Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ADL214C2.287ON36736719330.0
KLTH0G10384g2.287ON36736714080.0
Kwal_27.115282.287ON36736713990.0
SAKL0E07656g2.287ON36836813980.0
NCAS0B062502.287ON37335613870.0
Kpol_1003.392.287ON37034813770.0
KNAG0A054202.287ON37237113740.0
Suva_9.1052.287ON37137113730.0
YIL094C (LYS12)2.287ON37137113730.0
CAGL0G02585g2.287ON37237213730.0
Ecym_33262.287ON36635513660.0
Skud_9.792.287ON37137113610.0
NDAI0B035502.287ON37237213580.0
ZYRO0A01914g2.287ON36836813560.0
Smik_9.852.287ON37137113530.0
TDEL0G021802.287ON36936913530.0
KLLA0E08339g2.287ON36936813380.0
TPHA0C034102.287ON37134813330.0
TBLA0B059402.287ON36936913300.0
KAFR0J013602.287ON37337213110.0
Ecym_23135.473ON3703534795e-56
KLLA0E03125g5.473ON3683534787e-56
TPHA0D015602.278ON3603514724e-55
ADL223W2.278ON3623544707e-55
NCAS0H022505.473ON4223794741e-54
CAGL0I07227g5.473ON3683544656e-54
Suva_8.1885.473ON3693534631e-53
TPHA0J027705.473ON3763584613e-53
YNL037C (IDH1)2.278ON3603544593e-53
Smik_14.2902.278ON3603544593e-53
KAFR0B063705.473ON3783664586e-53
NDAI0C014105.473ON3693544577e-53
AFR137C5.473ON3673544561e-52
Skud_15.3005.473ON3693534551e-52
NCAS0B062902.278ON3593514541e-52
KNAG0B040705.473ON3733664552e-52
Smik_15.3165.473ON3693534542e-52
Kpol_440.125.473ON3683534542e-52
Skud_14.2932.278ON3613544533e-52
SAKL0G03520g5.473ON3693534517e-52
YOR136W (IDH2)5.473ON3693534509e-52
TBLA0B022405.473ON3733544501e-51
NDAI0B035902.278ON3593514481e-51
KLTH0F15048g5.473ON3683534463e-51
Kwal_23.50122.278ON3613544445e-51
Kpol_543.85.473ON3683634421e-50
SAKL0E07876g2.278ON3613704402e-50
Ecym_33162.278ON3623544393e-50
TDEL0A033705.473ON3713584378e-50
Kwal_55.212735.473ON3683594361e-49
KLLA0F04103g2.278ON3613504332e-49
Kpol_1039.352.278ON3593524314e-49
TDEL0C038402.278ON3613514314e-49
KLTH0G10186g2.278ON3603544298e-49
KNAG0A052802.278ON3613534262e-48
KAFR0J014102.278ON3503554243e-48
CAGL0G02673g2.278ON3583524229e-48
ZYRO0D02838g2.278ON3613804193e-47
TBLA0B069102.278ON3653504151e-46
TPHA0E014805.473ON3773424123e-46
ZYRO0D11220g5.473ON3683534106e-46
KLLA0D04906g1.402ON3623653895e-43
Suva_14.3022.278ON3002933822e-42
Ecym_12961.402ON3633693852e-42
TBLA0C015001.402ON3653723792e-41
TDEL0B060001.402ON3623653782e-41
Smik_3.661.402ON3643643722e-40
Kwal_0.2251.402ON3643653695e-40
KLTH0H12188g1.402ON3643643687e-40
YCL018W (LEU2)1.402ON3643643687e-40
CAGL0H03795g1.402ON3653683679e-40
Skud_3.431.402ON3643643661e-39
NDAI0G042301.402ON3633673652e-39
KNAG0I012801.402ON4473763692e-39
KAFR0I022001.402ON3653673625e-39
AAL012C1.402ON3723643531e-37
Kpol_1048.631.402ON3643683521e-37
Suva_3.31.402ON3643693512e-37
ZYRO0E04796g1.402ON3623653503e-37
SAKL0D08690g1.402ON3643683494e-37
NCAS0C048701.402ON3653713494e-37
TPHA0B037301.402ON3653683302e-34
YDL066W (IDP1)4.254ON4281711452e-09
AER061C4.254ON4251331442e-09
Skud_4.1894.254ON4291441434e-09
NCAS0A087201.396ON4131301425e-09
KLTH0D14476g4.254ON4201261416e-09
Kwal_23.42104.254ON4222181409e-09
Smik_4.1694.254ON4281441391e-08
KAFR0H031601.396ON4211261381e-08
Kwal_0.1911.396ON4111261382e-08
Kpol_1055.784.254ON4272181382e-08
ZYRO0E05016g1.396ON4111411372e-08
CAGL0D00770g4.254ON4231261363e-08
TDEL0E011604.254ON4231261363e-08
SAKL0H02860g4.254ON4211331363e-08
KLTH0H12012g1.396ON4131261363e-08
AAL022W1.396ON4151261354e-08
KNAG0D044104.254ON4281261345e-08
KAFR0I021301.396ON4081301336e-08
TBLA0C012901.396ON4181241328e-08
Suva_4.1844.254ON4292361328e-08
KNAG0H016701.396ON4241301329e-08
Ecym_13061.396ON4151261311e-07
NDAI0D043604.254ON4241441311e-07
KNAG0I013201.396ON4121331301e-07
CAGL0H03663g1.396ON4181261301e-07
KLLA0B03355g4.254ON4291261302e-07
TDEL0B061001.396ON4141261292e-07
KLLA0F12342g1.396ON4151261292e-07
KAFR0G032604.254ON4212251283e-07
CAGL0B04917g1.396ON4112211283e-07
NCAS0G036201.396ON4181331283e-07
Skud_14.3181.396ON4201331283e-07
Smik_12.2351.396ON4121301274e-07
NCAS0A025104.254ON4261261264e-07
TPHA0B036601.396ON4221271265e-07
Kpol_1048.701.396ON4191261256e-07
Skud_12.2391.396ON4121301247e-07
SAKL0D08426g1.396ON4111411248e-07
ZYRO0B12496g4.254ON4222141248e-07
TPHA0B022104.254ON4331261249e-07
YLR174W (IDP2)1.396ON4121301231e-06
Ecym_32654.254ON4241091221e-06
NDAI0G051601.396ON4201301222e-06
Suva_14.3391.396ON4171261222e-06
Suva_10.2711.396ON4121261212e-06
Smik_14.3191.396ON4181311176e-06
TBLA0A080104.254ON428891176e-06
YNL009W (IDP3)1.396ON4201261168e-06
NDAI0G008501.396ON4191261095e-05
Suva_14.303singletonON5350770.031
KAFR0D002101.12ON32198731.2
CAGL0H06809g1.283ON14748701.3
Suva_16.4833.502ON613138703.8
ZYRO0F15202g2.23ON435104694.3
NCAS0A138807.309ON79860694.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADL214C
         (367 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADL214C Chr4 complement(328094..329197) [1104 bp, 367 aa] {ON} S...   749   0.0  
KLTH0G10384g Chr7 complement(878375..879478) [1104 bp, 367 aa] {...   546   0.0  
Kwal_27.11528 s27 (836437..837540) [1104 bp, 367 aa] {ON} YIL094...   543   0.0  
SAKL0E07656g Chr5 (620028..621134) [1107 bp, 368 aa] {ON} highly...   543   0.0  
NCAS0B06250 Chr2 (1179360..1180481) [1122 bp, 373 aa] {ON} Anc_2...   538   0.0  
Kpol_1003.39 s1003 complement(96083..97195) [1113 bp, 370 aa] {O...   535   0.0  
KNAG0A05420 Chr1 (799521..800639) [1119 bp, 372 aa] {ON}              533   0.0  
Suva_9.105 Chr9 complement(180626..181741) [1116 bp, 371 aa] {ON...   533   0.0  
YIL094C Chr9 complement(186517..187632) [1116 bp, 371 aa] {ON}  ...   533   0.0  
CAGL0G02585g Chr7 (238931..240049) [1119 bp, 372 aa] {ON} highly...   533   0.0  
Ecym_3326 Chr3 complement(624805..625905) [1101 bp, 366 aa] {ON}...   530   0.0  
Skud_9.79 Chr9 complement(163173..164288) [1116 bp, 371 aa] {ON}...   528   0.0  
NDAI0B03550 Chr2 (891508..892626) [1119 bp, 372 aa] {ON} Anc_2.2...   527   0.0  
ZYRO0A01914g Chr1 complement(158403..159509) [1107 bp, 368 aa] {...   526   0.0  
Smik_9.85 Chr9 complement(165648..166763) [1116 bp, 371 aa] {ON}...   525   0.0  
TDEL0G02180 Chr7 complement(428789..429898) [1110 bp, 369 aa] {O...   525   0.0  
KLLA0E08339g Chr5 (750670..751779) [1110 bp, 369 aa] {ON} highly...   520   0.0  
TPHA0C03410 Chr3 complement(748639..749754) [1116 bp, 371 aa] {O...   518   0.0  
TBLA0B05940 Chr2 complement(1402869..1403978) [1110 bp, 369 aa] ...   516   0.0  
KAFR0J01360 Chr10 (249197..250318) [1122 bp, 373 aa] {ON} Anc_2....   509   0.0  
Ecym_2313 Chr2 complement(610493..611605) [1113 bp, 370 aa] {ON}...   189   5e-56
KLLA0E03125g Chr5 (288825..289931) [1107 bp, 368 aa] {ON} highly...   188   7e-56
TPHA0D01560 Chr4 complement(321751..322833) [1083 bp, 360 aa] {O...   186   4e-55
ADL223W Chr4 (312893..313981) [1089 bp, 362 aa] {ON} Syntenic ho...   185   7e-55
NCAS0H02250 Chr8 (441692..442960) [1269 bp, 422 aa] {ON} Anc_5.473    187   1e-54
CAGL0I07227g Chr9 complement(696605..697711) [1107 bp, 368 aa] {...   183   6e-54
Suva_8.188 Chr8 (335409..336518) [1110 bp, 369 aa] {ON} YOR136W ...   182   1e-53
TPHA0J02770 Chr10 (617727..618857) [1131 bp, 376 aa] {ON} Anc_2....   182   3e-53
YNL037C Chr14 complement(557920..559002) [1083 bp, 360 aa] {ON} ...   181   3e-53
Smik_14.290 Chr14 (528131..529213) [1083 bp, 360 aa] {ON} YNL037...   181   3e-53
KAFR0B06370 Chr2 complement(1317952..1319088) [1137 bp, 378 aa] ...   181   6e-53
NDAI0C01410 Chr3 complement(295178..296287) [1110 bp, 369 aa] {O...   180   7e-53
AFR137C Chr6 complement(685586..686689) [1104 bp, 367 aa] {ON} S...   180   1e-52
Skud_15.300 Chr15 (534346..535455) [1110 bp, 369 aa] {ON} YOR136...   179   1e-52
NCAS0B06290 Chr2 complement(1186838..1187917) [1080 bp, 359 aa] ...   179   1e-52
KNAG0B04070 Chr2 complement(778658..779779) [1122 bp, 373 aa] {O...   179   2e-52
Smik_15.316 Chr15 (541618..542727) [1110 bp, 369 aa] {ON} YOR136...   179   2e-52
Kpol_440.12 s440 (32084..33190) [1107 bp, 368 aa] {ON} (32084..3...   179   2e-52
Skud_14.293 Chr14 (538202..539287) [1086 bp, 361 aa] {ON} YNL037...   179   3e-52
SAKL0G03520g Chr7 (290768..291877) [1110 bp, 369 aa] {ON} highly...   178   7e-52
