement(2435..3736) [1302 bp, 433 aa] {ON}
           YNL330C (REAL)
          Length = 433

 Score =  128 bits (322), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 90/326 (27%), Positives = 157/326 (48%), Gaps = 28/326 (8%)

Query: 59  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGIDEIGELMQKIPVR 118
           R+ Y        + Y   HP  P RI   + ++   GL +             M+    +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 119 EATEEEILTVHSKEHVEFLKTTNTMDREQLLKET---EAGDSVYYNNDSLISARLSCGGA 175
            AT++E+   H+ E+++FL      + E   +E+     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 176 IEACKAVVEGRVKNAMAVVRPPG-HHAEPGVAGGFCLFSNVAVAAQNILKNYPESVRRVM 234
           +E    +  G+    +AV    G HHA+   A GFC  +++ +    +L+ +P    RV+
Sbjct: 128 MEGAARLNRGKCD--VAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 235 ILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKGEGFNCNIP 294
            +D D+HHG+G ++AFY  +RV+  S H+Y  G+++PGT  G     G G G+ +  N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGTGKNYAVNVP 237

Query: 295 WSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHLTH 354
               G+ DA Y   FE V+  +   +QP  V++  G D+  GD +G  ++S   + +  +
Sbjct: 238 LR-DGIDDATYRSVFEPVIKKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHANCVN 296

Query: 355 MLKSLARGNMCVVLEGGYNLDSIAKS 380
            +KS     M VV  GGY + ++A++
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>YNL330C Chr14 complement(18001..19302) [1302 bp, 433 aa] {ON}
           RPD3Histone deacetylase; regulates transcription,
           silencing, and other processes by influencing chromatin
           remodeling; forms at least two different complexes which
           have distinct functions and members
          Length = 433

 Score =  128 bits (322), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 90/326 (27%), Positives = 157/326 (48%), Gaps = 28/326 (8%)

Query: 59  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGIDEIGELMQKIPVR 118
           R+ Y        + Y   HP  P RI   + ++   GL +             M+    +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 119 EATEEEILTVHSKEHVEFLKTTNTMDREQLLKET---EAGDSVYYNNDSLISARLSCGGA 175
            AT++E+   H+ E+++FL      + E   +E+     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 176 IEACKAVVEGRVKNAMAVVRPPG-HHAEPGVAGGFCLFSNVAVAAQNILKNYPESVRRVM 234
           +E    +  G+    +AV    G HHA+   A GFC  +++ +    +L+ +P    RV+
Sbjct: 128 MEGAARLNRGKCD--VAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 235 ILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKGEGFNCNIP 294
            +D D+HHG+G ++AFY  +RV+  S H+Y  G+++PGT  G     G G G+ +  N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGAGKNYAVNVP 237

Query: 295 WSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHLTH 354
               G+ DA Y   FE V+  +   +QP  V++  G D+  GD +G  ++S   + +  +
Sbjct: 238 LR-DGIDDATYRSVFEPVIKKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHANCVN 296

Query: 355 MLKSLARGNMCVVLEGGYNLDSIAKS 380
            +KS     M VV  GGY + ++A++
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>KLLA0E01981g Chr5 complement(186177..187475) [1299 bp, 432 aa] {ON}
           highly similar to uniprot|P32561 Saccharomyces
           cerevisiae YNL330C RPD3 Histone deacetylase regulates
           transcription and silencing
          Length = 432

 Score =  128 bits (321), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 89/326 (27%), Positives = 158/326 (48%), Gaps = 28/326 (8%)

Query: 59  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGIDEIGELMQKIPVR 118
           R+ Y        + Y   HP  P RI   + ++   GL +             M+    +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 119 EATEEEILTVHSKEHVEFLKTTNTMDREQLLKET---EAGDSVYYNNDSLISARLSCGGA 175
            AT++E+   H+ E+++FL      + +   KE+     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 176 IEACKAVVEGRVKNAMAVVRPPG-HHAEPGVAGGFCLFSNVAVAAQNILKNYPESVRRVM 234
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    RV+
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 235 ILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKGEGFNCNIP 294
            +D D+HHG+G ++AFY  +RV+  S H+Y  G+++PGT  G     G GKG+ +  N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYAVNVP 237

Query: 295 WSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHLTH 354
               G+ DA Y   FE V+  +   +QP  V++  G D+  GD +G  ++S   + +  +
Sbjct: 238 LR-DGIDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMKGHANCVN 296

Query: 355 MLKSLARGNMCVVLEGGYNLDSIAKS 380
            +KS     M +V  GGY + ++A++
Sbjct: 297 YMKSFGVPLM-IVGGGGYTMRNVART 321

>TDEL0A00270 Chr1 complement(44950..46251) [1302 bp, 433 aa] {ON}
           Anc_3.8 YNL330C
          Length = 433

 Score =  127 bits (319), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 91/326 (27%), Positives = 157/326 (48%), Gaps = 28/326 (8%)

Query: 59  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGIDEIGELMQKIPVR 118
           R+ Y        F Y   HP  P RI   + ++   GL +             M+    +
Sbjct: 20  RVAYFYDADVGNFSYGQYHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 119 EATEEEILTVHSKEHVEFLKTTNTMDREQLLKET---EAGDSVYYNNDSLISARLSCGGA 175
            AT++E+   H+ E+++FL      + E   KE+     GD     +       +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLELFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 176 IEACKAVVEGRVKNAMAVVRPPG-HHAEPGVAGGFCLFSNVAVAAQNILKNYPESVRRVM 234
           +E    +  G+    +A+    G HHA+   A GFC  +++ +    +L+ +P    RV+
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKAEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 235 ILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKGEGFNCNIP 294
            +D D+HHG+G ++AFY  +RV+  S H+Y  G+++PGT  G     G G G+ +  N+P
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGSGKYYAVNVP 237

Query: 295 WSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHLTH 354
               G+ DA +   FE VV  +   +QP  V++  G D+  GD +G  ++S   + +  +
Sbjct: 238 LR-DGIDDATFRNVFEPVVGKIMEWYQPAAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 355 MLKSLARGNMCVVLEGGYNLDSIAKS 380
            +KS     M VV  GGY + ++A++
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>TDEL0C05040 Chr3 complement(901798..903162) [1365 bp, 454 aa] {ON}
           Anc_3.362 YPR068C
          Length = 454

 Score = 80.1 bits (196), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 93/182 (51%), Gaps = 11/182 (6%)

Query: 199 HHAEPGVAGGFCLFSNVAVAAQNILKNYPESVRRVMILDWDIHHGNGTQKAFYGDNRVLY 258
           HHA    A GFC  +++ +  Q + +   +  +++  +D+D+HHG+G +KAF   + V  
Sbjct: 206 HHAFKQKASGFCYVNDIVLLIQKLRR---KGFQKISYIDFDLHHGDGVEKAFQFSSNVQT 262

Query: 259 VSLHRYELGKYYPGTSYGNYDQCGDGKGEGFNCNIPWSCSGVGDAEYMWAFEQVVIPMGR 318
           +SLH +E+G ++PGT  GN  +    +      NIP    G+ D       EQ+V P+  
Sbjct: 263 ISLHLFEVG-FFPGT--GNLSESDKRRNV---VNIPL-LHGLDDTSLEQLIEQIVKPVIE 315

Query: 319 EFQPDLVIISSGFDAADGDTIGQCHVSPACYGH-LTHMLKSLARGNMCVVLEGGYNLDSI 377
             +PD+++I  G D   GD   +  +S       +T ++ +     + ++  GGYN+  +
Sbjct: 316 RHEPDVLVIQCGGDGLMGDGFNEWQLSIRGLAKCITELINNTKDCPVILLGGGGYNVTLM 375

Query: 378 AK 379
           ++
Sbjct: 376 SR 377

>CAGL0D01430g Chr4 (158990..160327) [1338 bp, 445 aa] {ON} similar
           to uniprot|Q12214 Saccharomyces cerevisiae YPR068c HOS1
          Length = 445

 Score = 79.7 bits (195), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 71/287 (24%), Positives = 128/287 (44%), Gaps = 19/287 (6%)

Query: 170 LSCGGAIEACKAVVEGRVKNAMAVVRPPGHHAEPGVAGGFCLFSNVAVAAQNILKNYPES 229
           +S G  +   + ++EG  +          HH+    A GFC  +++A+    + +     
Sbjct: 174 VSTGATLSLAQYILEGSERTIAINWDGGRHHSMKTKASGFCYINDIALLIMTLRRG---G 230

Query: 230 VRRVMILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKGEGF 289
           V R+  +D+D+HHG+G +KAF    +V  +SLH YE G ++P +  G+ +    GK    
Sbjct: 231 VDRISYVDFDLHHGDGVEKAFKYSKQVQTISLHMYETG-FFPCS--GSLEDNSSGKSI-- 285

Query: 290 NCNIPWSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACY 349
             NIP    G+ D+      +++++P   + QP++++I  G D   GD   +  +S    
Sbjct: 286 -VNIPL-LHGLDDSTLQDIAKRIIVPSISKHQPNVIVIQCGGDGLKGDKYSEWQLSIK-- 341

Query: 350 GHLTHMLKSLARGNMCVVL---EGGYNLDSIAKSALGVAKVLIGEPPDELPQPLKQPKPE 406
             LT  + SL     C ++    GGYN   +++    +   +  +   E   P+     +
Sbjct: 342 -GLTSTITSLIEQFNCHIVLLGGGGYNNLLMSRFYTYLTWSICHQYASEYSTPIDDLIQD 400

Query: 407 AIVTIDMGLVKEQSKYWNCFKGRHGNDGINWREGAVNDSLTSKNFPL 453
              + D+    EQ K+W   +   G    N+   A  + L  KN PL
Sbjct: 401 HCYS-DL-YSPEQFKFWYYDQETSGGSLKNYNTTAYIEDLI-KNIPL 444

>Suva_16.396 Chr16 complement(689796..691229) [1434 bp, 477 aa] {ON}
           YPR068C (REAL)
          Length = 477

 Score = 79.0 bits (193), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 90/176 (51%), Gaps = 11/176 (6%)

Query: 199 HHAEPGVAGGFCLFSNVAVAAQNILKNYPESVRRVMILDWDIHHGNGTQKAFYGDNRVLY 258
           HHA    A GFC  ++V +  Q + K     + +V  LD+D+HHG+G +KAF    ++  
Sbjct: 212 HHAFKQKANGFCYINDVVLLIQRLRK---LKLSKVTYLDFDLHHGDGVEKAFQYSRQIQT 268

Query: 259 VSLHRYELGKYYPGTSYGNYDQCGDGKGEGFNCNIPWSCSGVGDAEYMWAFEQVVIPMGR 318
           +S+H YE G ++PGT  G+ +   +GK      NIP    G  D        +++ P+ +
Sbjct: 269 ISVHLYEPG-FFPGT--GSLNDSQNGKNI---VNIPLK-HGCDDNYLNLVASKIIHPLIK 321

Query: 319 EFQPDLVIISSGFDAADGDTIGQCHVSPACYGH-LTHMLKSLARGNMCVVLEGGYN 373
              P+++I+  G D   GD   +  ++       + +++KS  + ++ ++  GGYN
Sbjct: 322 RHDPEVIIMECGGDGLQGDRFNEWQLTIRGLSRTIVNIMKSYPQAHIFLLGGGGYN 377