YOR136W Chr15 (580250..581359) [1110 bp, 369 aa] {ON}  IDH2Subun...   177   9e-52
TBLA0B02240 Chr2 complement(524111..525232) [1122 bp, 373 aa] {O...   177   1e-51
NDAI0B03590 Chr2 complement(901108..902187) [1080 bp, 359 aa] {O...   177   1e-51
KLTH0F15048g Chr6 complement(1232566..1233672) [1107 bp, 368 aa]...   176   3e-51
Kwal_23.5012 s23 (964254..965339) [1086 bp, 361 aa] {ON} YNL037C...   175   5e-51
Kpol_543.8 s543 (21411..22517) [1107 bp, 368 aa] {ON} (21411..22...   174   1e-50
SAKL0E07876g Chr5 complement(635705..636790) [1086 bp, 361 aa] {...   174   2e-50
Ecym_3316 Chr3 (608744..609832) [1089 bp, 362 aa] {ON} similar t...   173   3e-50
TDEL0A03370 Chr1 (599855..600970) [1116 bp, 371 aa] {ON} Anc_5.4...   172   8e-50
Kwal_55.21273 s55 complement(762121..763227) [1107 bp, 368 aa] {...   172   1e-49
KLLA0F04103g Chr6 (389159..390244) [1086 bp, 361 aa] {ON} unipro...   171   2e-49
Kpol_1039.35 s1039 complement(108102..109181) [1080 bp, 359 aa] ...   170   4e-49
TDEL0C03840 Chr3 complement(673007..674092) [1086 bp, 361 aa] {O...   170   4e-49
KLTH0G10186g Chr7 (863151..864233) [1083 bp, 360 aa] {ON} highly...   169   8e-49
KNAG0A05280 Chr1 (780448..781533) [1086 bp, 361 aa] {ON}              168   2e-48
KAFR0J01410 Chr10 complement(256693..257745) [1053 bp, 350 aa] {...   167   3e-48
CAGL0G02673g Chr7 complement(246455..247531) [1077 bp, 358 aa] {...   167   9e-48
ZYRO0D02838g Chr4 (223132..224217) [1086 bp, 361 aa] {ON} simila...   166   3e-47
TBLA0B06910 Chr2 (1634845..1635942) [1098 bp, 365 aa] {ON}            164   1e-46
TPHA0E01480 Chr5 complement(300222..301355) [1134 bp, 377 aa] {O...   163   3e-46
ZYRO0D11220g Chr4 (946652..947758) [1107 bp, 368 aa] {ON} highly...   162   6e-46
KLLA0D04906g Chr4 (420903..421991) [1089 bp, 362 aa] {ON} highly...   154   5e-43
Suva_14.302 Chr14 (546468..547370) [903 bp, 300 aa] {ON} YNL037C...   151   2e-42
Ecym_1296 Chr1 (602530..603621) [1092 bp, 363 aa] {ON} similar t...   152   2e-42
TBLA0C01500 Chr3 complement(347212..348309) [1098 bp, 365 aa] {O...   150   2e-41
TDEL0B06000 Chr2 (1060828..1061916) [1089 bp, 362 aa] {ON} Anc_1...   150   2e-41
Smik_3.66 Chr3 (89718..90812) [1095 bp, 364 aa] {ON} YCL018W (REAL)   147   2e-40
Kwal_0.225 s0 (111017..112111) [1095 bp, 364 aa] {ON} YCL018W (L...   146   5e-40
KLTH0H12188g Chr8 (1039347..1040441) [1095 bp, 364 aa] {ON} high...   146   7e-40
YCL018W Chr3 (91324..92418) [1095 bp, 364 aa] {ON}  LEU2Beta-iso...   146   7e-40
CAGL0H03795g Chr8 (356535..357632) [1098 bp, 365 aa] {ON}             145   9e-40
Skud_3.43 Chr3 (70293..71387) [1095 bp, 364 aa] {ON} YCL018W (REAL)   145   1e-39
NDAI0G04230 Chr7 complement(1015689..1016780) [1092 bp, 363 aa] ...   145   2e-39
KNAG0I01280 Chr9 complement(245603..246946) [1344 bp, 447 aa] {O...   146   2e-39
KAFR0I02200 Chr9 (449737..450834) [1098 bp, 365 aa] {ON} Anc_1.4...   144   5e-39
AAL012C Chr1 complement(320148..321266) [1119 bp, 372 aa] {ON} S...   140   1e-37
Kpol_1048.63 s1048 (182096..183190) [1095 bp, 364 aa] {ON} (1820...   140   1e-37
Suva_3.3 Chr3 (1464..2558) [1095 bp, 364 aa] {ON} YCL018W (REAL)      139   2e-37
ZYRO0E04796g Chr5 (362881..363969) [1089 bp, 362 aa] {ON} unipro...   139   3e-37
SAKL0D08690g Chr4 complement(723302..724396) [1095 bp, 364 aa] {...   139   4e-37
NCAS0C04870 Chr3 complement(993177..994274) [1098 bp, 365 aa] {O...   139   4e-37
TPHA0B03730 Chr2 complement(878199..879296) [1098 bp, 365 aa] {O...   131   2e-34
YDL066W Chr4 (334835..336121) [1287 bp, 428 aa] {ON}  IDP1Mitoch...    60   2e-09
AER061C Chr5 complement(749709..750986) [1278 bp, 425 aa] {ON} S...    60   2e-09
Skud_4.189 Chr4 (330300..331589) [1290 bp, 429 aa] {ON} YDL066W ...    60   4e-09
NCAS0A08720 Chr1 complement(1722511..1723752) [1242 bp, 413 aa] ...    59   5e-09
KLTH0D14476g Chr4 complement(1184813..1186075) [1263 bp, 420 aa]...    59   6e-09
Kwal_23.4210 s23 (619516..620784) [1269 bp, 422 aa] {ON} YDL066W...    59   9e-09
Smik_4.169 Chr4 (311244..312530) [1287 bp, 428 aa] {ON} YDL066W ...    58   1e-08
KAFR0H03160 Chr8 complement(602807..604072) [1266 bp, 421 aa] {O...    58   1e-08
Kwal_0.191 s0 (98033..99268) [1236 bp, 411 aa] {ON} YLR174W (IDP...    58   2e-08
Kpol_1055.78 s1055 (207889..209172) [1284 bp, 427 aa] {ON} (2078...    58   2e-08
ZYRO0E05016g Chr5 complement(379654..380889) [1236 bp, 411 aa] {...    57   2e-08
CAGL0D00770g Chr4 (95715..96986) [1272 bp, 423 aa] {ON} highly s...    57   3e-08
TDEL0E01160 Chr5 (234217..235488) [1272 bp, 423 aa] {ON} Anc_4.2...    57   3e-08
SAKL0H02860g Chr8 (280944..282209) [1266 bp, 421 aa] {ON} highly...    57   3e-08
KLTH0H12012g Chr8 (1026586..1027827) [1242 bp, 413 aa] {ON} high...    57   3e-08
AAL022W Chr1 (302946..304193) [1248 bp, 415 aa] {ON} Syntenic ho...    57   4e-08
KNAG0D04410 Chr4 complement(799414..800700) [1287 bp, 428 aa] {O...    56   5e-08
KAFR0I02130 Chr9 (438428..439654) [1227 bp, 408 aa] {ON} Anc_1.3...    56   6e-08
TBLA0C01290 Chr3 complement(283624..284880) [1257 bp, 418 aa] {O...    55   8e-08
Suva_4.184 Chr4 (324382..325671) [1290 bp, 429 aa] {ON} YDL066W ...    55   8e-08
KNAG0H01670 Chr8 (298481..299755) [1275 bp, 424 aa] {ON} Anc_1.3...    55   9e-08
Ecym_1306 Chr1 complement(619565..620812) [1248 bp, 415 aa] {ON}...    55   1e-07
NDAI0D04360 Chr4 (1024297..1025571) [1275 bp, 424 aa] {ON} Anc_4...    55   1e-07
KNAG0I01320 Chr9 complement(255478..256716) [1239 bp, 412 aa] {O...    55   1e-07
CAGL0H03663g Chr8 (337533..338789) [1257 bp, 418 aa] {ON} highly...    55   1e-07
KLLA0B03355g Chr2 (303444..304733) [1290 bp, 429 aa] {ON} highly...    55   2e-07
TDEL0B06100 Chr2 complement(1076365..1077609) [1245 bp, 414 aa] ...    54   2e-07
KLLA0F12342g Chr6 (1137608..1138855) [1248 bp, 415 aa] {ON} high...    54   2e-07
KAFR0G03260 Chr7 complement(675642..676907) [1266 bp, 421 aa] {O...    54   3e-07
CAGL0B04917g Chr2 complement(477939..479174) [1236 bp, 411 aa] {...    54   3e-07
NCAS0G03620 Chr7 complement(675224..676480) [1257 bp, 418 aa] {O...    54   3e-07
Skud_14.318 Chr14 (581597..582859) [1263 bp, 420 aa] {ON} YNL009...    54   3e-07
Smik_12.235 Chr12 (451719..452957) [1239 bp, 412 aa] {ON} YLR174...    54   4e-07
NCAS0A02510 Chr1 complement(476363..477643) [1281 bp, 426 aa] {O...    53   4e-07
TPHA0B03660 Chr2 (863280..864548) [1269 bp, 422 aa] {ON} Anc_1.3...    53   5e-07
Kpol_1048.70 s1048 complement(198298..199557) [1260 bp, 419 aa] ...    53   6e-07
Skud_12.239 Chr12 (451342..452580) [1239 bp, 412 aa] {ON} YLR174...    52   7e-07
SAKL0D08426g Chr4 (705189..706424) [1236 bp, 411 aa] {ON} highly...    52   8e-07
ZYRO0B12496g Chr2 complement(1007086..1008354) [1269 bp, 422 aa]...    52   8e-07
TPHA0B02210 Chr2 (509945..511246) [1302 bp, 433 aa] {ON} Anc_4.2...    52   9e-07
YLR174W Chr12 (504591..505829) [1239 bp, 412 aa] {ON}  IDP2Cytos...    52   1e-06
Ecym_3265 Chr3 (504267..505541) [1275 bp, 424 aa] {ON} similar t...    52   1e-06
NDAI0G05160 Chr7 complement(1250883..1252145) [1263 bp, 420 aa] ...    52   2e-06
Suva_14.339 Chr14 (594794..596047) [1254 bp, 417 aa] {ON} YNL009...    52   2e-06
Suva_10.271 Chr10 (476726..477964) [1239 bp, 412 aa] {ON} YLR174...    51   2e-06
Smik_14.319 Chr14 (573167..574423) [1257 bp, 418 aa] {ON} YLR174...    50   6e-06
TBLA0A08010 Chr1 (1981576..1982862) [1287 bp, 428 aa] {ON} Anc_4...    50   6e-06
YNL009W Chr14 (614821..616083) [1263 bp, 420 aa] {ON}  IDP3Perox...    49   8e-06
NDAI0G00850 Chr7 (179074..180333) [1260 bp, 419 aa] {ON} Anc_1.396     47   5e-05
Suva_14.303 Chr14 (547367..547525) [159 bp, 53 aa] {ON} YNL037C ...    34   0.031
KAFR0D00210 Chr4 (24617..25582) [966 bp, 321 aa] {ON} Anc_1.12 Y...    33   1.2  
CAGL0H06809g Chr8 complement(678341..678784) [444 bp, 147 aa] {O...    32   1.3  
Suva_16.483 Chr16 complement(831888..833729) [1842 bp, 613 aa] {...    32   3.8  
ZYRO0F15202g Chr6 complement(1243693..1245000) [1308 bp, 435 aa]...    31   4.3  
NCAS0A13880 Chr1 complement(2723605..2726001) [2397 bp, 798 aa] ...    31   4.7  