>SAKL0B07854g Chr2 complement(669743..671212) [1470 bp, 489 aa] {ON}
           similar to uniprot|Q12214 Saccharomyces cerevisiae
           YPR068C
          Length = 489

 Score = 78.2 bits (191), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 53/176 (30%), Positives = 88/176 (50%), Gaps = 12/176 (6%)

Query: 199 HHAEPGVAGGFCLFSNVAVAAQNILKNYPESVRRVMILDWDIHHGNGTQKAFYGDNRVLY 258
           HH+    A GFC  +++ +A Q + +N+      +  +D+D+HHG+G ++AF     V  
Sbjct: 242 HHSFKSRASGFCYINDIVLAIQRLRRNFSN----ISYVDFDLHHGDGVERAFQYSKNVQT 297

Query: 259 VSLHRYELGKYYPGTSYGNYDQCGDGKGEGFNCNIPWSCSGVGDAEYMWAFEQVVIPMGR 318
           +SLH +E G ++PGT  G+ +   DG       NIP    G  D   M   E VVIP  +
Sbjct: 298 ISLHNHEPG-FFPGT--GSMESSQDGHS---IINIPLR-HGADDDCLMKITESVVIPCIQ 350

Query: 319 EFQPDLVIISSGFDAADGDTIGQCHVS-PACYGHLTHMLKSLARGNMCVVLEGGYN 373
           +  P +++I  G D   GD   +  ++       +  +L SL   ++ ++  GGYN
Sbjct: 351 KHGPQVIVIQCGGDGLIGDKYEEWQLTIRGLTSSILKILSSLPDTHIILLGGGGYN 406

>Ecym_8290 Chr8 complement(589795..591924) [2130 bp, 709 aa] {ON}
           similar to Ashbya gossypii ADL265W
          Length = 709

 Score = 77.4 bits (189), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 76/300 (25%), Positives = 126/300 (42%), Gaps = 68/300 (22%)

Query: 151 ETEAGDSVYYNNDSLISARLSCGGAIEACKAVVEGRVKN-----AMAVVRPPGHHAEPGV 205
           E   GD +Y   +++ + R S G       ++ +G V       A   +RPPGHH+    
Sbjct: 141 EWNVGD-IYLCEETVYALRGSIGAVEYGVDSIFKGEVNKDTANRAFVAIRPPGHHSHAAT 199

Query: 206 AGGFCLFSNVAVAAQNILKNYPESVRRVMILDWDIHHGNGTQ------------------ 247
             GFCL +N  +A +     Y   V   +ILD+D+HHG+GTQ                  
Sbjct: 200 PSGFCLLNNAHIAVEYAADTY--GVTHAVILDFDLHHGDGTQDICWKRAGFKADDIQDAK 257

Query: 248 -------KAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKG---EGFNCNI---- 293
                  K F    +V Y S+H  ++  +    +Y + D+  D      +  + NI    
Sbjct: 258 GEYNEFDKKFAEFPKVGYFSMH--DINSFPTELNYASKDKVKDASTCIMDAHDVNIWNIH 315

Query: 294 --PWSCSGVGDAEY------MWA-----FEQVVIPMGREFQP--DLVIISSGFDAADGDT 338
             P+      +  Y      ++A     F+   + M ++ +P   LV++S+GFDA++ + 
Sbjct: 316 LLPYETEEEFNKLYQTRYRTLFAKADEFFKAAKLSMAKDGKPFKGLVVMSAGFDASEYEQ 375

Query: 339 IGQ----CHVSPACYGHLTHMLKSLAR----GNMCVVLEGGYNLDSIAKSALGVAKVLIG 390
           +       +V  + Y   T     LA+    G +  +LEGGY+  +IA    GV   LIG
Sbjct: 376 VSMQRHGVNVPTSFYSTFTKDALKLAQMHTNGKIISLLEGGYSDAAIAS---GVFSHLIG 432

>Skud_16.353 Chr16 complement(647799..649214) [1416 bp, 471 aa] {ON}
           YPR068C (REAL)
          Length = 471

 Score = 76.6 bits (187), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 49/176 (27%), Positives = 89/176 (50%), Gaps = 11/176 (6%)

Query: 199 HHAEPGVAGGFCLFSNVAVAAQNILKNYPESVRRVMILDWDIHHGNGTQKAFYGDNRVLY 258
           HHA    A GFC  ++V +  Q + K     + ++  +D+D+HHG+G ++AF    ++  
Sbjct: 212 HHAFKQKANGFCYINDVVLLIQRLRK---MKLNKITYVDFDLHHGDGVERAFQYSKQIQT 268

Query: 259 VSLHRYELGKYYPGTSYGNYDQCGDGKGEGFNCNIPWSCSGVGDAEYMWAFEQVVIPMGR 318
           +S+H YE G ++PGT  G+ +    GK      NIP    G  D+       +++ P+ +
Sbjct: 269 ISIHLYEPG-FFPGT--GSLNDARKGKSV---VNIPLK-HGCDDSYLDLVASKIISPLIK 321

Query: 319 EFQPDLVIISSGFDAADGDTIGQCHVSPACYGH-LTHMLKSLARGNMCVVLEGGYN 373
              PD++II  G D   GD   +  ++       + +++K   R ++ ++  GGYN
Sbjct: 322 RHDPDVLIIECGGDGLLGDRFNEWQLTIRGLSRTIVNVMKLYPRAHIFLLGGGGYN 377

>NDAI0A05120 Chr1 (1164314..1165840) [1527 bp, 508 aa] {ON}
           Anc_3.362 YPR068C
          Length = 508

 Score = 76.6 bits (187), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 59/208 (28%), Positives = 100/208 (48%), Gaps = 14/208 (6%)

Query: 166 ISARLSCGGAIEACKAVVEGRVKNAMAVVRPPG-HHAEPGVAGGFCLFSNVAVAAQNILK 224
           +  ++  G  +   K +     +  +AV    G HHA    A GFC  +++ +  Q +  
Sbjct: 199 VYCQVIVGATLSLAKHITAVANERTIAVNWDGGRHHALRNKASGFCYINDIVLLIQQLRS 258

Query: 225 NYPESVRRVMILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDG 284
           N     +R+  +D+D+HHG+G Q++F     V  +S H +E G ++P T  G+  +   G
Sbjct: 259 N---GYKRITYIDFDLHHGDGVQRSFQYSTSVQTISAHMFEPG-FFPCT--GSLKESKMG 312

Query: 285 KGEGFNCNIPWSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHV 344
           K      NIP    GV D       E+V+IP  + + P++++I  G D   GD   +  +
Sbjct: 313 KNI---VNIPL-LHGVDDMLMNEIVEKVMIPCVKRYDPEILVIQCGGDGLIGDGYAEWQL 368

Query: 345 SPACYGHLTHMLKSLARGNMC-VVLEGG 371
           +   +G + ++LK L     C VVL GG
Sbjct: 369 T--IHGLVNNILKLLRIFPGCPVVLLGG 394

>Kwal_23.3724 s23 (406773..408194) [1422 bp, 473 aa] {ON} YPR068C
           (HOS1) - Similar to Hda1p, Rpd3p, Hos2p, and Hos3p
           [contig 254] FULL
          Length = 473

 Score = 76.3 bits (186), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 56/202 (27%), Positives = 92/202 (45%), Gaps = 12/202 (5%)

Query: 174 GAIEACKAVVEGRVKNAMAVVRPPG-HHAEPGVAGGFCLFSNVAVAAQNILKNYPESVRR 232
           GA          R +  ++V    G HHA    A GFC  +++A+  Q + +     + +
Sbjct: 198 GATIKLARYASSRQQRTISVNWDGGRHHAFKSKASGFCYVNDIAILIQKLRR---RGIHK 254

Query: 233 VMILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKGEGFNCN 292
           +  LD+D+HHG+G ++AF     V  +S+H YE G ++PGT  G       G+      N
Sbjct: 255 ISYLDFDLHHGDGVERAFQHSANVQTISIHMYEEG-FFPGT--GTLKDASSGRNI---VN 308

Query: 293 IPWSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVS-PACYGH 351
           IP    G+ D        +VVIP      P++VII  G D   GD   +  ++       
Sbjct: 309 IP-VLHGMDDTFLNEVVNRVVIPCLHNHNPEVVIIQCGGDGLIGDKYKEWQLTLKGLTDT 367

Query: 352 LTHMLKSLARGNMCVVLEGGYN 373
           +  +++     N+ ++  GGYN
Sbjct: 368 IMKVVEDFPSSNIVLLGGGGYN 389

>KLTH0F10582g Chr6 (910298..911722) [1425 bp, 474 aa] {ON} similar
           to uniprot|Q12214 Saccharomyces cerevisiae YPR068C
          Length = 474

 Score = 76.3 bits (186), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 90/176 (51%), Gaps = 11/176 (6%)

Query: 199 HHAEPGVAGGFCLFSNVAVAAQNILKNYPESVRRVMILDWDIHHGNGTQKAFYGDNRVLY 258
           HHA    A GFC  +++A+  Q + +     +RR+  +D+D+HH +G ++AF     V  
Sbjct: 221 HHASRSRASGFCYINDIALLIQKLRR---RGIRRISYIDFDLHHCDGVERAFQHSQSVQT 277

Query: 259 VSLHRYELGKYYPGTSYGNYDQCGDGKGEGFNCNIPWSCSGVGDAEYMWAFEQVVIPMGR 318
           +S+H +E G ++PGT  G+  +   GK      NIP    G+ D       ++V++P  R
Sbjct: 278 ISVHLHEPG-FFPGT--GSLKEASVGKNV---VNIPVQ-HGMDDTFLNQIVQRVIMPCIR 330

Query: 319 EFQPDLVIISSGFDAADGDTIGQCHVS-PACYGHLTHMLKSLARGNMCVVLEGGYN 373
              P++++I  G D   GD   +  ++      ++ ++++     N+ ++  GGYN
Sbjct: 331 SHNPEVLVIQCGGDGLMGDKYKEWQLTIKGLVNNIMYIVRGFPATNVVMLGGGGYN 386

>YPR068C Chr16 complement(682941..684353) [1413 bp, 470 aa] {ON}
           HOS1Class I histone deacetylase (HDAC) family member
           that deacetylates Smc3p on lysine residues at anaphase
           onset; has sequence similarity to Hda1p, Rpd3p, Hos2p,
           and Hos3p; interacts with the Tup1p-Ssn6p corepressor
           complex
          Length = 470

 Score = 76.3 bits (186), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 49/176 (27%), Positives = 86/176 (48%), Gaps = 11/176 (6%)

Query: 199 HHAEPGVAGGFCLFSNVAVAAQNILKNYPESVRRVMILDWDIHHGNGTQKAFYGDNRVLY 258
           HHA    A GFC  ++V +  Q + K     + ++  +D+D+HHG+G +KAF    ++  
Sbjct: 210 HHAFKQRASGFCYINDVVLLIQRLRK---AKLNKITYVDFDLHHGDGVEKAFQYSKQIQT 266

Query: 259 VSLHRYELGKYYPGTSYGNYDQCGDGKGEGFNCNIPWSCSGVGDAEYMWAFEQVVIPMGR 318
           +S+H YE G ++PGT         D + +    NIP    G  D        ++V P+  
Sbjct: 267 ISVHLYEPG-FFPGTG-----SLSDSRKDKNVVNIPLK-HGCDDNYLELIASKIVNPLIE 319

Query: 319 EFQPDLVIISSGFDAADGDTIGQCHVSPACYGH-LTHMLKSLARGNMCVVLEGGYN 373
             +P+ +II  G D   GD   +  ++       + +++KS  R ++ ++  GGYN
Sbjct: 320 RHEPEALIIECGGDGLLGDRFNEWQLTIRGLSRIIINIMKSYPRAHIFLLGGGGYN 375

>TDEL0A05520 Chr1 complement(970572..972596) [2025 bp, 674 aa] {ON}
           Anc_8.607 YPL116W
          Length = 674

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 89/333 (26%), Positives = 136/333 (40%), Gaps = 75/333 (22%)

Query: 125 ILTVHSKEHVEFLKTTNTMDREQLLK-ETEAGDS-----VYYNNDSLISARLSCGGAIEA 178
           +L VH ++    L        E+L K E E  DS     +Y ++ ++ + + S G     
Sbjct: 108 VLKVHGRDWPPTLLRLCKHADEKLAKGEIEVPDSWNSGDIYLSSKTIEALQGSIGALETG 167

Query: 179 CKAVVEG----RVKN-AMAVVRPPGHHAEPGVAGGFCLFSNVAVAAQNILKNYPESVRRV 233
             ++ EG     V N A  V+RPPGHH   G   GFCL +N  V+ +     Y   +   
Sbjct: 168 VDSIFEGPSPEHVSNRAFVVIRPPGHHCRAGTPSGFCLLNNAHVSIEYAHDTY--GITHA 225

Query: 234 MILDWDIHHGNGTQ-------------------------KAFYGDNRVLYVSLHRYELGK 268
           ++LD+D+HHG+GTQ                         K F    RV Y S+H  ++  
Sbjct: 226 VVLDFDLHHGDGTQDICWKRAGFRPDEQDENTGGYDEFGKKFAEFPRVGYFSMH--DINS 283

Query: 269 YYPGTSYGNYDQCGDGKG---EGFNCNI------PWSCSGVGDAEY------MWA----- 308
           +   + Y   D           G + NI       W      +  Y      ++A     
Sbjct: 284 FPTESGYATKDNIKSASTCIMNGHDLNIWNVHLSAWETEEDFNKLYQSKYRTLFAKADEF 343

Query: 309 FEQVVIPM---GREFQPDLVIISSGFDAADGDTIGQ----CHVSPACYGHLTHMLKSLAR 361
           F+   I M   G++F+  LV+IS+GFDA++ + +       +V    Y   T     LA+
Sbjct: 344 FKNAKIEMSAKGKKFK-GLVVISAGFDASEFEQVSMQRHGVNVPTNFYTMFTKDALKLAQ 402

Query: 362 ----GNMCVVLEGGYNLDSIAKSALGVAKVLIG 390
               G +  VLEGGY+  +I     GV   LIG
Sbjct: 403 MHSEGKVLSVLEGGYSDKAITS---GVFAHLIG 432

>KNAG0H00630 Chr8 (105506..106876) [1371 bp, 456 aa] {ON} Anc_3.362
           YPR068C
          Length = 456

 Score = 74.7 bits (182), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 54/181 (29%), Positives = 92/181 (50%), Gaps = 22/181 (12%)

Query: 199 HHAEPGVAGGFCLFSNVAVAAQNILKNYPESVRRVMILDWDIHHGNGTQKAFYGDNRVLY 258
           HHA  G A GFC  +++ +  Q + K   +   +V  LD+D+HHG+G ++AF    +V  
Sbjct: 206 HHASKGKASGFCYVNDIVLLIQKLRK---QGTGKVTYLDFDLHHGDGVERAFKFTKKVQT 262

Query: 259 VSLHRYELGKYYPGTSYGNYDQCGDGKG-EGFN-CNIPWSCSGVGDAEYMWAFEQVVIPM 316
           +SLH YE G ++P T        G  +G  GF+  N+P    G+ D+      +QVV P+
Sbjct: 263 ISLHLYEPG-FFPCT--------GSLEGSSGFDTVNLPLQ-HGLTDSFLQGLVDQVVNPL 312

Query: 317 GREFQPDLVIISSGFDAADGDTIGQCHVS----PACYGHLTHMLKSLARGNMCVVLEGGY 372
            +   P++++I  G D   GDT  +  +S      C   +  ++    + ++ ++  GGY
Sbjct: 313 IQRHGPEVIVIQCGGDGLLGDTFHEWQLSIRGLTKC---ILDVMSHSTQAHVILLGGGGY 369

Query: 373 N 373
           N
Sbjct: 370 N 370

>Kpol_376.15 s376 complement(25558..27114) [1557 bp, 518 aa] {ON}
           complement(25558..27114) [1557 nt, 519 aa]
          Length = 518

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 57/243 (23%), Positives = 118/243 (48%), Gaps = 15/243 (6%)

Query: 135 EFLKTTNTMDREQLL--KETEAGDSVYYNNDSLISARLSCGGAIEACKAVVEGRVKNAMA 192
           E+ +  N+ +R+Q +  K    GD   ++   L    +S G ++     + +   +  +A
Sbjct: 157 EYFQINNSRERQQDVYKKFNLEGDCPLFSFLPLYCEVIS-GASLMLSDFIEKSSSQRTIA 215

Query: 193 VVRPPG-HHAEPGVAGGFCLFSNVAVAAQNILKNYPESVRRVMILDWDIHHGNGTQKAFY 251
           +    G HHA    A GFC  +++ +  Q + K   + + +V  +D+D+HHG+G +KAF 
Sbjct: 216 INWDGGRHHAIKNKASGFCYINDIVILIQKLRK---KGISKVSYIDFDLHHGDGVEKAFR 272

Query: 252 GDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKGEGFNCNIPWSCSGVGDAEYMWAFEQ 311
             + +  +S+H YE G ++P T  G+ +   +GK      N+P    GV D        +
Sbjct: 273 YSSNIQTISMHMYEPG-FFPCT--GSLEDTLNGKNI---VNVPLY-HGVDDNYMTEIVNE 325

Query: 312 VVIPMGREFQPDLVIISSGFDAADGDTIGQCHVS-PACYGHLTHMLKSLARGNMCVVLEG 370
           ++ P+     P++++I  G D   GD   +  ++      ++ ++++   + ++ ++  G
Sbjct: 326 LIKPLIERHSPEVLVIQCGGDGLIGDKFEEWQLTISGLTRNIQNLIEWFPKSDIILLGGG 385

Query: 371 GYN 373
           GYN
Sbjct: 386 GYN 388

>Smik_16.309 Chr16 complement(559713..561125) [1413 bp, 470 aa] {ON}
           YPR068C (REAL)
          Length = 470

 Score = 74.3 bits (181), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 90/176 (51%), Gaps = 11/176 (6%)

Query: 199 HHAEPGVAGGFCLFSNVAVAAQNILKNYPESVRRVMILDWDIHHGNGTQKAFYGDNRVLY 258
           HHA    A GFC  ++V +  Q + K     + ++  LD+D+HHG+G +KAF    ++  
Sbjct: 210 HHAFKQRASGFCYINDVVLLIQRLRK---IKLNKITYLDFDLHHGDGVEKAFQYSKQIQT 266

Query: 259 VSLHRYELGKYYPGTSYGNYDQCGDGKGEGFNCNIPWSCSGVGDAEYMWAFEQVVIPMGR 318
           +S+H YE G ++PGT  G+ D   D +G     NIP    G  D+       +++ P+  
Sbjct: 267 ISVHIYEPG-FFPGT--GSLD---DSRGGKNVVNIPLK-HGCDDSYLNLIASKIINPLID 319

Query: 319 EFQPDLVIISSGFDAADGDTIGQCHVSPACYGH-LTHMLKSLARGNMCVVLEGGYN 373
           +  P+++II  G D   GD   +  ++       + + +K  ++ ++ ++  GGYN
Sbjct: 320 KHDPEVLIIECGGDGLLGDRFNEWQLTVRGLSETIINFIKRYSQAHIFLLGGGGYN 375

>ADL339W Chr4 (110772..112085) [1314 bp, 437 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR068C (HOS1)
          Length = 437

 Score = 74.3 bits (181), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 71/279 (25%), Positives = 128/279 (45%), Gaps = 22/279 (7%)

Query: 171 SCGGAIEACKAVVEGRVKNAMAVVRPPG-HHAEPGVAGGFCLFSNVAVAAQNILKNYPES 229
           +  GA  A    +     +A+AV    G HHA    A GFC  +++A+  Q + +   + 
Sbjct: 164 TVAGATLALAKELSRHRGSALAVNWDGGRHHALKARASGFCYVNDIALLIQTLRR---QG 220

Query: 230 VRRVMILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKGEGF 289
             RV  +D+D+HHG+G + AF     V   SLH +E G ++PGT  G    C D      
Sbjct: 221 FLRVSYVDFDLHHGDGVENAFRYSKNVQTCSLHLFEPG-FFPGT--GACKNCTDNS---- 273

Query: 290 NCNIPWSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVS-PAC 348
             N+P    GV D+      + +V P  +   P+++II  G D   GD  G+  +S    
Sbjct: 274 VLNVPL-LHGVDDSTLDHVVDHIVTPAVQRHDPEVLIIQCGGDGLSGDKYGEWQLSIHGL 332

Query: 349 YGHLTHMLKSLARGNMCVVLEGGYNLDSIAKSALGVAKVLIGEPPDELPQPLKQPKPEAI 408
             ++  ++++     + ++  GGYN    ++    +  +L+ +    +P  +   + E I
Sbjct: 333 TRNILKLVQAHKFKKIALLGGGGYNGRLQSRFYAYLTSMLLAQCKG-IPTEIGDDEDELI 391

Query: 409 VTIDMGLVKEQS--KYWNCFKGRHGNDGINWREGAVNDS 445
              ++  + EQ   K+W      +  +G+N R+  +ND+
Sbjct: 392 RDHELIEMYEQEDYKFW-----YYEYEGLN-RKNLINDN 424

>ZYRO0C16390g Chr3 complement(1274651..1275961) [1311 bp, 436 aa]
           {ON} similar to uniprot|Q12214 Saccharomyces cerevisiae
           YPR068C
          Length = 436

 Score = 73.9 bits (180), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 52/178 (29%), Positives = 88/178 (49%), Gaps = 15/178 (8%)

Query: 199 HHAEPGVAGGFCLFSNVAVAAQNILKNYPESVRRVMILDWDIHHGNGTQKAFYGDNRVLY 258
           HHA    A GFC  +++ +  Q +     +  +R+  +D+D+HHG+G ++AF   + V  
Sbjct: 195 HHAMKKRASGFCYVNDIVLLIQKL---RSKGFQRLSYIDFDLHHGDGVERAFQFSSNVQT 251

Query: 259 VSLHRYELGKYYPGTSYGNYDQCGDGKGEGFNCNIPWSCSGVGDAEYMWAFEQVVIPMGR 318
           +S+H +E G ++P +  G+ +    GK      NIP +  G+ D        QVVIP+  
Sbjct: 252 ISMHLFECG-FFPTS--GSLEDNKKGKNIA---NIPLA-HGLNDEYLNEIVTQVVIPLTD 304