>ADL214C Chr4 complement(328094..329197) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL094C
           (LYS12)
          Length = 367

 Score =  749 bits (1933), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/367 (100%), Positives = 367/367 (100%)

Query: 1   MHRSSATSLIHKATYATSKTLTIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLD 60
           MHRSSATSLIHKATYATSKTLTIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLD
Sbjct: 1   MHRSSATSLIHKATYATSKTLTIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLD 60

Query: 61  AGWQTFLETGNALPGATVEALRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANI 120
           AGWQTFLETGNALPGATVEALRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANI
Sbjct: 61  AGWQTFLETGNALPGATVEALRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANI 120

Query: 121 RPVKSVSGTGQPVDLVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEI 180
           RPVKSVSGTGQPVDLVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEI
Sbjct: 121 RPVKSVSGTGQPVDLVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEI 180

Query: 181 SLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDS 240
           SLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDS
Sbjct: 181 SLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDS 240

Query: 241 MVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNVGNNIIIGEPCHGSAPD 300
           MVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNVGNNIIIGEPCHGSAPD
Sbjct: 241 MVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNVGNNIIIGEPCHGSAPD 300

Query: 301 IAGRGIANPIATIRSVSLMLQFLGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNTTQEVL 360
           IAGRGIANPIATIRSVSLMLQFLGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNTTQEVL
Sbjct: 301 IAGRGIANPIATIRSVSLMLQFLGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNTTQEVL 360

Query: 361 DDILARI 367
           DDILARI
Sbjct: 361 DDILARI 367

>KLTH0G10384g Chr7 complement(878375..879478) [1104 bp, 367 aa] {ON}
           highly similar to uniprot|P40495 Saccharomyces
           cerevisiae YIL094C LYS12 Homo-isocitrate dehydrogenase
           an NAD-linked mitochondrial enzyme required for the
           fourth step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 367

 Score =  546 bits (1408), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 252/367 (68%), Positives = 312/367 (85%)

Query: 1   MHRSSATSLIHKATYATSKTLTIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLD 60
           M R+S T L  ++  + SK+LTIGLIPGDGIGKEVIPAG++VLE +  KH ++F +  L 
Sbjct: 1   MLRASFTQLARRSYASASKSLTIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDFIDLQ 60

Query: 61  AGWQTFLETGNALPGATVEALRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANI 120
           AGWQTF ETG ALP  T++ LR +CQGALFGAVQSPT KVEGYSSPIVALR++LGLYAN+
Sbjct: 61  AGWQTFQETGKALPDETIDILRNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANV 120

Query: 121 RPVKSVSGTGQPVDLVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEI 180
           RPVKSV    +PVD++IVRENTEDLY++ E+TY+D  TG RVAEAIKRISE AT+ IA I
Sbjct: 121 RPVKSVLPQERPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNIANI 180

Query: 181 SLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDS 240
           +L +ALQRQ++ G   LTVTHKSNVLSQ+DGLF+EVCR+VYE+NK  +GSI+YNEQIVDS
Sbjct: 181 ALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQIVDS 240

Query: 241 MVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNVGNNIIIGEPCHGSAPD 300
           MVYR+F+EP CFDV+VAPNLYGD+LSDGAAALVGSLG+VPS NVG + ++GEPCHGSAPD
Sbjct: 241 MVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCHGSAPD 300

Query: 301 IAGRGIANPIATIRSVSLMLQFLGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNTTQEVL 360
           IAG+GI+NP+ATIRS +LML+F+G  EAA DI +AV  NL+D  + +PDLGGK+TTQ+V+
Sbjct: 301 IAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNSIKTPDLGGKSTTQQVV 360

Query: 361 DDILARI 367
           +D+L+R+
Sbjct: 361 EDVLSRM 367

>Kwal_27.11528 s27 (836437..837540) [1104 bp, 367 aa] {ON} YIL094C
           (LYS12) - Homo-isocitrate dehydrogenase [contig 27] FULL
          Length = 367

 Score =  543 bits (1399), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/367 (67%), Positives = 310/367 (84%)

Query: 1   MHRSSATSLIHKATYATSKTLTIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLD 60
           M R+S   L  ++  + +K+LTIGLIPGDGIG+EVIPAG+ VLE +  KH ++F++  L+
Sbjct: 1   MLRTSFNQLARRSYTSATKSLTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFIDLE 60

Query: 61  AGWQTFLETGNALPGATVEALRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANI 120
           AGWQTFL+TG ALP  T++ L+  CQGALFGAVQSPT KVEGYSSPIVALR++LGLYAN+
Sbjct: 61  AGWQTFLDTGKALPDETIDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANV 120

Query: 121 RPVKSVSGTGQPVDLVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEI 180
           RPVKSV    +P+D+VIVRENTEDLY++ E+TY+D  TG RVAEAIKRISE AT  IA I
Sbjct: 121 RPVKSVLSQEKPIDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIANI 180

Query: 181 SLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDS 240
           +L +ALQRQ++ G   LTVTHKSNVLSQ+DGLF+E+CR+VYE+N+  +GSI YNEQIVDS
Sbjct: 181 ALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVDS 240

Query: 241 MVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNVGNNIIIGEPCHGSAPD 300
           MVYRLF+EP CFDV+VAPNLYGD+LSDGAAALVGSLG+VPS NVG + ++GEPCHGSAPD
Sbjct: 241 MVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCHGSAPD 300

Query: 301 IAGRGIANPIATIRSVSLMLQFLGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNTTQEVL 360
           IAG+GI+NP+ATIRS +LML+F+G  EAA DI +AV  NL+D  V +PDLGGK+TTQ+V+
Sbjct: 301 IAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNTVKTPDLGGKSTTQQVV 360

Query: 361 DDILARI 367
           DD+L+R+
Sbjct: 361 DDVLSRM 367

>SAKL0E07656g Chr5 (620028..621134) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094C LYS12 Homo-isocitrate dehydrogenase an
           NAD-linked mitochondrial enzyme required for the fourth
           step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 368

 Score =  543 bits (1398), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 251/368 (68%), Positives = 313/368 (85%), Gaps = 1/368 (0%)

Query: 1   MHRSSATSLIHKATYATSKTLTIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLD 60
           M RS+ +    ++  + +K LTIGLIPGDGIGKEVIPAG+ VLE +  KH+++F++  L 
Sbjct: 1   MLRSTVSQFARRSYASAAKPLTIGLIPGDGIGKEVIPAGKLVLENLSSKHNLKFNFIDLQ 60

Query: 61  AGWQTFLETGNALPGATVEALRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANI 120
           AGWQTFL+TG ALP  T+E L+  CQGALFGAVQSPT KVEGYSSPIVALR++LGLYAN+
Sbjct: 61  AGWQTFLDTGKALPDETIEILKSDCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANV 120

Query: 121 RPVKSVSGTG-QPVDLVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAE 179
           RPVKSV GT  +PVD++IVRENTEDLY++ E+TY+D  TG RVAEAIKRISE AT  IA+
Sbjct: 121 RPVKSVQGTNDRPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTDIAK 180

Query: 180 ISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVD 239
           I+L ++LQR +  G+  LTVTHKSNVLSQ+DGLF+EVC+ VYE+NK+ YG+I YNEQIVD
Sbjct: 181 IALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQIVD 240

Query: 240 SMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNVGNNIIIGEPCHGSAP 299
           SMVYRLF+EP CFDV+VAPNLYGD+LSDGAAALVGSLG+VPS NVG++ I+GEPCHGSAP
Sbjct: 241 SMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHDFIVGEPCHGSAP 300

Query: 300 DIAGRGIANPIATIRSVSLMLQFLGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNTTQEV 359
           DIAG+GI+NPIATIRS +LML+F+G  EAA DI +AV  N+++ Q+ +PDLGGK+TTQ+V
Sbjct: 301 DIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVDTNIRENQIKTPDLGGKSTTQQV 360

Query: 360 LDDILARI 367
           +DDIL+++
Sbjct: 361 VDDILSKM 368

>NCAS0B06250 Chr2 (1179360..1180481) [1122 bp, 373 aa] {ON}
           Anc_2.287
          Length = 373

 Score =  538 bits (1387), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 252/356 (70%), Positives = 307/356 (86%), Gaps = 1/356 (0%)

Query: 13  ATYATSKTLTIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLDAGWQTFLETGNA 72
           AT A  K LTIGLIPGDGIGKEVIPAG++VLE +  KH ++F +  L AG+QTFL+TG A
Sbjct: 18  ATNALRKNLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKFDFIDLQAGFQTFLDTGKA 77

Query: 73  LPGATVEALRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANIRPVKSVSGT-GQ 131
           LP  TV+ L+ +CQGALFGAVQSPTTKVEGYSSPIVALR+++GL+AN+RPVKSVSGT  +
Sbjct: 78  LPDETVQVLKSQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLFANVRPVKSVSGTKDR 137

Query: 132 PVDLVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLALQRQRM 191
           PVD+VIVRENTEDLY++ E+TY+D ATG RVAEA KRISE AT RIA I+L +ALQR ++
Sbjct: 138 PVDMVIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATRRIATIALDIALQRLKV 197

Query: 192 GGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLFKEPHC 251
            G+  LTVTHKSNVLSQ+DGLF+E+C++VYE+NK  YGSI YNEQIVDSMVYR+F+EP C
Sbjct: 198 NGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITYNEQIVDSMVYRMFREPQC 257

Query: 252 FDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNVGNNIIIGEPCHGSAPDIAGRGIANPIA 311
           FDV+VAPNLYGD+LSDGAAALVGSLG+VPS NVG  I+IGEPCHGSAPDIAG+GIANPIA
Sbjct: 258 FDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSAPDIAGKGIANPIA 317

Query: 312 TIRSVSLMLQFLGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNTTQEVLDDILARI 367
           TIRS +LML+FLG  +AA DI +AV  N+++ ++ +PDLGG +TTQ+V +D+LAR+
Sbjct: 318 TIRSTALMLEFLGHNDAAQDIHRAVEANMRENKIKTPDLGGNSTTQQVTEDVLARL 373

>Kpol_1003.39 s1003 complement(96083..97195) [1113 bp, 370 aa] {ON}
           complement(96083..97195) [1113 nt, 371 aa]
          Length = 370

 Score =  535 bits (1377), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 254/348 (72%), Positives = 301/348 (86%), Gaps = 1/348 (0%)

Query: 21  LTIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLDAGWQTFLETGNALPGATVEA 80
           LTIGLIPGDGIGKEVIPAG++VLE IG K+ I F +  L AGWQTFL+TG ALP  TV  
Sbjct: 23  LTIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFKFIDLHAGWQTFLDTGKALPDETVSI 82

Query: 81  LRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANIRPVKSVSGTG-QPVDLVIVR 139
           L+++CQGALFGAVQSPTTKVEGYSSPIVALR+QLGLYANIRPVKSVSGT  +PVD+VIVR
Sbjct: 83  LKQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLGLYANIRPVKSVSGTNDRPVDMVIVR 142

Query: 140 ENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLALQRQRMGGRGALTV 199
           ENTEDLY+++ERTY+D ATG +VAEA KRISE AT +IA+I+L +ALQR +  G+  LTV
Sbjct: 143 ENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRKIAKIALDIALQRLKNTGKATLTV 202

Query: 200 THKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLFKEPHCFDVVVAPN 259
           THKSNVLSQ+DGLF+EVCR+VYE NK  YG++ YNEQIVDSMVYR+F+EP CFDVVVAPN
Sbjct: 203 THKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQIVDSMVYRIFREPECFDVVVAPN 262

Query: 260 LYGDLLSDGAAALVGSLGLVPSVNVGNNIIIGEPCHGSAPDIAGRGIANPIATIRSVSLM 319
           LYGD+LSDGAAALVGSLG+VPS NVG +IIIGEPCHGSAPDI+G+GI+NP+ATIRS +LM
Sbjct: 263 LYGDILSDGAAALVGSLGVVPSANVGPDIIIGEPCHGSAPDISGQGISNPVATIRSAALM 322

Query: 320 LQFLGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNTTQEVLDDILARI 367
           LQFLG  EAA DI  AV  N++  ++ +PDLGG ++T EV DDIL+++
Sbjct: 323 LQFLGYNEAAKDIQNAVDENIRSGKIKTPDLGGDSSTTEVTDDILSKL 370

>KNAG0A05420 Chr1 (799521..800639) [1119 bp, 372 aa] {ON} 
          Length = 372

 Score =  533 bits (1374), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/371 (70%), Positives = 307/371 (82%), Gaps = 4/371 (1%)

Query: 1   MHRSSATSLIHK---ATYATSKTLTIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYE 57
           M RS+A  L      AT A  K+LTIGLIPGDGIGKEVIPAG++VL+++  KH + F + 
Sbjct: 2   MLRSAANKLAGCRGLATNAARKSLTIGLIPGDGIGKEVIPAGKQVLQSLNPKHGLNFDFI 61

Query: 58  HLDAGWQTFLETGNALPGATVEALRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLY 117
            L AG+QTF +TG ALP  TV+ L+E+CQGALFGAVQSPTTKVEGYSSPIVALR+ +GLY
Sbjct: 62  DLQAGFQTFQDTGKALPDETVQILKEKCQGALFGAVQSPTTKVEGYSSPIVALRKAMGLY 121

Query: 118 ANIRPVKSVSGTGQ-PVDLVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATER 176
           ANIRPVKSV G+ + PVD++IVRENTEDLY++ E+TY+D ATG RVAEA KRISE AT+R
Sbjct: 122 ANIRPVKSVEGSNERPVDMIIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATQR 181

Query: 177 IAEISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQ 236
           IA I+L +ALQR +  G+  LTVTHKSNVLSQ+DGLF+EVCRE+YEANK  Y  I YNEQ
Sbjct: 182 IATIALDIALQRLQNNGKATLTVTHKSNVLSQSDGLFREVCREMYEANKDKYAGITYNEQ 241

Query: 237 IVDSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNVGNNIIIGEPCHG 296
           IVDSMVYR+F+EP CFDV+VAPNLYGD+LSDGAAALVGSLG+VPS NVG  I+IGEPCHG
Sbjct: 242 IVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG 301

Query: 297 SAPDIAGRGIANPIATIRSVSLMLQFLGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNTT 356
           SAPDIAG+GIANPIATIRS +LML+FLG  EAA DI +AV  NL+D  V + DLGG  TT
Sbjct: 302 SAPDIAGKGIANPIATIRSTALMLEFLGHNEAAQDIHKAVDANLRDGLVKTADLGGNATT 361

Query: 357 QEVLDDILARI 367
           Q V+DDILAR+
Sbjct: 362 QNVVDDILARL 372

>Suva_9.105 Chr9 complement(180626..181741) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  533 bits (1373), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/371 (68%), Positives = 314/371 (84%), Gaps = 4/371 (1%)

Query: 1   MHRSSATSLIHK---ATYATSKTLTIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYE 57
           M RS AT +      A+ A  K+LTIGLIPGDGIGKEVIPAG+++LE +  KH + F++ 
Sbjct: 1   MFRSVATRISACRGLASNAARKSLTIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNFI 60

Query: 58  HLDAGWQTFLETGNALPGATVEALRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLY 117
            L AG+QTF ETG ALP  T++ L+++CQGALFGAVQSPTTKVEGYSSPIVALRR++GLY
Sbjct: 61  DLYAGFQTFQETGKALPDETIKVLKDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLY 120

Query: 118 ANIRPVKSVSGT-GQPVDLVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATER 176
           AN+RPVKSV GT  +P+D+VIVRENTEDLY++ E+TY+D ATG RVA+AIKRISE AT R
Sbjct: 121 ANVRPVKSVEGTKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATRR 180

Query: 177 IAEISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQ 236
           IA+I+L +ALQR +  G   LTVTHKSNVLSQ+DGLF+E+C++VYE+NK  YG I+YNEQ
Sbjct: 181 IAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNEQ 240

Query: 237 IVDSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNVGNNIIIGEPCHG 296
           IVDSMVYRLF+EP CFDV+VAPNLYGD+LSDGAAALVGSLG+VPS NVG +I+IGEPCHG
Sbjct: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVIGEPCHG 300

Query: 297 SAPDIAGRGIANPIATIRSVSLMLQFLGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNTT 356
           SAPDIAG+GIANPIATIRS +LML+FLG  +AA DI +AV  NL++  + +PDLGGK +T
Sbjct: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIYKAVDANLREGAITTPDLGGKAST 360

Query: 357 QEVLDDILARI 367
           Q+V+DD+L+R+
Sbjct: 361 QQVVDDVLSRL 371

>YIL094C Chr9 complement(186517..187632) [1116 bp, 371 aa] {ON}
           LYS12Homo-isocitrate dehydrogenase, an NAD-linked
           mitochondrial enzyme required for the fourth step in the
           biosynthesis of lysine, in which homo-isocitrate is
           oxidatively decarboxylated to alpha-ketoadipate
          Length = 371

 Score =  533 bits (1373), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/371 (69%), Positives = 312/371 (84%), Gaps = 4/371 (1%)

Query: 1   MHRSSATSLIHK---ATYATSKTLTIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYE 57
           M RS AT L      A+ A  K+LTIGLIPGDGIGKEVIPAG++VLE +  KH + F++ 
Sbjct: 1   MFRSVATRLSACRGLASNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFI 60

Query: 58  HLDAGWQTFLETGNALPGATVEALRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLY 117
            L AG+QTF ETG ALP  TV+ L+E+CQGALFGAVQSPTTKVEGYSSPIVALRR++GL+
Sbjct: 61  DLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLF 120

Query: 118 ANIRPVKSVSG-TGQPVDLVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATER 176
           AN+RPVKSV G  G+P+D+VIVRENTEDLY++ E+TY+D ATG RVA+A KRISE AT R
Sbjct: 121 ANVRPVKSVEGEKGKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRR 180

Query: 177 IAEISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQ 236
           IA I+L +AL+R +  G+  LTVTHKSNVLSQ+DGLF+E+C+EVYE+NK  YG I+YNEQ
Sbjct: 181 IATIALDIALKRLQTRGQATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQ 240

Query: 237 IVDSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNVGNNIIIGEPCHG 296
           IVDSMVYRLF+EP CFDV+VAPNLYGD+LSDGAAALVGSLG+VPS NVG  I+IGEPCHG
Sbjct: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG 300

Query: 297 SAPDIAGRGIANPIATIRSVSLMLQFLGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNTT 356
           SAPDIAG+GIANPIATIRS +LML+FLG  EAA DI +AV  NL++  + +PDLGGK +T
Sbjct: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHNEAAQDIYKAVDANLREGSIKTPDLGGKAST 360

Query: 357 QEVLDDILARI 367
           Q+V+DD+L+R+
Sbjct: 361 QQVVDDVLSRL 371

>CAGL0G02585g Chr7 (238931..240049) [1119 bp, 372 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094c LYS12 homo-isocitrate dehydrogenase
          Length = 372

 Score =  533 bits (1373), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/372 (69%), Positives = 305/372 (81%), Gaps = 5/372 (1%)

Query: 1   MHRSSATSLI----HKATYATSKTLTIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSY 56
           M R SAT L       +T    K LTIGLIPGDGIGKEVIPAG+++LE +G K D+ F +
Sbjct: 1   MLRGSATRLTAMRGFSSTRLAQKALTIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKF 60

Query: 57  EHLDAGWQTFLETGNALPGATVEALRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGL 116
             L AGW+TF  TG ALP  TVE LR  CQGALFGAVQSPTTKVEGYSSPIVALR+ +GL
Sbjct: 61  IDLHAGWETFQNTGKALPDETVEVLRRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGL 120

Query: 117 YANIRPVKSVSGTG-QPVDLVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATE 175
           +AN+RPVK+V GT  +PVD+VIVRENTEDLY++ E+TY D ATG RVAEA KRISE AT 
Sbjct: 121 FANVRPVKAVEGTNDRPVDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATR 180

Query: 176 RIAEISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNE 235
           RIA I+L +ALQR +  G   LTVTHKSNVLSQ+DGLF+E+C++VYE+NK  YG I+YNE
Sbjct: 181 RIATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNE 240

Query: 236 QIVDSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNVGNNIIIGEPCH 295
           QIVDSMVYR+F+EP CFDVVVAPNLYGD+LSDGAAALVGSLG+VPS NVG  I+IGEPCH
Sbjct: 241 QIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 300

Query: 296 GSAPDIAGRGIANPIATIRSVSLMLQFLGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNT 355
           GSAPDIAGRGIANPIATIRS +LML+FLG  EAA  I +AV  N+++ Q+ +PDLGGK+T
Sbjct: 301 GSAPDIAGRGIANPIATIRSTALMLEFLGYPEAAQPIYKAVDSNIRENQIKTPDLGGKST 360