Query: 319 EFQPDLVIISSGFDAADGDTIGQCHVSPACYGHLTHMLKSLARGNMCVVL---EGGYN 373
              P ++II  G D   GD   +  ++    G   ++LK + R   C ++    GGYN
Sbjct: 305 RHSPQVIIIQCGGDGLMGDEYNEWQLTIK--GLCENILKIVNRYKNCSIVLLGGGGYN 360

>NCAS0A11180 Chr1 complement(2216701..2218173) [1473 bp, 490 aa]
           {ON} Anc_3.362 YPR068C
          Length = 490

 Score = 74.3 bits (181), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 52/202 (25%), Positives = 95/202 (47%), Gaps = 12/202 (5%)

Query: 174 GAIEACKAVVEGRVKNAMAVVRPPG-HHAEPGVAGGFCLFSNVAVAAQNILKNYPESVRR 232
           GA  +    ++   + ++A+    G HHA    A GFC  +++ +  Q I KN     + 
Sbjct: 189 GATLSLSKFLQPNSERSIAINWDGGRHHAFKNKASGFCYVNDIVLLIQKIRKN---GFKN 245

Query: 233 VMILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKGEGFNCN 292
           +  +D+D+HHG+G QKAF     V  VSLH +E G ++P T         + K      N
Sbjct: 246 ISYVDFDLHHGDGVQKAFQFSKNVQTVSLHMFEPG-FFPCTG-----SLQEAKAGSSIVN 299

Query: 293 IPWSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVS-PACYGH 351
           IP    G+         + ++IP+  + +P++++I  G D   GD   +  ++     G 
Sbjct: 300 IPL-LHGLDGTFLKQLTKDIIIPVVEQHEPEVLVIQCGGDGLIGDQYNEWQLTIHDLSGA 358

Query: 352 LTHMLKSLARGNMCVVLEGGYN 373
           +  ++ +    ++ ++  GGYN
Sbjct: 359 IMKLINTFPSCSVVLLGGGGYN 380

>KLLA0B09394g Chr2 (822629..823954) [1326 bp, 441 aa] {ON} similar
           to uniprot|Q12214 Saccharomyces cerevisiae YPR068C HOS1
           Putative class I histone deacetylase (HDAC) with
           sequence similarity to Hda1p, Rpd3p, Hos2p, and Hos3p;
           deletion results in increased histone acetylation at
           rDNA repeats; interacts with the Tup1p-Ssn6p complex
          Length = 441

 Score = 73.6 bits (179), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 49/176 (27%), Positives = 84/176 (47%), Gaps = 11/176 (6%)

Query: 199 HHAEPGVAGGFCLFSNVAVAAQNILKNYPESVRRVMILDWDIHHGNGTQKAFYGDNRVLY 258
           HHA    A GFC  +++ +  Q++ +   +  +RV  +D+D+H+G+G  KAF     V  
Sbjct: 193 HHALKHYASGFCYVNDIVLLIQSLRR---KGWKRVTYIDFDLHYGDGVAKAFRFSENVQT 249

Query: 259 VSLHRYELGKYYPGTSYGNYDQCGDGKGEGFNCNIPWSCSGVGDAEYMWAFEQVVIPMGR 318
           +S+H YE G ++PGT  G+ ++  + K      N+P    G+ D   +     V+ P+  
Sbjct: 250 ISVHLYEPG-FFPGT--GSLEETRNSKQM---VNLP-VLHGMDDKYLLELISSVITPLIE 302

Query: 319 EFQPDLVIISSGFDAADGDTIGQCHVSPACYGHLTHMLKSLARGNMCVVL-EGGYN 373
            F  + ++I  G D   GD   +  +S     H    +  + R     +L  GGYN
Sbjct: 303 TFNAECIVIQCGSDGLSGDKYNEWQLSIRGLTHAIISIMDMFRDKQVFLLGGGGYN 358

>TBLA0B02390 Chr2 (558067..559806) [1740 bp, 579 aa] {ON} Anc_3.362
           YPR068C
          Length = 579

 Score = 73.9 bits (180), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 45/177 (25%), Positives = 94/177 (53%), Gaps = 13/177 (7%)

Query: 199 HHAEPGVAGGFCLFSNVAVAAQNILKNYPESVRRVMILDWDIHHGNGTQKAFYGDNRVLY 258
           HH+    A GFC  +++ +  Q + +   +  R++  LD+D+HHG+G +K+F     +  
Sbjct: 299 HHSRKKKASGFCYVNDIVLCIQKLGE---KGFRKITYLDFDLHHGDGVEKSFQYSKHIQT 355

Query: 259 VSLHRYELGKYYPGTSYGNYDQCGDGKGEGFN-CNIPWSCSGVGDAEYMWAFEQVVIPMG 317
           +S+H +E G ++P T  G+ ++       GFN  NIP +  G+ D    +   +V+IP+ 
Sbjct: 356 ISVHLFEPG-FFPCT--GSLEET----KHGFNIVNIP-TLHGLDDNYLTYLLNRVIIPLI 407

Query: 318 REFQPDLVIISSGFDAADGDTIGQCHVS-PACYGHLTHMLKSLARGNMCVVLEGGYN 373
           ++ +P+ +++  G D   GD   +  ++      ++  +L++    ++ ++  GGYN
Sbjct: 408 KKHKPECLVVQCGGDGLIGDRYKEWQMTISGLTKNIMLVLQNFPECSVVLLGGGGYN 464

>KAFR0H00890 Chr8 (167453..168877) [1425 bp, 474 aa] {ON} Anc_3.362
           YPR068C
          Length = 474

 Score = 72.4 bits (176), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 52/209 (24%), Positives = 95/209 (45%), Gaps = 17/209 (8%)

Query: 169 RLSCGGAIEACKAVVEGRVKNAMAVVRPPG-HHAEPGVAGGFCLFSNVAVAAQNILKNYP 227
           +++ G  +   K +V       + +    G HHA    A GFC  +++ +  Q + KN  
Sbjct: 188 QVTTGATLSLSKFLVPNSKDRTICINWDGGRHHASKKKASGFCYINDIVLLIQRMRKN-- 245

Query: 228 ESVRRVMILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKGE 287
              +++  LD+D+HHG+G +KAF     +  +SLH +E G ++PGT           KG 
Sbjct: 246 -GFKKITYLDFDLHHGDGVEKAFQFSKSIQTISLHLFETG-FFPGTG------GLSNKGS 297

Query: 288 GFNCNIPWSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPA 347
               +IP S  G+ D       +Q++IP       + +++  G D   GD   +  ++  
Sbjct: 298 RDLIDIPLS-HGLTDDYLFELVKQIIIPAIDLHAAEAIVLQCGGDGLSGDKFNEWQLTIK 356

Query: 348 CYGHLTHMLKSLARGNMCVVL---EGGYN 373
             G    ++  + + + C ++    GGYN
Sbjct: 357 --GLTQCIIDVIGKFSDCQIVLLGGGGYN 383

>ZYRO0F10780g Chr6 complement(879680..881686) [2007 bp, 668 aa] {ON}
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116W HOS3 Trichostatin A-insensitive homodimeric
           histone deacetylase (HDAC)
          Length = 668

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 88/333 (26%), Positives = 133/333 (39%), Gaps = 75/333 (22%)

Query: 125 ILTVHSKE-HVEFLKTTNTMDREQLLKETE------AGDSVYYNNDSLISARLSCGGAIE 177
           +L VH K+   + L+     D +   KE E      AGD +Y ++ ++ + + S G    
Sbjct: 106 VLKVHGKDWPPQLLRLCKEADAKLAAKEVEVPASWNAGD-IYLSSKTVEALQGSIGALET 164

Query: 178 ACKAVVEG----RVKN-AMAVVRPPGHHAEPGVAGGFCLFSNVAVAAQNILKNYPESVRR 232
           A  ++ +G     + N A   +RPPGHH       GFCL +N  VA +     +   V  
Sbjct: 165 AVDSIFDGPSPEHISNRAFVAIRPPGHHCHVATPSGFCLLNNAHVAIEYAKDRF--GVTH 222

Query: 233 VMILDWDIHHGNGTQ-------------------------KAFYGDNRVLYVSLHRYELG 267
             ILD+D+HHG+GTQ                         K F    RV Y S+H  ++ 
Sbjct: 223 AAILDFDLHHGDGTQDICWKRAGFRPDEEDEDSPGYDSFGKKFAEYPRVGYFSMH--DIN 280

Query: 268 KYYPGTSYGNYDQCGDGKG---EGFNCNI------PWSCSGVGDAEYMWA---------- 308
            +   + Y   +   +         + NI      PW         Y             
Sbjct: 281 SFPTESGYATKENVKNASTCIMNAHDVNIWNIHLSPWETEEDFAKLYHTKYRSLFVKADE 340

Query: 309 -FEQVVIPMGREFQP--DLVIISSGFDAADGD-TIGQCH---VSPACYGHLTHMLKSLAR 361
            F+Q  I M  + +P   LV+ISSGFDA++ + T  Q H   V    Y   T     L++
Sbjct: 341 FFKQGKIEMAAQNKPFKGLVVISSGFDASEFEQTSMQRHGTNVPTYFYTAFTKDALKLSQ 400

Query: 362 ----GNMCVVLEGGYNLDSIAKSALGVAKVLIG 390
               G +  ++EGGY+  +I     GV   LIG
Sbjct: 401 MHCHGKVLSIMEGGYSDKAIVS---GVFAHLIG 430

>Ecym_3465 Chr3 (874618..875955) [1338 bp, 445 aa] {ON} similar to
           Ashbya gossypii ADL339W
          Length = 445

 Score = 70.1 bits (170), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 61/231 (26%), Positives = 105/231 (45%), Gaps = 21/231 (9%)

Query: 199 HHAEPGVAGGFCLFSNVAVAAQNILKNYPESVRRVMILDWDIHHGNGTQKAFYGDNRVLY 258
           HHA    A GFC  +++ +  Q + KN      RV  +D+D+HHG+  + AF     V  
Sbjct: 195 HHAFKSRASGFCYINDIVLLIQELRKN---GYSRVSYVDFDLHHGDAVESAFQYSRNVQT 251

Query: 259 VSLHRYELGKYYPGTSYGNYDQCGDGKGEGFNCNIPWSCSGVGDAEYMWAFEQVVIPMGR 318
            SLH +E G ++PGT  G++  C     E    NIP    G+ D       + ++IP   
Sbjct: 252 CSLHLFEAG-FFPGT--GSFKNC----RETNVVNIPL-FHGLDDESLDEIVDNILIPCVN 303

Query: 319 EFQPDLVIISSGFDAADGDTIGQCHVSPACYGHLTHMLKSL---ARGNMCVVLEGGYNLD 375
           +  P++++I  G D   GD   +  ++   +G   ++LK +   +   + ++  GGYN  
Sbjct: 304 KHDPEVLVIQCGADGLSGDKYKEWQLT--IHGLTRNILKLVDIHSYKKVVLLGGGGYN-P 360