Query: 356 TQEVLDDILARI 367
           TQ+V+DDIL++I
Sbjct: 361 TQQVVDDILSKI 372

>Ecym_3326 Chr3 complement(624805..625905) [1101 bp, 366 aa] {ON}
           similar to Ashbya gossypii ADL214C
          Length = 366

 Score =  530 bits (1366), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/355 (71%), Positives = 301/355 (84%), Gaps = 2/355 (0%)

Query: 14  TYATSKTLTIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLDAGWQTFLETGNAL 73
           TY TSK+ TIGLIPGDGIGKEVIP G++VLE IG K+ + F Y  L AGWQTFL+TG AL
Sbjct: 13  TYVTSKSFTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQAGWQTFLDTGKAL 72

Query: 74  PGATVEALRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANIRPVKSVSGTG-QP 132
           P  TVE LR  CQGALFGAVQSPTTKV+GYSSPIVALR+ LGLYANIRPVKSV GTG +P
Sbjct: 73  PDDTVEQLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIRPVKSVDGTGDRP 132

Query: 133 VDLVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLALQRQRMG 192
           VDLVI RENTEDLY++ ERTY+D  TG RVAEAIKRISE AT  IA I+L +ALQR +  
Sbjct: 133 VDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEIALQRLKEK 192

Query: 193 GRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLFKEPHCF 252
           G   LTVTHKSNVLSQ+DGLF+E+C+ VY++NKK + +++YNEQIVDSMVYRLFKEP CF
Sbjct: 193 GHATLTVTHKSNVLSQSDGLFREICKSVYQSNKK-FANVQYNEQIVDSMVYRLFKEPQCF 251

Query: 253 DVVVAPNLYGDLLSDGAAALVGSLGLVPSVNVGNNIIIGEPCHGSAPDIAGRGIANPIAT 312
           DV+VAPNLYGD+LSDGAAALVGSLG+VPSVNVG NI+IGEPCHGSAPDI G+GIANPIAT
Sbjct: 252 DVIVAPNLYGDILSDGAAALVGSLGVVPSVNVGPNIVIGEPCHGSAPDIVGQGIANPIAT 311

Query: 313 IRSVSLMLQFLGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNTTQEVLDDILARI 367
           IRS +L+L+FLGL EAA  I++ V  N+++ ++ +PDLGG +T ++V +DIL+RI
Sbjct: 312 IRSAALLLEFLGLPEAARHIEKVVDENIRENKIKTPDLGGNSTGEQVANDILSRI 366

>Skud_9.79 Chr9 complement(163173..164288) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  528 bits (1361), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/371 (69%), Positives = 309/371 (83%), Gaps = 4/371 (1%)

Query: 1   MHRSSATSLIHK---ATYATSKTLTIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYE 57
           M RS AT +      AT A  K+LTIGLIPGDGIGKEVIPAG++VLE +  KH + F++ 
Sbjct: 1   MFRSVATRVSACRGLATNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFI 60

Query: 58  HLDAGWQTFLETGNALPGATVEALRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLY 117
            L AG+QTF ETG ALP  TV  L+++CQGALFGAVQSPTTKVEGYSSPIVALRR++GL+
Sbjct: 61  DLYAGFQTFQETGKALPDETVNVLKKQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLF 120

Query: 118 ANIRPVKSVSGT-GQPVDLVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATER 176
           AN+RPVKSV G+  +P+D+VIVRENTEDLY++ E+TY+D ATG RVA+A KRISE AT R
Sbjct: 121 ANVRPVKSVEGSRNKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRR 180

Query: 177 IAEISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQ 236
           IA I+L +AL+R +  G   LTVTHKSNVLSQTDGLF+E+C+EVYE+NK  YG I+YNEQ
Sbjct: 181 IATIALDIALKRLQTRGEATLTVTHKSNVLSQTDGLFREICKEVYESNKDKYGQIKYNEQ 240

Query: 237 IVDSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNVGNNIIIGEPCHG 296
           IVDSMVYRLF+EP CFDV+VAPNLYGD+LSDGAAALVGSLG+VPS NVG  I+IGEPCHG
Sbjct: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG 300

Query: 297 SAPDIAGRGIANPIATIRSVSLMLQFLGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNTT 356
           SAPDIAG+GIANPIATIRS +LML+FLG   AA DI +AV  NL++  + +PDLGGK +T
Sbjct: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHNGAAQDIYKAVDANLREGAITTPDLGGKAST 360

Query: 357 QEVLDDILARI 367
           Q+V+DD+L+R+
Sbjct: 361 QQVVDDVLSRL 371

>NDAI0B03550 Chr2 (891508..892626) [1119 bp, 372 aa] {ON} Anc_2.287
           YIL094C
          Length = 372

 Score =  527 bits (1358), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/372 (68%), Positives = 308/372 (82%), Gaps = 5/372 (1%)

Query: 1   MHRSSATSLIHKATYATS---KTLTIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYE 57
           M R++A+ L     YAT+   K LTIGLIPGDGIGKEVIPAG++VL+ +  KH + F + 
Sbjct: 1   MLRTTASRLATCRGYATNAIRKNLTIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFI 60

Query: 58  HLDAGWQTFLETGNALPGATVEALRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLY 117
            L AG+QTFL+TG ALP  T++ L+ +CQGALFGAVQSPTTKVEGYSSPIVALR+++GLY
Sbjct: 61  DLQAGFQTFLDTGKALPDETIQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLY 120

Query: 118 ANIRPVKSVSGT-GQPVDLVIVRENTEDLY-VQQERTYVDAATGKRVAEAIKRISEPATE 175
           AN+RPVKSV GT  +PVD+VIVRENT     ++ ERTY+D ATG RVAEA KRISE AT 
Sbjct: 121 ANVRPVKSVEGTTDKPVDMVIVRENTRRFINIKLERTYIDRATGTRVAEATKRISEIATR 180

Query: 176 RIAEISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNE 235
           RIA I+L +ALQR +  G+  LTVTHKSNVLSQ+DGLF+E+C++VYE+NK  YG I YNE
Sbjct: 181 RIATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNE 240

Query: 236 QIVDSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNVGNNIIIGEPCH 295
           QIVDSMVYR+F+EP CFDVVVAPNLYGD+LSDGAAALVGSLG+VPS NVG  I+IGEPCH
Sbjct: 241 QIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 300

Query: 296 GSAPDIAGRGIANPIATIRSVSLMLQFLGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNT 355
           GSAPDIAG+GI+NPIATIRS +LML+FLG  EAA DI +AV  NLK+ +V +PDLGGK+T
Sbjct: 301 GSAPDIAGKGISNPIATIRSTALMLEFLGHNEAAQDIHRAVEANLKENKVKTPDLGGKST 360

Query: 356 TQEVLDDILARI 367
           TQEV +D+LAR+
Sbjct: 361 TQEVTEDVLARL 372

>ZYRO0A01914g Chr1 complement(158403..159509) [1107 bp, 368 aa] {ON}
           highly similar to uniprot|P40495 Saccharomyces
           cerevisiae YIL094C LYS12 Homo-isocitrate dehydrogenase
           an NAD-linked mitochondrial enzyme required for the
           fourth step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 368

 Score =  526 bits (1356), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 251/368 (68%), Positives = 303/368 (82%), Gaps = 1/368 (0%)

Query: 1   MHRSSATSLIHKATYATSKTLTIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLD 60
           M RSS   +  +  Y+  K++ IGLIPGDGIGKEVIPAG++VLEA+G KH ++F +  L 
Sbjct: 1   MFRSSVAKVAARRAYSAPKSMKIGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFIDLK 60

Query: 61  AGWQTFLETGNALPGATVEALRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANI 120
           AGW+ F + G ALP  TV+ L+E+CQGALFGAVQSPTTKV GYSSPIVALR++LGLYAN+
Sbjct: 61  AGWEAFQQQGKALPDDTVKVLKEQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYANV 120

Query: 121 RPVKSV-SGTGQPVDLVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAE 179
           RPVKSV  G  + VD++IVRENTEDLY++ E+TYVD ATG RVAEAIKRISE AT +IA 
Sbjct: 121 RPVKSVEKGNDRNVDMIIVRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKIAT 180

Query: 180 ISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVD 239
           I+L ++LQR +  G   LTVTHKSNVLSQ+DGLF+E+C++VYE NK  YG ++YNEQIVD
Sbjct: 181 IALDISLQRLKSRGHATLTVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQIVD 240

Query: 240 SMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNVGNNIIIGEPCHGSAP 299
           SMVYR+F+EP CFDVVVAPNLYGD+LSDGAAALVGSLG+VPS NVG  I+IGEPCHGSAP
Sbjct: 241 SMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSAP 300

Query: 300 DIAGRGIANPIATIRSVSLMLQFLGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNTTQEV 359
           DIAG+GI+NPIATIRS +LML+FLG  E A DI +AV  NL    V +PDLGGK TTQ+V
Sbjct: 301 DIAGKGISNPIATIRSTALMLEFLGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQQV 360

Query: 360 LDDILARI 367
           +DDIL++I
Sbjct: 361 VDDILSKI 368

>Smik_9.85 Chr9 complement(165648..166763) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  525 bits (1353), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/371 (68%), Positives = 309/371 (83%), Gaps = 4/371 (1%)

Query: 1   MHRSSATSLIHK---ATYATSKTLTIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYE 57
           M RS AT L      AT A  K+LTIGLIPGDGIGKEVIPAG++VLE +  KH + F++ 
Sbjct: 1   MLRSVATRLSTCRGLATNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFI 60

Query: 58  HLDAGWQTFLETGNALPGATVEALRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLY 117
            L AG+QTF ETG ALP  TV+ L+E+CQGALFGAVQSPTTKVEGYSSPIVALRR++GL+
Sbjct: 61  DLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLF 120

Query: 118 ANIRPVKSVSG-TGQPVDLVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATER 176
           AN+RPVKSV G   +P+D+VIVRENTEDLY++ E+TY+D ATG RVA+A KRISE AT R
Sbjct: 121 ANVRPVKSVEGGKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRR 180

Query: 177 IAEISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQ 236
           IA I++ +AL+R +  G   LTVTHKSNVLSQ+DGLF+E+C+EVYE+NK  YG I+YNEQ
Sbjct: 181 IATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQ 240

Query: 237 IVDSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNVGNNIIIGEPCHG 296
           IVDSMVYRLF+EP CFDV+VAPNLYGD+LSDGAAALVGSLG+VPS NVG  I+IGEPCHG
Sbjct: 241 IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG 300

Query: 297 SAPDIAGRGIANPIATIRSVSLMLQFLGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNTT 356
           SAPDIAG+GIANPIATIRS +LML+FLG   AA DI +AV  NL++  + +PDLGGK +T
Sbjct: 301 SAPDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDANLREGAIKTPDLGGKAST 360

Query: 357 QEVLDDILARI 367
           Q+V++D+L+R+
Sbjct: 361 QQVVEDVLSRL 371

>TDEL0G02180 Chr7 complement(428789..429898) [1110 bp, 369 aa] {ON}
           Anc_2.287 YIL094C
          Length = 369

 Score =  525 bits (1353), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/369 (68%), Positives = 306/369 (82%), Gaps = 2/369 (0%)

Query: 1   MHRSSATSLIHKATYATS-KTLTIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHL 59
           M RS+   L  +  YA++ K++ IGLIPGDGIGKEVIPAG++VLE +  KH + F +  L
Sbjct: 1   MLRSAIGRLATRRAYASAPKSMVIGLIPGDGIGKEVIPAGKQVLENLSGKHGLNFDFIDL 60

Query: 60  DAGWQTFLETGNALPGATVEALRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYAN 119
            AGW TF ETG ALP  TV+ L+ +CQGALFGAVQSPTTKVEGYSSPIVALR++LGLYAN
Sbjct: 61  QAGWGTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKELGLYAN 120

Query: 120 IRPVKSVSGT-GQPVDLVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIA 178
           +RPVKSV GT  +PVD+VIVRENTEDLY++ E+TYVD ATG RVAEA KRISE AT RIA
Sbjct: 121 VRPVKSVEGTKDRPVDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRRIA 180

Query: 179 EISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIV 238
            I+L +ALQR +  G   LTVTHKSNVLSQ+DGLF+E+C++VYE+NK  YG + YNEQIV
Sbjct: 181 TIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQIV 240

Query: 239 DSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNVGNNIIIGEPCHGSA 298
           DSMVYR+F+EP CFDVVVAPNLYGD+LSDGAAALVGSLG+VPS NVG  I+IGEPCHGSA
Sbjct: 241 DSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSA 300

Query: 299 PDIAGRGIANPIATIRSVSLMLQFLGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNTTQE 358
           PDIAG+GI+NPIATIRS  LML+FLG  + A DI +AV  NL++ +V +PDLGG +TTQ+
Sbjct: 301 PDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDANLREDKVKTPDLGGNSTTQQ 360

Query: 359 VLDDILARI 367
           V++DIL+++
Sbjct: 361 VVEDILSKL 369

>KLLA0E08339g Chr5 (750670..751779) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094C LYS12 Homo-isocitrate dehydrogenase an
           NAD-linked mitochondrial enzyme required for the fourth
           step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 369

 Score =  520 bits (1338), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 244/368 (66%), Positives = 304/368 (82%), Gaps = 1/368 (0%)

Query: 1   MHRSSATSLIHKATYATSKTLTIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLD 60
           M R+    L  +A  + +K LTIGLIPGDGIGKEVIPAG+++LE++  K+ + F +  L 
Sbjct: 1   MMRTRFIQLSRRAYASNAKNLTIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFIDLQ 60

Query: 61  AGWQTFLETGNALPGATVEALRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANI 120
           AGW+TF  TG ALP  T++ L+ +C+GALFGAVQSPTTKVEGYSSPIVALR+ LGL+AN+
Sbjct: 61  AGWETFQNTGKALPDETIDILKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGLFANV 120

Query: 121 RPVKSVSGT-GQPVDLVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAE 179
           RPVKSV GT  + VDLVIVRENTEDLY++ E++Y+D ATG RVA+A KRI+E AT+ IA 
Sbjct: 121 RPVKSVDGTKDRKVDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIAT 180

Query: 180 ISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVD 239
           I+L++A QR    G   LTVTHKSNVLSQ+DGLF+EVCRE YEANK  YG ++YNEQIVD
Sbjct: 181 IALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVD 240

Query: 240 SMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNVGNNIIIGEPCHGSAP 299
           SMVYR+F+EP CFDVVVAPNLYGD+LSDGAAALVGSLG+VPS NVG NI+IGEPCHGSAP
Sbjct: 241 SMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPNIVIGEPCHGSAP 300

Query: 300 DIAGRGIANPIATIRSVSLMLQFLGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNTTQEV 359
           DIAG+GI+NPIATIRS +LML+FLG  E A DI +AV  N+++ + ++PDLGG +TTQ+V
Sbjct: 301 DIAGKGISNPIATIRSTALMLEFLGYPEPAKDIHKAVDANIREGKYLTPDLGGNSTTQQV 360

Query: 360 LDDILARI 367
           L+D+L+++
Sbjct: 361 LEDVLSKL 368

>TPHA0C03410 Chr3 complement(748639..749754) [1116 bp, 371 aa] {ON}
           Anc_2.287 YIL094C
          Length = 371

 Score =  518 bits (1333), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/348 (70%), Positives = 296/348 (85%), Gaps = 1/348 (0%)

Query: 21  LTIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLDAGWQTFLETGNALPGATVEA 80
           LTIGLIPGDGIGKEVIP+G++VLE IG KH + F++  L AGWQTFL+TG ALP  TV+ 
Sbjct: 24  LTIGLIPGDGIGKEVIPSGRQVLETIGPKHGLTFNFIDLQAGWQTFLDTGKALPVETVKT 83

Query: 81  LRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANIRPVKSVSGTG-QPVDLVIVR 139
           LRE C GALFGAVQSPTTKVEGYSSPIVALR++LGLYANIRPVKSV   G + VD+VIVR
Sbjct: 84  LRENCDGALFGAVQSPTTKVEGYSSPIVALRKELGLYANIRPVKSVDTPGNKKVDMVIVR 143

Query: 140 ENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLALQRQRMGGRGALTV 199
           ENTEDLY++ E+TY+D  TG RVA+A KRISE AT RIA+I+L +ALQR +  G   LTV
Sbjct: 144 ENTEDLYIKLEKTYIDEKTGTRVADATKRISEVATRRIAKIALDIALQRLKNNGNVQLTV 203

Query: 200 THKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLFKEPHCFDVVVAPN 259
           THKSNVLSQ+DGLF+EVC+EV+E+NK  Y  I+YNEQI+DSMVYRLF+EP CFDV+VAPN
Sbjct: 204 THKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNEQIIDSMVYRLFREPECFDVIVAPN 263

Query: 260 LYGDLLSDGAAALVGSLGLVPSVNVGNNIIIGEPCHGSAPDIAGRGIANPIATIRSVSLM 319
           LYGD+LSDGAAALVGSLG+VPS NVG  I+IGEPCHGSAPDIAG+GI+NPIATIRS +LM
Sbjct: 264 LYGDILSDGAAALVGSLGVVPSANVGPGIVIGEPCHGSAPDIAGKGISNPIATIRSTALM 323

Query: 320 LQFLGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNTTQEVLDDILARI 367
           L+FLG  +AA DI  AV  NL++ ++ +PDLGGKN+T +V++D++ R+
Sbjct: 324 LEFLGHSQAAQDIQTAVDSNLREDKIKTPDLGGKNSTSDVVNDVIRRL 371

>TBLA0B05940 Chr2 complement(1402869..1403978) [1110 bp, 369 aa]
           {ON} Anc_2.287 YIL094C
          Length = 369

 Score =  516 bits (1330), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 248/369 (67%), Positives = 302/369 (81%), Gaps = 2/369 (0%)

Query: 1   MHRSSATSLIHKATYATS-KTLTIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHL 59
           M R+S       A  A+S KTLTIGLIPGDGIGKEVIPAG++VL+ + KKH + F +  L
Sbjct: 1   MLRTSVRQFSVSARNASSLKTLTIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEFIDL 60

Query: 60  DAGWQTFLETGNALPGATVEALRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYAN 119
            AG+QTFL+TG ALP  TV+ L+ +CQGALFGAVQSPTTKVEGYSSPIV LR++LGL+AN
Sbjct: 61  QAGYQTFLDTGAALPRDTVDILKNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGLFAN 120

Query: 120 IRPVKSVSGT-GQPVDLVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIA 178
           +RPVK+V GT  +P+DLVIVRENTEDLY++ E+TY D   G R+AEA KRI+E AT+RIA
Sbjct: 121 VRPVKTVEGTDAKPIDLVIVRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIA 180

Query: 179 EISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIV 238
           + +L +ALQR +  G   LTVTHKSNVLSQ+DGLF+EVC+EVYE+NK  Y  + YNEQIV
Sbjct: 181 KTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIV 240

Query: 239 DSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNVGNNIIIGEPCHGSA 298
           DSMVYRLF+EP CFDV+VAPNLYGD+LSDGAAALVGSLGLVPS NVG NI+IGEPCHGSA
Sbjct: 241 DSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGLVPSANVGPNIVIGEPCHGSA 300

Query: 299 PDIAGRGIANPIATIRSVSLMLQFLGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNTTQE 358
           PDIAG+GIANPIATIRS + ML++LG    A DI +AV  N++D ++ + DLGG +TTQ+
Sbjct: 301 PDIAGKGIANPIATIRSTAQMLEYLGYSNPAQDIYKAVDANIRDNKIKTADLGGDSTTQQ 360

Query: 359 VLDDILARI 367
           V+DDIL ++
Sbjct: 361 VIDDILGKL 369

>KAFR0J01360 Chr10 (249197..250318) [1122 bp, 373 aa] {ON} Anc_2.287
           YIL094C
          Length = 373

 Score =  509 bits (1311), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 240/372 (64%), Positives = 310/372 (83%), Gaps = 6/372 (1%)

Query: 1   MHRSSAT---SLIHKATYATSKTLTIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYE 57
           M RS  T   ++ H +T   +K+LTIGLIPGDGIGKEVIPAG++VL+ +  +H + F++ 
Sbjct: 1   MLRSVVTKSATIRHLSTKGINKSLTIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNFI 60

Query: 58  HLDAGWQTFLETGNALPGATVEALRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLY 117
            L+AG+QTFL+TG ALP  TV+ L+E+CQG LFGAVQSPTT+V+ YSSPIVALR++L LY
Sbjct: 61  DLEAGFQTFLDTGKALPDETVKVLKEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQLY 120

Query: 118 ANIRPVKSVSG--TGQPVDLVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATE 175
           ANIRPVKSV+G  +G+PVD+VIVRENTEDLY++ E++Y D   G RVAEA KRI+E AT 
Sbjct: 121 ANIRPVKSVAGAHSGKPVDMVIVRENTEDLYIKIEKSYKDQ-NGMRVAEATKRITEVATR 179

Query: 176 RIAEISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNE 235
           +IA+I+L +ALQR +  G+  LTVTHKSNVLSQ+DGLF+E+C++VY+ANK  Y  I YNE
Sbjct: 180 KIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYNE 239

Query: 236 QIVDSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNVGNNIIIGEPCH 295
           QI+DSMVYR+F+EP  FDV+VAPNLYGD+LSDGAAALVGSLG+VPS NVG +I++GEPCH
Sbjct: 240 QIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVMGEPCH 299

Query: 296 GSAPDIAGRGIANPIATIRSVSLMLQFLGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNT 355
           GSAPDIAG+GIANPIATIRS +LML+FLG +EAA DI +AV  N+++ ++ +PDLGG ++
Sbjct: 300 GSAPDIAGKGIANPIATIRSTALMLEFLGHKEAAQDIHKAVESNMRENKIKTPDLGGNSS 359