Query: 376 SIAKSALGVAKVLIGEPPDELPQPLKQPKPEAIV---TIDMGLVKEQSKYW 423
           ++         V + +    +P  +   + E I+    ID    KE  K+W
Sbjct: 361 TLQSRFYTYVTVCLLKYHKGIPSLISDSEDEHIIEHHLIDF-YRKEAYKFW 410

>Kpol_479.6 s479 complement(10892..12958) [2067 bp, 688 aa] {ON}
           complement(10892..12958) [2067 nt, 689 aa]
          Length = 688

 Score = 70.1 bits (170), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 72/298 (24%), Positives = 114/298 (38%), Gaps = 70/298 (23%)

Query: 154 AGDSVYYNNDSLISARLSCGGAIEACKAVVEG----RVKN-AMAVVRPPGHHAEPGVAGG 208
           AGD +Y ++ ++ + + S G       ++  G     + N A   +RPPGHH       G
Sbjct: 145 AGD-IYLSSRTIEALQGSIGALETGVDSIFSGPSPDHISNRAFVAIRPPGHHCHVDTPSG 203

Query: 209 FCLFSNVAVAAQNILKNYPESVRRVMILDWDIHHGNGTQ--------------------- 247
           FCL +N  +A +     Y   +   +ILD+D+HHG+GTQ                     
Sbjct: 204 FCLLNNAHIAIEYASDTY--GITHAVILDFDLHHGDGTQDICWKRAGFRTEAEPETTEGY 261

Query: 248 ----KAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKG---EGFNCNI------P 294
               K F    +V Y S+H  ++  +   + Y   +   +         + NI      P
Sbjct: 262 DEFGKKFAEFPKVGYFSMH--DINSFPTESQYATKENIRNASTCVMNAHDVNIWNIHLSP 319

Query: 295 WSCSGVGDAEYMWAFEQVVI--------------PMGREFQPDLVIISSGFDAADGDTIG 340
           W      D  Y   +  +                 +G+ FQ  LV+IS+GFDA++ +   
Sbjct: 320 WETEQDFDKLYQTKYRTLFAKADEFFRNAKEEMDALGKPFQ-GLVVISAGFDASEFEQTS 378

Query: 341 QCHVSPACYGHLTHMLKSLA--------RGNMCVVLEGGYNLDSIAKSALGVAKVLIG 390
               S     H   M    A         G +  ++EGGY+  +IA    GV   LIG
Sbjct: 379 MQRHSVNVPTHFYTMFTKDALKLSQIHCHGKVLSIMEGGYSDKAIAS---GVFSHLIG 433

>YPL116W Chr16 (329606..331699) [2094 bp, 697 aa] {ON}
           HOS3Trichostatin A-insensitive homodimeric histone
           deacetylase (HDAC) with specificity in vitro for
           histones H3, H4, H2A, and H2B; similar to Hda1p, Rpd3p,
           Hos1p, and Hos2p; deletion results in increased histone
           acetylation at rDNA repeats
          Length = 697

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 82/331 (24%), Positives = 138/331 (41%), Gaps = 72/331 (21%)

Query: 125 ILTVH-SKEHVEFLKTTNTMDREQLLKETEAGDS-----VYYNNDSLISARLSCGGAIEA 178
           +L VH S    E ++     D + L  E E  D+     +Y ++ ++ + + + G     
Sbjct: 110 VLKVHGSSWPAELIELCQMADAKLLKGEIEVPDTWNSGDIYLSSKTIKALQGTIGAIETG 169

Query: 179 CKAVVEG----RVKN-AMAVVRPPGHHAEPGVAGGFCLFSNVAVAAQNILKNYPESVRRV 233
             ++ +G     + N A   +RPPGHH   G   GFCL +N  VA +     Y  +V  V
Sbjct: 170 VDSIFKGPSAEHISNRAFVAIRPPGHHCHYGTPSGFCLLNNAHVAIEYAYDTY--NVTHV 227

Query: 234 MILDWDIHHGNGTQ------------------------KAFYGDNRVLYVSLHRYELGKY 269
           ++LD+D+HHG+GTQ                        K F    +V Y S+H  ++  +
Sbjct: 228 VVLDFDLHHGDGTQDICWKRAGFKPEEEPEDSSYDDFGKKFAEFPKVGYFSMH--DINSF 285

Query: 270 YPGTSYGNYDQCGDGKG---EGFNCNI------PWSCSGVGDAEY------MWA-----F 309
              + +   +   +         + NI       W+     +  Y      ++A     F
Sbjct: 286 PTESGFATKENIKNASTCIMNSHDLNIWNIHLSKWTTEEEFNVLYRTKYRTLFAKADEFF 345

Query: 310 EQVVIPMGREFQP--DLVIISSGFDAADGD-TIGQCH---VSPACYGHLTHMLKSLAR-- 361
               + M ++ +P   LV+IS+GFDA++ + T  Q H   V  + Y   T     LA+  
Sbjct: 346 RSAKLEMNQQGRPFKGLVVISAGFDASEFEQTSMQRHSVNVPTSFYTTFTKDALKLAQMH 405

Query: 362 --GNMCVVLEGGYNLDSIAKSALGVAKVLIG 390
             G +  ++EGGY+  +I     GV   LIG
Sbjct: 406 CHGKVLSLMEGGYSDKAICS---GVFAHLIG 433

>KAFR0H02790 Chr8 complement(531813..533966) [2154 bp, 717 aa] {ON}
           Anc_8.607 YPL116W
          Length = 717

 Score = 67.8 bits (164), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 53/99 (53%), Gaps = 8/99 (8%)

Query: 154 AGDSVYYNNDSLISARLSCGGAIEACKAVVEGR-----VKNAMAVVRPPGHHAEPGVAGG 208
           AGD +Y N+D++++ + S G       ++  G         A   +RPPGHH   G+  G
Sbjct: 145 AGD-IYLNSDTIMALKGSIGAIETGVDSIFNGPSPEHICNRAFVAIRPPGHHCHVGMPSG 203

Query: 209 FCLFSNVAVAAQNILKNYPESVRRVMILDWDIHHGNGTQ 247
           FCL +N  +  +     Y   V  V++LD+D+HHG+GTQ
Sbjct: 204 FCLLNNANITIEYAANTY--GVTHVVVLDFDLHHGDGTQ 240

 Score = 35.0 bits (79), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 67/148 (45%), Gaps = 19/148 (12%)

Query: 304 EYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIG----QCHVSPACYGHLTHMLKSL 359
           E+  A +  +  MG+ ++  LV+ISSGFDA++ + +       +V    Y   T     L
Sbjct: 346 EFFKAAKLEMASMGKPYK-GLVLISSGFDASEFEQVSMQRHSVNVPTTFYTMFTKDALKL 404

Query: 360 AR----GNMCVVLEGGYNLDSIAKSALGVAKVLIGEPPDELPQPLKQPKPEAIVTIDMGL 415
           A+    G +  ++EGGY+  +I     GV   LIG    +    +K+   E +V     +
Sbjct: 405 AQMHCHGKVISIMEGGYSDKAITS---GVFAHLIGLQNQDW---IKEWGSEQVVK---EI 455

Query: 416 VKEQSKYWNCFKGRHGNDGIN-WREGAV 442
           V+     W  +K +  +D I  W E  +
Sbjct: 456 VRGCKPTWKPYKTKRNDDVIRVWAEEVI 483

>KLTH0D09592g Chr4 complement(792708..794825) [2118 bp, 705 aa] {ON}
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116W HOS3 Trichostatin A-insensitive homodimeric
           histone deacetylase (HDAC)
          Length = 705

 Score = 67.4 bits (163), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 72/263 (27%), Positives = 103/263 (39%), Gaps = 62/263 (23%)

Query: 183 VEGRVKNAMAVVRPPGHHAEPGVAGGFCLFSNVAVAAQNILKNYPESVRRVMILDWDIHH 242
           VE     A   +RPPGHH+      GFCL +N  +A +     Y   V   ++LD+D+HH
Sbjct: 178 VEQTSNRAFVALRPPGHHSHASTPSGFCLLNNAHIAIEYAADTY--GVTHAVVLDFDLHH 235

Query: 243 GNGTQ-------------------------KAFYGDNRVLYVSLHRY-----ELGKYYPG 272
           G+GTQ                         K F    +V Y SLH       ELG Y   
Sbjct: 236 GDGTQDICWKRAGFKPDGCDDGGSEYNEFGKKFAEFPKVGYFSLHDINSFPTELG-YATK 294

Query: 273 TSYGNYDQCGDGKGEGFNCNIPWSCSGVGDA-----------------EYMWAFEQVVIP 315
            +  N   C     +    N+        +A                 EY    +Q +  
Sbjct: 295 ENVRNAATCIMDAHDVNIWNVHLQSYDSDEAFTKLYQTKYRTLFAKADEYFRTAKQNMRA 354

Query: 316 MGREFQPDLVIISSGFDAADGDTIGQ----CHVSPACYGHLTHMLKSLAR----GNMCVV 367
           +G+ F+  LV+IS+GFDA++ +         +V    Y   T     LA+    G +  V
Sbjct: 355 LGKPFK-GLVVISAGFDASEYEQPSMQRHAVNVPTFFYNLFTKDALKLAQMHSHGKLLSV 413

Query: 368 LEGGYNLDSIAKSALGVAKVLIG 390
           LEGGY+  +I+    GV   LIG
Sbjct: 414 LEGGYSDGAISS---GVFAHLIG 433

>SAKL0H08338g Chr8 (716414..718486) [2073 bp, 690 aa] {ON} similar
           to uniprot|Q02959 Saccharomyces cerevisiae YPL116W HOS3
           Trichostatin A-insensitive homodimeric histone
           deacetylase (HDAC)
          Length = 690

 Score = 67.4 bits (163), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 95/415 (22%), Positives = 161/415 (38%), Gaps = 92/415 (22%)

Query: 158 VYYNNDSLISARLSCGGAIEACKAVVEGRVK-----NAMAVVRPPGHHAEPGVAGGFCLF 212
           +Y +  ++ +   S G       ++ +G  +      A   VRPPGHH+      GFCL 
Sbjct: 148 IYLSQQTIAALEGSIGALETGIDSIFQGSSQEDIANRAFVAVRPPGHHSHTATPSGFCLL 207

Query: 213 SNVAVAAQNILKNYPESVRRVMILDWDIHHGNGTQ------------------------K 248
           +N  +A +     +  +V   ++LD+D+HHG+GTQ                        K
Sbjct: 208 NNAHIAIEYAADTF--NVTHAVVLDFDLHHGDGTQDICWKRAGFNPDEQDDDPAYDEFGK 265

Query: 249 AFYGDNRVLYVSLHRY-----ELGKYYPGTSYGNYDQCGDGKGEGFNCNIPWS------- 296
            F    +V Y S+H       ELG Y    +  N   C     +    N+  S       
Sbjct: 266 KFAEFPKVGYFSMHDINSFPTELG-YATKENIKNASTCIMNAHDLNIWNVHLSHYETEED 324

Query: 297 CSGVGDAEYMWAFEQV----------VIPMGREFQPDLVIISSGFDAADGDTIG-QCH-- 343
              +  ++Y   F +           +   G++F+  LV+IS+GFDA++ +    Q H  
Sbjct: 325 FVKLYQSKYRSLFAKADEFFKNAKKEMASQGKKFK-GLVVISAGFDASEYEQPSMQRHGV 383