Query: 356 TQEVLDDILARI 367
           TQ V+DD+L ++
Sbjct: 360 TQNVVDDVLEKL 371

>Ecym_2313 Chr2 complement(610493..611605) [1113 bp, 370 aa] {ON}
           similar to Ashbya gossypii AFR137C
          Length = 370

 Score =  189 bits (479), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 126/353 (35%), Positives = 188/353 (53%), Gaps = 28/353 (7%)

Query: 22  TIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLDAGWQTFLETGNALPGATVEAL 81
           T+  I GDGIG E+  + + +  A      +   +E+ D     F+     +P   V+++
Sbjct: 39  TVSFIEGDGIGPEISQSVKDIFSAA----KVPVEWEYCDV-TPIFINGLTTIPDPAVQSI 93

Query: 82  RERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANIRPVKSVSG---TGQPVDLVIV 138
            +    AL G + +P  K  G+ S  + LR+  GL+AN+RP KS+ G   T + VDLV++
Sbjct: 94  NKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLI 150

Query: 139 RENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLALQRQRMGGRGALT 198
           RENTE  Y     + ++      V ++IK I+  A+ER+    +R A +  R  GR  + 
Sbjct: 151 RENTEGEY-----SGIEHVVSPGVVQSIKLITRDASERV----IRYAFEYARAVGRPKVV 201

Query: 199 VTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLFKEPHCFD--VVV 256
           V HKS +    DGLF  V +EV     K Y  IE   +++D+ V  +  +P  +   V V
Sbjct: 202 VVHKSTIQRLADGLFVNVAQEV----GKEYPDIELQPELIDNTVLNVVSKPEKYSDSVAV 257

Query: 257 APNLYGDLLSDGAAAL-VGSLGLVPSVNVGNNIIIGEPCHGSAPDIAGRGIANPIATIRS 315
            PNLYGD+LSD  + L  GSLGL PS N+G+ + I E  HGSAPDIAG+  ANP A + S
Sbjct: 258 CPNLYGDILSDLNSGLSAGSLGLTPSANIGHTVSIFEAVHGSAPDIAGQNCANPTALLLS 317

Query: 316 VSLMLQFLGLEEAASDIDQAVTGNL-KDRQVVSPDLGGKNTTQEVLDDILARI 367
             +ML  +GL E A  I+ AV   +  D++  + DL G  TT      ++ R+
Sbjct: 318 SVMMLNHMGLHEHADQIESAVLATVASDKKNRTADLAGTATTSSFTKAVIERL 370

>KLLA0E03125g Chr5 (288825..289931) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 368

 Score =  188 bits (478), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 124/353 (35%), Positives = 191/353 (54%), Gaps = 28/353 (7%)

Query: 22  TIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLDAGWQTFLETGNALPGATVEAL 81
           T+  I GDG+G E+     + ++AI     +   +E  D     F+     +P   V ++
Sbjct: 37  TVSFIEGDGVGPEI----SKSVKAIFSAAKVPIEWESCDVS-PIFVNGLTTIPDPAVASI 91

Query: 82  RERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANIRPVKSVSG---TGQPVDLVIV 138
            +    AL G + +P  K  G+ S  + LR+  GL+AN+RP KS+ G   T + V+LV++
Sbjct: 92  NKNLI-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGYKTTYENVNLVLI 148

Query: 139 RENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLALQRQRMGGRGALT 198
           RENTE  Y     + ++      V ++IK I++ A+ER+    +R A +  R   R  + 
Sbjct: 149 RENTEGEY-----SGIEHVVAPGVVQSIKLITQDASERV----IRYAFEYARAVDRSKVL 199

Query: 199 VTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLFKEPHCFD--VVV 256
           V HKS +    DGLF +V +++       Y  IE   +++D+ V +  + P  +D  VVV
Sbjct: 200 VVHKSTIQRLADGLFVDVAKKL----SSEYPDIELQTELLDNTVLKTVQHPEAYDDVVVV 255

Query: 257 APNLYGDLLSDGAAAL-VGSLGLVPSVNVGNNIIIGEPCHGSAPDIAGRGIANPIATIRS 315
            PNLYGD+LSD  + L  GSLGL PS N+G+ + I E  HGSAPDIAG+  ANP A + S
Sbjct: 256 CPNLYGDILSDLNSGLSAGSLGLTPSANIGHTVSIFEAVHGSAPDIAGQNKANPTALLLS 315

Query: 316 VSLMLQFLGLEEAASDIDQAVTGNL-KDRQVVSPDLGGKNTTQEVLDDILARI 367
             +ML  +GL E A  I++AV   +  D +  + DLGG  +T    D ++ R+
Sbjct: 316 SVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSSFTDAVIERL 368

>TPHA0D01560 Chr4 complement(321751..322833) [1083 bp, 360 aa] {ON}
           Anc_2.278 YNL037C
          Length = 360

 Score =  186 bits (472), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 128/351 (36%), Positives = 184/351 (52%), Gaps = 28/351 (7%)

Query: 22  TIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLDA-GWQTFLETGNALPGATVEA 80
           T+ LIPGDGIGKEV  +  ++  + G    +   +E +D  G     E   A     VE+
Sbjct: 30  TVTLIPGDGIGKEVTDSVVKIFASQG----LPIDWERIDVPGMSNENEVKKA-----VES 80

Query: 81  LRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANIRPVKSVSG--TGQP-VDLVI 137
           L+    G     +   +    GY S  VALR+QL ++AN+   KS+ G  T  P VDLV+
Sbjct: 81  LKRNKIG--LKGIWHTSADQTGYGSLNVALRKQLDIFANVAIFKSLKGVKTKIPDVDLVV 138

Query: 138 VRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLALQRQRMGGRGAL 197
           +RENTE  Y   E   V       V E++K I++P TERIA  +   AL+  R      +
Sbjct: 139 IRENTEGEYSGLEHESVPG-----VVESLKIITKPKTERIARFAFDFALENNR----STV 189

Query: 198 TVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLFKEPHCFDVVVA 257
           T  HK+N++  +DGLFK    EV E   K Y  I+ N  IVD+   +   +PH FDV+V 
Sbjct: 190 TAVHKANIMKLSDGLFKNTVAEVGE---KEYPDIKVNTIIVDNASMQAVAKPHQFDVMVT 246

Query: 258 PNLYGDLLSDGAAALVGSLGLVPSVNVGNNIIIGEP-CHGSAPDIAGRGIANPIATIRSV 316
           P++YG +L +  AAL+G  GL+P  N G    + EP       DI  + IANP A I S 
Sbjct: 247 PSMYGTILGNIGAALIGGPGLIPGANYGREHAVFEPGSRHVGLDIENQNIANPTAMILSA 306

Query: 317 SLMLQFLGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNTTQEVLDDILARI 367
           +LML  LGL E +  I  AV   +++ +  + D+GG  +T E  D ++ ++
Sbjct: 307 TLMLNQLGLREESKRISNAVYAVIEEGKTTTKDIGGNASTTEFTDAVIDKL 357

>ADL223W Chr4 (312893..313981) [1089 bp, 362 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL037C (IDH1)
          Length = 362

 Score =  185 bits (470), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 125/354 (35%), Positives = 184/354 (51%), Gaps = 33/354 (9%)

Query: 22  TIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLDAGWQTF----LETGNALPGAT 77
           T+ LIPGDGIGKEV  +  ++ EA           E++   W++     LE  +      
Sbjct: 31  TVTLIPGDGIGKEVTDSVVQIFEA-----------ENVPVDWESVELSALEENHEGVQKA 79

Query: 78  VEALRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANIRPVKSVSGTG---QPVD 134
           VE+L+ R +  L G   +P  +  G+ S  VA R+QL ++AN+   KS  G     Q VD
Sbjct: 80  VESLK-RNKVGLKGIWHTPADQT-GHGSLNVAFRKQLDIFANVALFKSFPGVKTKLQDVD 137

Query: 135 LVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLALQRQRMGGR 194
           LVI+RENTE  Y   E   V       V E++K +++  +ERIA  +   AL+  R    
Sbjct: 138 LVIIRENTEGEYSGLEHESVPG-----VVESLKIMTKAKSERIARFAFDFALKNNRK--- 189

Query: 195 GALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLFKEPHCFDV 254
            A+   HK+N++   DGLF+    E+     K Y  +  +  IVD+   +   +PH FDV
Sbjct: 190 -AVCAVHKANIMKLGDGLFRNTVSEI---GAKEYPEVNVSSIIVDNASMQAVAKPHQFDV 245

Query: 255 VVAPNLYGDLLSDGAAALVGSLGLVPSVNVGNNIIIGEP-CHGSAPDIAGRGIANPIATI 313
           +V PNLYG +L +  AAL+G  GLVP  N G    + EP C     DI G+ +ANP A I
Sbjct: 246 LVTPNLYGSILGNIGAALIGGPGLVPGANFGREYAVFEPGCRHVGLDIKGQDVANPTAMI 305

Query: 314 RSVSLMLQFLGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNTTQEVLDDILARI 367
            S +LML+ LGL E A  I +A    + + +  + D+GG  TT E  + ++ ++
Sbjct: 306 LSSTLMLRHLGLNEYADRISRATYETIAEGKRTTKDIGGTATTTEFTNAVIDKL 359

>NCAS0H02250 Chr8 (441692..442960) [1269 bp, 422 aa] {ON} Anc_5.473
          Length = 422

 Score =  187 bits (474), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 133/379 (35%), Positives = 197/379 (51%), Gaps = 41/379 (10%)

Query: 2   HRSSATSLIHKATYATSKTLTIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLDA 61
           H+ S      K   +T K  T+  I GDGIG E+  + +++           FS   +  
Sbjct: 72  HQPSIGKYTGKPNPSTGK-YTVSFIEGDGIGPEISNSVKQI-----------FSAAKVPI 119

Query: 62  GWQT------FLETGNALPGATVEALRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLG 115
            W+T      F++    +P   V+++ +    AL G + +P  K  G+ S  + LR+  G
Sbjct: 120 EWETCDVTPLFIDGLTTIPEPAVQSINKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFG 176

Query: 116 LYANIRPVKSVSG--TGQP-VDLVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEP 172
           L+AN+RP +SV G  T  P VDLV++RENTE  Y   E           V ++IK I+  
Sbjct: 177 LFANVRPARSVKGFKTTYPNVDLVLIRENTEGEYSGIEHVVTPG-----VVQSIKLITRE 231

Query: 173 ATERIAEISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIE 232
           A+ER+    +R A +  R  GR  L V HKS +   +DGLF  V +E+     K Y  I+
Sbjct: 232 ASERV----IRYAFEYCRAIGRPRLVVVHKSTIQRLSDGLFVNVAKEL----SKEYPDIQ 283

Query: 233 YNEQIVDSMVYRLFKEPHCFD--VVVAPNLYGDLLSDGAAAL-VGSLGLVPSVNVGNNII 289
           +  +++D+ V ++   P  +   V V PNLYGD+LSD  + L  GSLGL PS N+GN I 
Sbjct: 284 FETELIDNTVLKVVSNPSSYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSGNIGNEIS 343