Query: 344 VSPAC-YGHLTHMLKSLAR----GNMCVVLEGGYNLDSIAK------------------- 379
             P C Y   T     LA+    G +  V+EGGY+  +I+                    
Sbjct: 384 NVPTCFYNMFTKDALKLAQMHTSGKVLSVMEGGYSDGAISSGVFSHLIGLQNQNWINEWG 443

Query: 380 SALGVAKVLIGEPPDELPQPLKQPK------PEAIVTIDMGLVKE-QSKYWNCFKGRHGN 432
           SA  V +++ G  P   P   K+ +       E ++ +   ++ E +   +   + +   
Sbjct: 444 SAQVVKEIIRGCKPQWKPYKTKKARDVIRIWAEEVIKLGRSMIPEFEDLLFGMVEAQIVP 503

Query: 433 D--GINWREGAVNDSLTSKNFPLQKCCSPTTQFRRLAKEYK-FVTLPLLNMELPS 484
           D   +   + A N      N  L +  +PT + RRLA+  K    +P L  +LPS
Sbjct: 504 DVKRVTRSQKASNVVAKVNNVALPRSDTPTPEDRRLARNNKPSEAVPFLQQDLPS 558

>TBLA0E04080 Chr5 complement(1026669..1028753) [2085 bp, 694 aa]
           {ON} Anc_8.607 YPL116W
          Length = 694

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 70/256 (27%), Positives = 105/256 (41%), Gaps = 62/256 (24%)

Query: 190 AMAVVRPPGHHAEPGVAGGFCLFSNVAVAAQNILKNYPESVRRVMILDWDIHHGNGTQ-- 247
           A   +RPPGHH +     GFCL +N  ++ +    +Y   +   +ILD+D+HHG+GTQ  
Sbjct: 187 AFVAIRPPGHHCKVATPSGFCLLNNAHISIEYAADHY--GITHAVILDFDLHHGDGTQDI 244

Query: 248 -----------------------KAFYGDNRVLYVSLHRYELGKYYPGTSYG---NYDQC 281
                                  K F    +V Y S+H  ++  +   T Y    N    
Sbjct: 245 CWKRAGFRSEDEPEGSEGYDDFGKKFAEFPKVGYFSMH--DINSFPTETGYATKVNIRNA 302

Query: 282 GDGKGEGFNCNI------PWSCSGVGDAEY------MWA-----FEQVVIPMGREFQP-- 322
                +G + NI      PW+        Y      ++A     F      M +E +P  
Sbjct: 303 STCIMDGHDLNIWNIHLSPWNTEEDFQKLYQSKYRTLFAKADDYFRNAKYQMAQEGKPFK 362

Query: 323 DLVIISSGFDAADGD-TIGQCH---VSPACYGHLTHMLKSLA----RGNMCVVLEGGYNL 374
            LV+IS+GFDA++ + T  Q H   V    Y   T     LA    +G +  +LEGGY+ 
Sbjct: 363 GLVVISAGFDASEYEQTSMQRHNVNVPTNFYTMFTKDALKLAQIHCQGKVLSLLEGGYSD 422

Query: 375 DSIAKSALGVAKVLIG 390
            ++     GV   LIG
Sbjct: 423 KALTS---GVFAHLIG 435

>Smik_6.315 Chr6 complement(492590..494683) [2094 bp, 697 aa] {ON}
           YPL116W (REAL)
          Length = 697

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 93/384 (24%), Positives = 154/384 (40%), Gaps = 79/384 (20%)

Query: 125 ILTVH-SKEHVEFLKTTNTMDREQLLKETEAGDS-----VYYNNDSLISARLSCGGAIEA 178
           +L VH S    E ++     D + L  E E  D+     +Y ++ ++ + + + G     
Sbjct: 110 VLKVHGSHWPAELIELCQMADAKLLKGEIEVPDTWNSGDIYLSSKTIKALQGTIGAIETG 169

Query: 179 CKAVVEG----RVKN-AMAVVRPPGHHAEPGVAGGFCLFSNVAVAAQNILKNYPESVRRV 233
             ++ EG     + N A   +RPPGHH       GFCL +N  VA +     Y  +V  V
Sbjct: 170 VDSIFEGPSAEHISNRAFVAIRPPGHHCHYATPSGFCLLNNAHVAIEYAYDTY--NVTHV 227

Query: 234 MILDWDIHHGNGTQ------------------------KAFYGDNRVLYVSLHRYELGKY 269
           ++LD+D+HHG+GTQ                        K F    +V Y S+H  ++  +
Sbjct: 228 VVLDFDLHHGDGTQDICWKRAGFKPEEEPENSSYDEFDKKFAEFPKVGYFSMH--DINSF 285

Query: 270 YPGTSYGNYDQCGDGKG---EGFNCNI------PWSCSGVGDAEY------MWA-----F 309
              + +   +   +         + NI       W+     +  Y      ++A     F
Sbjct: 286 PTESGFATKENIKNASTCIMNSHDLNIWNVHLSKWTTEEEFNILYRTKYRTLFAKADEFF 345

Query: 310 EQVVIPMGREFQP--DLVIISSGFDAADGD-TIGQCH---VSPACYGHLTHMLKSLAR-- 361
                 M +  +P   LV+IS+GFDA++ + T  Q H   V  + Y   T     LA+  
Sbjct: 346 RSAKQEMNQNEKPFKGLVVISAGFDASEFEQTSMQRHSVNVPTSFYTTFTKDALKLAQMH 405

Query: 362 --GNMCVVLEGGYNLDSIAKSALGVAKVLIGEPPDELPQPLKQPKPEAIVTIDMGLVKEQ 419
             G +  ++EGGY+  +I     GV   LIG    +    +K+   E +V     +V+  
Sbjct: 406 CHGKVLSLMEGGYSDKAICS---GVFAHLIGLQNQDW---VKEWGSEQVVK---EIVRGC 456

Query: 420 SKYWNCFKGRHGNDGIN-WREGAV 442
              W  +K R   D I  W E  +
Sbjct: 457 KPAWKPYKTRRAKDVIRIWAEEVI 480

>ADL265W Chr4 (237911..239995) [2085 bp, 694 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL116W (HOS3)
          Length = 694

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 66/257 (25%), Positives = 98/257 (38%), Gaps = 64/257 (24%)

Query: 190 AMAVVRPPGHHAEPGVAGGFCLFSNVAVAAQNILKNYPESVRRVMILDWDIHHGNGTQ-- 247
           A   +RPPGHH+      GFCL +N  +A +     Y   V    ILD+D+HHG+GTQ  
Sbjct: 184 AFVALRPPGHHSHTSTPSGFCLLNNAHIAVEYAASRY--GVTHAAILDFDLHHGDGTQDI 241

Query: 248 -----------------------KAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDG 284
                                  K F    +V Y SLH  ++  +     Y +     D 
Sbjct: 242 CWKRAGFKPDDEEDNAAEYDDFGKRFAEFPKVGYFSLH--DINSFPTEQGYAHKTSIKDA 299

Query: 285 K---------------------GEGFN--CNIPWSCSGVGDAEYMWAFEQVVIPMGREFQ 321
                                  E FN      +        E++   ++ +   G+ ++
Sbjct: 300 SVCIMDSHDVNIWNIHLTAYETEEEFNKLYQTKYRAIFAKADEFLRVSQKRMASEGKNYK 359

Query: 322 PDLVIISSGFDAADGDTIGQ----CHVSPACYGHLTHMLKSLA----RGNMCVVLEGGYN 373
             L+IIS+GFDA++ + +       HV  + Y   T     LA    +G +  +LEGGY 
Sbjct: 360 -GLIIISAGFDASEHEQLSMQRHGVHVPTSFYCAFTKDALKLAQMHTQGKLLSLLEGGY- 417

Query: 374 LDSIAKSALGVAKVLIG 390
             S A    GV   LIG
Sbjct: 418 --SDAALVSGVFSHLIG 432

>Suva_16.194 Chr16 (339127..341226) [2100 bp, 699 aa] {ON} YPL116W
           (REAL)
          Length = 699

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 89/384 (23%), Positives = 149/384 (38%), Gaps = 79/384 (20%)

Query: 125 ILTVH-SKEHVEFLKTTNTMDREQLLKETEAGDS-----VYYNNDSLISARLSCGGAIEA 178
           +L VH S    E ++     D + L  E E  D+     +Y ++ ++ + + + G     
Sbjct: 110 VLKVHGSHWPTELIELCQMADAKLLKGEIEVPDTWNSGDIYLSSKTIQALQGTIGAIETG 169

Query: 179 CKAVVEG----RVKN-AMAVVRPPGHHAEPGVAGGFCLFSNVAVAAQNILKNYPESVRRV 233
             ++ +G     + N A   +RPPGHH       GFCL +N  VA +     Y   V  V
Sbjct: 170 VDSIFKGPSPEHISNRAFVAIRPPGHHCHYATPSGFCLLNNAHVAIEYAFDTY--DVTHV 227

Query: 234 MILDWDIHHGNGTQ------------------------KAFYGDNRVLYVSLHRYELGKY 269
           ++LD+D+HHG+GTQ                        K F    +V Y S+H  ++  +
Sbjct: 228 VVLDFDLHHGDGTQDICWKRAGFKPEEESENSSYDNFGKKFAEFPKVGYFSMH--DINSF 285

Query: 270 YPGTSYGNYDQCGDGKG---EGFNCNI------PWSCSGVGDAEYMWAFEQVVIPMGREF 320
              + +   +   +         + NI       W+     +  Y   +  +       F
Sbjct: 286 PTESGFATKENIKNASTCIMNSHDLNIWNVHLSKWTTEEDFNILYRTKYRTLFAKADEFF 345

Query: 321 Q-------------PDLVIISSGFDAADGD-TIGQCH---VSPACYGHLTHMLKSLAR-- 361
           +               LV+IS+GFDA++ + T  Q H   V  + Y   T     LA+  
Sbjct: 346 KTAKLEMNQQEKTFKGLVVISAGFDASEFEQTSMQRHSVNVPTSFYTTFTKDALKLAQMH 405

Query: 362 --GNMCVVLEGGYNLDSIAKSALGVAKVLIGEPPDELPQPLKQPKPEAIVTIDMGLVKEQ 419
             G +  ++EGGY+  +I     GV   LIG    +    +K+   E +V     +V+  
Sbjct: 406 CHGKVLSLMEGGYSDKAICS---GVFAHLIGLQNQDW---VKEWGSEQVVK---EIVRGC 456

Query: 420 SKYWNCFKGRHGNDGIN-WREGAV 442
              W  +K R   D I  W E  +
Sbjct: 457 KSTWKPYKTRRAKDVIRIWAEEVI 480

>KNAG0J01300 Chr10 (232784..234817) [2034 bp, 677 aa] {ON} Anc_8.607
           YPL116W
          Length = 677

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 80/306 (26%), Positives = 128/306 (41%), Gaps = 70/306 (22%)

Query: 147 QLLKETEAGDSVYYNNDSLISARLSCGGAIEACKAVVEG----RVKN-AMAVVRPPGHHA 201
           ++ KE  AGD +Y ++ +L + R + G        +  G     + N    VVRPPGHH 
Sbjct: 136 EVPKEWNAGD-IYLSSATLTALRGTIGALETGVDTIFTGASPEHISNRVFVVVRPPGHHC 194

Query: 202 EPGVAGGFCLFSNVAVAAQNILKNYPESVRRVMILDWDIHHGNGTQ------KAFYGDN- 254
                 GFCL +N  ++ +     Y   V    ILD+D+HHG+GTQ        F  D  
Sbjct: 195 HVTGPSGFCLLNNAHISIEYAADTY--GVTHAAILDFDLHHGDGTQDICWKRAGFKPDGA 252

Query: 255 --------------------RVLYVSLHRYELGKYYPGTSYGNYDQCGDGKG---EGFNC 291
                               +V Y S+H  ++  +   + Y   +   +      +  + 
Sbjct: 253 TREENEEPYDDFGKRTAAFPKVGYFSMH--DINSFPTESGYATSENIRNASTCIMDSHDL 310

Query: 292 NI------PWSCS----GVGDAEY--MWA-----FEQVVIPMGREFQP--DLVIISSGFD 332
           NI      PW+       +  ++Y  ++A     F+   + M ++  P   LV+IS+GFD
Sbjct: 311 NIWNVHLAPWATEEDFMKLYRSKYRTLFAKADEYFKTARLEMQKQGTPFKGLVVISAGFD 370

Query: 333 AADGD-TIGQCH---VSPACYGHLTHMLKSLA----RGNMCVVLEGGYNLDSIAKSALGV 384
           A++ + T  Q H   V    Y   T  +  LA    +G +  V+EGGY+  +I     GV
Sbjct: 371 ASEFEQTSMQRHSVNVPTEFYTLFTKDVLKLAQMHTQGKVLSVMEGGYSDKAITS---GV 427

Query: 385 AKVLIG 390
              LIG
Sbjct: 428 FAHLIG 433

>KLLA0F00858g Chr6 complement(78519..80666) [2148 bp, 715 aa] {ON}
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116W HOS3 Trichostatin A-insensitive homodimeric
           histone deacetylase (HDAC)
          Length = 715

 Score = 65.5 bits (158), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 73/274 (26%), Positives = 109/274 (39%), Gaps = 76/274 (27%)

Query: 183 VEGRVKNAMAVVRPPGHHAEPGVAGGFCLFSNVAVAAQNILKNYPESVRRVMILDWDIHH 242
           VE     A   +RPPGHH+      GFCL +N  +A +   + Y   V   +ILD+D+HH
Sbjct: 176 VEQTANRAFIAIRPPGHHSHASTPSGFCLLNNAHIAIEYAFEKY--DVTHAVILDFDLHH 233

Query: 243 GNGTQ---------------------------------KAFYGDNRVLYVSLHRY----- 264
           G+GTQ                                 K+F    +V Y SLH       
Sbjct: 234 GDGTQDICWKRAGFRPDEFSTDAEHGASEDDNKYDEFGKSFAEFPKVGYFSLHDINSFPT 293

Query: 265 ELGKYYPGTSYGNYDQCGDGKGEGFNCNIPWSC---SGVGDAEYMWAFE---QVVIPMGR 318
           ELG Y    +  N   C     +  + NI W+    S   + E++  ++   + +     
Sbjct: 294 ELG-YATKENIRNASTC---IMDAHDINI-WNVHLQSYKDEEEFVKLYQTKYRSIFAKAD 348

Query: 319 EFQPD--------------LVIISSGFDAADGDTIG----QCHVSPACYGHLTHMLKSLA 360
           EF  +              LV+IS+GFDA++ +         +V  + Y   T     LA
Sbjct: 349 EFFKNAKLEMKQGGFRFKGLVVISAGFDASEYEQQSMQRHNVNVPTSFYNLFTKDALKLA 408

Query: 361 R----GNMCVVLEGGYNLDSIAKSALGVAKVLIG 390
           +    G +  V+EGGY+  +IA    GV   LIG
Sbjct: 409 QMHSNGKIISVMEGGYSDGAIAS---GVFSHLIG 439

>TPHA0A01120 Chr1 (216522..218618) [2097 bp, 698 aa] {ON} Anc_8.607
           YPL116W
          Length = 698

 Score = 65.1 bits (157), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 80/325 (24%), Positives = 127/325 (39%), Gaps = 76/325 (23%)

Query: 135 EFLKTTNTMDREQLLKETEAGDS-----VYYNNDSLISARLSCGGAIEACKAVVEG---- 185
           + +K     D++    E E  DS     +Y +++++ +   S G       ++  G    
Sbjct: 121 DLIKYCQEADKKLQNGEIEVPDSWNSGDIYLSSETIKAIEGSIGALELGLDSIFHGPSAE 180

Query: 186 RVKN-AMAVVRPPGHHAEPGVAGGFCLFSNVAVAAQNILKNYPESVRRVMILDWDIHHGN 244
            + N A   +RPPGHH       GFCL +N  +A +   + Y   V   +ILD+D+HHG+
Sbjct: 181 HISNRAFVAIRPPGHHCHVSTPSGFCLLNNAQIAIEYAYEKY--GVSHAVILDFDLHHGD 238

Query: 245 GTQ---------------------KAFYGD--------NRVLYVSLHRYELGKYYPGTSY 275
           GTQ                     K  Y D         +V Y S+H  ++  +   + Y
Sbjct: 239 GTQDICWKRAGFKPDDGNVQDDEDKNEYDDFGKKMADFPKVGYFSMH--DINSFPTESGY 296

Query: 276 GNYDQCGDGKG---EGFNCNI------PWSCSGVGDAEYMWAFEQVVIPMGREFQ----- 321
              D   +      +  + NI       W+     +  Y   +  +       F+     
Sbjct: 297 ATKDNIKNASTCVMDAHDLNIWNVHLQTWATEEDFNKLYQTKYRTLFAKADEFFKNAKNQ 356

Query: 322 --------PDLVIISSGFDAADGD-TIGQCH---VSPACYGHLTHMLKSLAR----GNMC 365
                     LV+IS+GFDA++ + T  Q H   V  + Y   T     LA+    G + 
Sbjct: 357 MQEMNKPFKGLVVISAGFDASEFEQTSMQRHSVNVPTSFYTTFTKDALKLAQLHCNGKVL 416

Query: 366 VVLEGGYNLDSIAKSALGVAKVLIG 390
            VLEGGY+  +IA    GV   LIG
Sbjct: 417 SVLEGGYSDKAIAS---GVFSHLIG 438

>Skud_16.164 Chr16 (301141..303234) [2094 bp, 697 aa] {ON} YPL116W
           (REAL)
          Length = 697

 Score = 63.9 bits (154), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 78/322 (24%), Positives = 133/322 (41%), Gaps = 73/322 (22%)

Query: 134 VEFLKTTNTMDREQLLKETEAGDS-----VYYNNDSLISARLSCGGAIEACKAVVEG--- 185
            E +K     D + L  E E  D+     +Y ++ ++ + + + G       ++ +G   
Sbjct: 120 AELIKLCQEADSKLLKGEIEVPDTWNSGDIYLSSKTIKALQGTIGAIETGVDSIFKGPSP 179

Query: 186 -RVKN-AMAVVRPPGHHAEPGVAGGFCLFSNVAVAAQNILKNYPESVRRVMILDWDIHHG 243
             + N A   +RPPGHH       GFCL +N  VA +     Y  +V  V++LD+D+HHG
Sbjct: 180 EHISNRAFVAIRPPGHHCHYATPSGFCLLNNAHVAIEYAHDAY--NVTHVVVLDFDLHHG 237

Query: 244 NGTQ------------------------KAFYGDNRVLYVSLHRYELGKYYPGTSYGNYD 279
           +GTQ                        K F    +V Y S+H  ++  +   + +   +
Sbjct: 238 DGTQDICWKRAGFKPEEEAKDTSYDDFGKKFAEFPKVGYFSMH--DINSFPTESGFATKE 295

Query: 280 QCGDGKG---EGFNCNI------PWSCSGVGDAEY------MWA-----FEQVVIPM--- 316
              +         + NI       W+     +  Y      ++A     F+   + M   
Sbjct: 296 NIKNASTCIMNSHDLNIWNVHLSKWTTEEEFNILYRTKYRTLFAKADEFFKSAKVEMKQQ 355

Query: 317 GREFQPDLVIISSGFDAADGD-TIGQCH-VSPACYGHLTHMLKSLA------RGNMCVVL 368
           G+ F+  LV+IS+GFDA++ + T  Q H V+   Y + T    +L        G +  ++
Sbjct: 356 GKSFE-GLVVISAGFDASEFEQTSMQRHSVNVPTYFYTTFTKDALKLAQMHCHGKVLSLM 414

Query: 369 EGGYNLDSIAKSALGVAKVLIG 390
           EGGY+  +I     GV   LIG
Sbjct: 415 EGGYSDKAICS---GVFAHLIG 433

>Kwal_26.8505 s26 complement(815901..818027) [2127 bp, 708 aa] {ON}
           YPL116W (HOS3) - sequence similar to the histone
           deacetylase Hda1p [contig 61] FULL
          Length = 708

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 64/257 (24%), Positives = 104/257 (40%), Gaps = 65/257 (25%)

Query: 190 AMAVVRPPGHHAEPGVAGGFCLFSNVAVAAQNILKNYPESVRRVMILDWDIHHGNGTQ-- 247
           A   +RPPGHH+      GFCL +N  +A +     Y  +V   ++LD+D+HHG+GTQ  
Sbjct: 187 AFVALRPPGHHSHASTPSGFCLLNNAHIAIEYAADTY--NVTHAVVLDFDLHHGDGTQDI 244

Query: 248 ----------------------KAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGK 285
                                 K F    +V Y S+H  ++  +     Y   +   +  
Sbjct: 245 CWKRAGFKPDECADSGEFDEFGKKFAEYPKVGYFSVH--DINSFPTELGYATKENIRNAA 302

Query: 286 G---EGFNCNIPWSC-----------SGVGDAEYMWAF----------EQVVIPMGREFQ 321
               +  + NI W+            + +   +Y   F          +Q +  +G+ F+
Sbjct: 303 TCIMDAHDVNI-WNVHLQPYDSEEAFTKLYQTKYRTLFAKADEFFRISKQTMKALGKPFK 361

Query: 322 PDLVIISSGFDAADGDTIGQ----CHVSPACYGHLTHMLKSLAR----GNMCVVLEGGYN 373
             LV+IS+GFDA++ +         +V    Y   T     LA+    G +  V+EGGY+
Sbjct: 362 -GLVVISAGFDASEYEQPSMQRHAVNVPTFFYNTFTKDALKLAQMHSHGKVLSVMEGGYS 420

Query: 374 LDSIAKSALGVAKVLIG 390
             +I     GV   LIG
Sbjct: 421 DGAITS---GVFAHLIG 434

>NDAI0E02480 Chr5 (512966..515020) [2055 bp, 684 aa] {ON} Anc_8.607
           YPL116W
          Length = 684

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 74/298 (24%), Positives = 124/298 (41%), Gaps = 70/298 (23%)

Query: 154 AGDSVYYNNDSLISARLSCGGAIEACKAVVEG----RVKN-AMAVVRPPGHHAEPGVAGG 208
           +GD +Y ++ ++ + + S G    A  ++ +G     + N A   +RPPGHH       G
Sbjct: 144 SGD-IYLSSKTVQALQGSIGALETAVDSIFKGPSPEHISNRAFVAIRPPGHHCHFATPSG 202

Query: 209 FCLFSNVAVAAQNILKNYPESVRRVMILDWDIHHGNGTQ------KAFYGDN-------- 254
           FC+ +N  VA +    +Y   V  V +LD+D+HHG+GTQ        F  D         
Sbjct: 203 FCVLNNAHVAIEYAADSY--DVTHVAVLDFDLHHGDGTQDICWKRAGFKPDEETKENEEY 260

Query: 255 -----------RVLYVSLHRYELGKYYPGTSYGNYDQCGDGKG---EGFNCNI------P 294
                      RV Y S+H  ++  +   + +   +   +         + NI       
Sbjct: 261 DGFGKKLAEFPRVGYFSMH--DINSFPTESGFATKENIKNASTCIMNSHDLNIWNIHLSS 318

Query: 295 WS----CSGVGDAEYMWAFEQV----------VIPMGREFQPDLVIISSGFDAADGD-TI 339
           WS     S +  ++Y   F +           +  MG+ F+  L+++S+GFDA++ +   
Sbjct: 319 WSNEEEFSKLYRSKYRLLFAKADEFFKTAKSEMADMGKPFK-GLILLSAGFDASEFEQKT 377

Query: 340 GQCH---VSPACYGHLTHMLKSLA----RGNMCVVLEGGYNLDSIAKSALGVAKVLIG 390
            Q H   V    Y   T     LA    +G +  ++EGGY+  +I     GV   LIG
Sbjct: 378 MQRHSVNVPTEFYTMFTKDALKLAQMHCQGKVLSLMEGGYSDKAITS---GVFAHLIG 432

>CAGL0J06974g Chr10 (667811..669847) [2037 bp, 678 aa] {ON} highly
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116w HOS3
          Length = 678

 Score = 62.8 bits (151), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 73/297 (24%), Positives = 122/297 (41%), Gaps = 69/297 (23%)

Query: 154 AGDSVYYNNDSLISARLSCGGAIEACKAVVEG----RVKNAMAV-VRPPGHHAEPGVAGG 208
           AGD +Y  + ++ + + + G       ++  G     + N + V +RPPGHH       G
Sbjct: 142 AGD-IYLTSRTIEALQGTIGAVETGVDSIFSGPSLEHISNRVFVAIRPPGHHCHYATPSG 200

Query: 209 FCLFSNVAVAAQNILKNYPESVRRVMILDWDIHHGNGTQ--------------------- 247
           FCL +N  +  +     Y   V   +ILD+D+HHG+GTQ                     
Sbjct: 201 FCLLNNAHIGIEYAADKY--GVTHAVILDFDLHHGDGTQDLCWKRAGFKPDEHTEEDGYD 258

Query: 248 ---KAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKG---EGFNCNI------PW 295
              K F    +V Y S+H  ++  +   + +   +   +         + NI       W
Sbjct: 259 EFGKKFAEFPKVGYFSMH--DINSFPTESGFATKENIKNASTCIMNSHDLNIWNVHLSRW 316

Query: 296 SC----SGVGDAEYMWAFEQV----------VIPMGREFQPDLVIISSGFDAADGD-TIG 340
           S     + +  ++Y   F +           +  +G+ F+  LV+IS+GFDA++ + T  
Sbjct: 317 STEEEFAKIYKSKYRTLFAKADEFFKNSKNEMNELGKPFK-GLVVISAGFDASEFEQTSM 375

Query: 341 QCH---VSPACYGHLTHMLKSLA----RGNMCVVLEGGYNLDSIAKSALGVAKVLIG 390
           Q H   V  + Y   T     LA    +G +  +LEGGY+  +I     GV   LIG
Sbjct: 376 QRHSVNVPTSFYTMFTKDALKLAQMHCQGKVLSLLEGGYSDKAITS---GVFSHLIG 429

>TPHA0M01590 Chr13 complement(332934..334418) [1485 bp, 494 aa] {ON}
           Anc_3.362 YPR068C
          Length = 494

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 71/276 (25%), Positives = 123/276 (44%), Gaps = 40/276 (14%)

Query: 199 HHAEPGVAGGFCLFSNVAVAAQNILKNYPESV---RRVMILDWDIHHGNGTQKAFYGDNR 255
           HHA    A GFC  +++ V+  N L+  P      R++  +D D+HHG+G + AF     
Sbjct: 206 HHAMKSRANGFCYINDI-VSLINELRKTPGQQGHKRKLTYIDLDLHHGDGVENAFNYSKD 264

Query: 256 VLYVSLHRYELGKYYPGTSYGNYDQCGDGKGEGFN-CNIPWSCSGVGDAEYMWAFEQVVI 314
           +  +S+H +E G +YP T    +     GK +  N  N+P    G+ ++        ++I
Sbjct: 265 IQIISIHLFEPG-FYPCTGGLKF-----GKPKSNNIINLPVK-HGLSNSNMFELVTNIII 317

Query: 315 PMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHLTHMLKSLAR----------GNM 364
           P+    Q D ++I  G D  + D   +  ++    G    ++K +A            N+
Sbjct: 318 PLIELHQSDDIVILCGGDGLNNDYYNEWQLT--IIGLTRCIIKIIAAFVGPHQPGSCKNV 375

Query: 365 CVVLEGGYN--LDSIAKSALGVAKV-LIGEPP-------DELPQPLKQPKPEAIVTIDMG 414
            ++  GGYN  L S   + L    + L G  P        E+P      K + ++  D  
Sbjct: 376 VLLGGGGYNELLASRFYTYLTYKVLQLAGRIPPAATTLAAEVPHGTIDDKDKELLIKDHE 435

Query: 415 LV----KEQSKYWNCFKGRHGNDGINW-REGAVNDS 445
            +    KE  KYW C++  +G DG+++ R+   ND+
Sbjct: 436 HIDEYEKEYYKYW-CYEIENGLDGLSFKRQINYNDT 470

>NCAS0C01760 Chr3 (324446..326548) [2103 bp, 700 aa] {ON} Anc_8.607
           YPL116W
          Length = 700

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 52/99 (52%), Gaps = 8/99 (8%)

Query: 154 AGDSVYYNNDSLISARLSCGGAIEACKAVVEG----RVKN-AMAVVRPPGHHAEPGVAGG 208
           AGD +Y ++ ++ + + + G       ++ +G     + N A   +RPPGHH       G
Sbjct: 144 AGD-IYLSSKTIQALQGTIGALETGVDSIFKGPSADHISNRAFVAIRPPGHHCHFATPSG 202

Query: 209 FCLFSNVAVAAQNILKNYPESVRRVMILDWDIHHGNGTQ 247
           FCL +N  VA +     Y   V  V +LD+D+HHG+GTQ
Sbjct: 203 FCLLNNAHVAIEYAADTY--GVTHVAVLDFDLHHGDGTQ 239

>Smik_16.223 Chr16 (406804..410484) [3681 bp, 1226 aa] {ON} YPL012W
           (REAL)
          Length = 1226

 Score = 38.5 bits (88), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 55/136 (40%), Gaps = 30/136 (22%)

Query: 293 IPWSCSGVGDAEYMWAFEQVVIPMGREF-QPDLVIISS---GFDAADGDTIGQCH----- 343
           +  S   V +     AF+  +I MGR+  +P+ +I  S   G+D A  D +         
Sbjct: 830 VILSTKDVNEKSRETAFD-TLINMGRKMNEPNSIIKLSQIPGYDPATPDQLSSISEFFKI 888

Query: 344 VSPACYGHLTHMLKSLARGNMCVVLEGGYNLDS--------------------IAKSALG 383
           +S    G   HM+ S   G  C+V E    +DS                    I KSA+G
Sbjct: 889 ISAGLIGESQHMVSSSITGYACLVFEFKNEIDSGILMDIYDTIELYLTSNSREIVKSAIG 948

Query: 384 VAKVLIGEPPDELPQP 399
             KV +   P+EL +P
Sbjct: 949 FTKVCVLGLPEELMRP 964

>YPL095C Chr16 complement(368071..369441) [1371 bp, 456 aa] {ON}
           EEB1Acyl-coenzymeA:ethanol O-acyltransferase responsible
           for the major part of medium-chain fatty acid ethyl
           ester biosynthesis during fermentation; possesses
           short-chain esterase activity; may be involved in lipid
           metabolism and detoxification
          Length = 456

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 45/90 (50%), Gaps = 11/90 (12%)

Query: 595 AYSGFV-HLLGHRDTRSVVKCAIAFADKKQLRPLVPLVDESL-----GDWYFKNSLVFTS 648
            Y+G V H+LG + T+S     +AF D K+  PL   V + +     G  +  NSL+FT 
Sbjct: 16  GYNGTVKHVLGEKGTKS-----LAFRDSKRQIPLHEFVTKHVPTLKDGANFRLNSLLFTG 70

Query: 649 TYHPCWGTDGNDSKKPRKKFGRVLRWTCDG 678
                + + G+ SKK +  +GR +    DG
Sbjct: 71  YLQTLYLSAGDFSKKFQVFYGREIIKFSDG 100

>Smik_16.142 Chr16 complement(251287..252657) [1371 bp, 456 aa] {ON}
           YPL095C (REAL)
          Length = 456

 Score = 32.3 bits (72), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 44/90 (48%), Gaps = 11/90 (12%)

Query: 595 AYSGFV-HLLGHRDTRSVVKCAIAFADKKQLRPLVPLVDESL-----GDWYFKNSLVFTS 648
            Y+G V H+LG + T+     A+AF D K   PL   V + +     G  +  NSL+FT 
Sbjct: 16  GYNGTVKHVLGEKGTK-----ALAFRDSKCQIPLHEFVTKHVPTLKDGANFRLNSLLFTG 70

Query: 649 TYHPCWGTDGNDSKKPRKKFGRVLRWTCDG 678
                + + G+ SKK +  +GR +    DG
Sbjct: 71  YLQTLYMSGGDFSKKFQVFYGREIVKFSDG 100

>Smik_6.260 Chr6 (417812..419335) [1524 bp, 507 aa] {ON} YGR155W
           (REAL)
          Length = 507

 Score = 32.0 bits (71), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 36/68 (52%), Gaps = 9/68 (13%)

Query: 83  RIYRIYKILAENG------LIEDPTLSGIDEIGELMQKIPVREATEEEILTVHSKEHVEF 136
           +I  + KIL +NG      L ED  LSG+  + EL++K+ +   T +   T+  K +++F
Sbjct: 385 KISDVIKILKDNGFDQLPVLTEDGKLSGLVTLSELLKKLSINNTTNDN--TIKGK-YLDF 441

Query: 137 LKTTNTMD 144
            K  N  D
Sbjct: 442 KKLNNFND 449

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.137    0.423 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 78,592,898
Number of extensions: 3549518
Number of successful extensions: 8489
Number of sequences better than 10.0: 113
Number of HSP's gapped: 8408
Number of HSP's successfully gapped: 121
Length of query: 705
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 588
Effective length of database: 40,065,477
Effective search space: 23558500476
Effective search space used: 23558500476
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)