Query: 290 IGEPCHGSAPDIAGRGIANPIATIRSVSLMLQFLGLEEAASDIDQAVTGNLKD-RQVVSP 348
           I E  HGSAPDIAG+ +ANP A + S  +ML  +GL + A  I+ AV   +    +  + 
Sbjct: 344 IFEAVHGSAPDIAGKNMANPTALLLSSVMMLNHMGLSKHADQIENAVLSTIASGPESRTG 403

Query: 349 DLGGKNTTQEVLDDILARI 367
           DL G  TT    D ++ ++
Sbjct: 404 DLAGTATTSTFTDAVIKKL 422

>CAGL0I07227g Chr9 complement(696605..697711) [1107 bp, 368 aa] {ON}
           highly similar to uniprot|P28241 Saccharomyces
           cerevisiae YOR136w IDH2 isocitrate dehydrogenase
          Length = 368

 Score =  183 bits (465), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 124/354 (35%), Positives = 188/354 (53%), Gaps = 28/354 (7%)

Query: 21  LTIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLDAGWQTFLETGNALPGATVEA 80
            T+  I GDGIG E+  + +R+ +A     D+   +E  D     F+     +P   V++
Sbjct: 36  FTVSFIEGDGIGPEISSSVKRIFQA----ADVPVEWETCDV-TPIFVNGLTTIPDPAVQS 90

Query: 81  LRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANIRPVKSVSG---TGQPVDLVI 137
           + +    AL G + +P  K  G+ S  + LR+   L+AN+RP KS+ G   T + VDLV+
Sbjct: 91  INKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSIEGFKTTYENVDLVL 147

Query: 138 VRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLALQRQRMGGRGAL 197
           +RENTE  Y     + ++      V ++IK I+  A+ER+    +R A +  R  GR  L
Sbjct: 148 IRENTEGEY-----SGIEHLVSPGVVQSIKLITRDASERV----IRYAYEYARAIGRPRL 198

Query: 198 TVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLFKEPHCFD--VV 255
            V HKS +    DGLF  V +E+       Y  I+   +++D+    +   P  +   V 
Sbjct: 199 IVVHKSTIQRLADGLFVNVAKEL----AAEYPDIQLETELIDNTCLNVVSNPSSYTDAVS 254

Query: 256 VAPNLYGDLLSDGAAAL-VGSLGLVPSVNVGNNIIIGEPCHGSAPDIAGRGIANPIATIR 314
           V PNLYGD+LSD  + L  GSLGL PS N+G+ + I E  HGSAPDIAG+  ANP A + 
Sbjct: 255 VCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAPDIAGQNKANPTALLL 314

Query: 315 SVSLMLQFLGLEEAASDIDQAVTGNLK-DRQVVSPDLGGKNTTQEVLDDILARI 367
           S  +ML  +G+ E A  I++AV G +    +  + DLGG  +T    D I+ ++
Sbjct: 315 SSVMMLNHMGMTEHADRIEKAVLGTIAGGSEYRTGDLGGSASTTSFTDAIIKKL 368

>Suva_8.188 Chr8 (335409..336518) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  182 bits (463), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 124/353 (35%), Positives = 184/353 (52%), Gaps = 28/353 (7%)

Query: 22  TIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLDAGWQTFLETGNALPGATVEAL 81
           T+  I GDGIG E+  + +++  A     D+  ++E  D     F+     +P   V+++
Sbjct: 38  TVSFIEGDGIGPEISKSVKKIFSA----ADVPINWEFCDVN-PIFVNGLTTIPDPAVQSI 92

Query: 82  RERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANIRPVKSVSG---TGQPVDLVIV 138
            +    AL G + +P  K  G+ S  + LR+  GL+AN+RP KS+ G   T + VDLV++
Sbjct: 93  TKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLI 149

Query: 139 RENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLALQRQRMGGRGALT 198
           RENTE  Y   E           V ++IK I+  A+ER+    +R A +  R  GR  + 
Sbjct: 150 RENTEGEYSGIEHIVCPG-----VVQSIKLITREASERV----IRYAFEYARAIGRPRII 200

Query: 199 VTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLFKEPHCFD--VVV 256
           V HKS +    DGLF  V +E+     K Y  I +  +++D+ V  +   P  +   V V
Sbjct: 201 VVHKSTIQRLADGLFVNVAKEL----SKEYPDITFETELIDNKVLNVVTNPSAYTNAVSV 256

Query: 257 APNLYGDLLSDGAAAL-VGSLGLVPSVNVGNNIIIGEPCHGSAPDIAGRGIANPIATIRS 315
            PNLYGD+LSD  + L  GSLGL PS N+G+ + I E  HGSAPDIAG+  ANP A + S
Sbjct: 257 CPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAPDIAGKDKANPTALLLS 316

Query: 316 VSLMLQFLGLEEAASDIDQAVTGNLKD-RQVVSPDLGGKNTTQEVLDDILARI 367
             +ML  +GL   A  I  AV   +    +  + DL G  TT    + ++ R+
Sbjct: 317 SVMMLNHMGLTSHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369

>TPHA0J02770 Chr10 (617727..618857) [1131 bp, 376 aa] {ON} Anc_2.278
           YNL037C
          Length = 376

 Score =  182 bits (461), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 128/358 (35%), Positives = 190/358 (53%), Gaps = 28/358 (7%)

Query: 17  TSKTLTIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLDAGWQTFLETGNALPGA 76
           +S T T+  I GDG+G E+  + + +  A     ++   ++  D G   F+     +P  
Sbjct: 40  SSGTYTVPFIEGDGVGPEISKSVKDIFSA----ANVPIQWQPCDVG-PIFVNGLTTIPEP 94

Query: 77  TVEALRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANIRPVKSV---SGTGQPV 133
            V+A++E    AL G + +P  K  G+ S  + LR+   L+AN+RP KSV     T + V
Sbjct: 95  AVKAIKESLV-ALKGPLATPVGK--GHRSLNLTLRKTFDLFANVRPAKSVPNYKSTYENV 151

Query: 134 DLVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLALQRQRMGG 193
           DLV++RENTE  Y   E           V ++IK I+  A+E++    +R A +     G
Sbjct: 152 DLVLIRENTEGEYSGIEHIVTPG-----VVQSIKLITREASEKV----IRYAYEYAIAVG 202

Query: 194 RGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLFKEPHCFD 253
           R  L V HKS +    DGLF ++  E+    +  Y SI+   QI+D+ V  +   P  + 
Sbjct: 203 RPRLIVVHKSTIQRLGDGLFVQIANEL----QSEYPSIKLETQILDNTVLNVVSNPTLYK 258

Query: 254 --VVVAPNLYGDLLSDGAAAL-VGSLGLVPSVNVGNNIIIGEPCHGSAPDIAGRGIANPI 310
             V V PNLYGD+LSD  + L  GSLGL PS N+G+ + I E  HGSAPDIAG+  ANP 
Sbjct: 259 DAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGSAPDIAGQNKANPT 318

Query: 311 ATIRSVSLMLQFLGLEEAASDIDQAVTGNLKD-RQVVSPDLGGKNTTQEVLDDILARI 367
           A + S  +ML  +GLEE AS I+ AV   +    +  + DLGG  TT    + ++ ++
Sbjct: 319 ALLLSSVMMLNHMGLEEHASRIENAVLSTIASGPESRTGDLGGSATTSSFTECVIKKL 376

>YNL037C Chr14 complement(557920..559002) [1083 bp, 360 aa] {ON}
           IDH1Subunit of mitochondrial NAD(+)-dependent isocitrate
           dehydrogenase, which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 360

 Score =  181 bits (459), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 121/354 (34%), Positives = 193/354 (54%), Gaps = 32/354 (9%)

Query: 21  LTIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLDAGWQTF-LETGNALPGA--T 77
            T+ LIPGDG+GKE+  + + + EA           E++   W+T  ++  +   G    
Sbjct: 29  FTVTLIPGDGVGKEITDSVRTIFEA-----------ENIPIDWETINIKQTDHKEGVYEA 77

Query: 78  VEALRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANIRPVKSVSG--TGQP-VD 134
           VE+L+ R +  L G   +P  +  G+ S  VALR+QL +YAN+   KS+ G  T  P +D
Sbjct: 78  VESLK-RNKIGLKGLWHTPADQT-GHGSLNVALRKQLDIYANVALFKSLKGVKTRIPDID 135

Query: 135 LVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLALQRQRMGGR 194
           L+++RENTE  +   E   V       V E++K ++ P TERIA    R A    +   R
Sbjct: 136 LIVIRENTEGEFSGLEHESVPG-----VVESLKVMTRPKTERIA----RFAFDFAKKYNR 186

Query: 195 GALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLFKEPHCFDV 254
            ++T  HK+N++   DGLF+ +  E+    +K Y  I+ +  IVD+   +   +PH FDV
Sbjct: 187 KSVTAVHKANIMKLGDGLFRNIITEI---GQKEYPDIDVSSIIVDNASMQAVAKPHQFDV 243

Query: 255 VVAPNLYGDLLSDGAAALVGSLGLVPSVNVGNNIIIGEP-CHGSAPDIAGRGIANPIATI 313
           +V P++YG +L +  AAL+G  GLV   N G +  + EP       DI G+ +ANP A I
Sbjct: 244 LVTPSMYGTILGNIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLDIKGQNVANPTAMI 303

Query: 314 RSVSLMLQFLGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNTTQEVLDDILARI 367
            S +LML  LGL E A+ I +AV   + + +  + D+GG ++T +  ++I+ ++
Sbjct: 304 LSSTLMLNHLGLNEYATRISKAVHETIAEGKHTTRDIGGSSSTTDFTNEIINKL 357

>Smik_14.290 Chr14 (528131..529213) [1083 bp, 360 aa] {ON} YNL037C
           (REAL)
          Length = 360

 Score =  181 bits (459), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 122/354 (34%), Positives = 191/354 (53%), Gaps = 32/354 (9%)

Query: 21  LTIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLDAGWQTF-LETGNALPGA--T 77
            T+ LIPGDG+GKE+  + + + EA           E +   W+T  ++  +   G    
Sbjct: 29  FTVTLIPGDGVGKEITDSVKTIFEA-----------EKIPVDWETVNIKQTDHKEGVYEA 77

Query: 78  VEALRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANIRPVKSVSG--TGQP-VD 134
           VE+L+ R +  L G   +P  +  G+ S  VALR+QL +YAN+   KS+ G  T  P +D
Sbjct: 78  VESLK-RNKIGLKGLWHTPADQT-GHGSLNVALRKQLDIYANVALFKSLKGVKTRIPDID 135

Query: 135 LVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLALQRQRMGGR 194
           L+++RENTE  +   E   V       V E++K ++ P TERIA    R A    +   R
Sbjct: 136 LIVIRENTEGEFSGLEHESVPG-----VVESLKIMTRPKTERIA----RFAFDFAKKYNR 186

Query: 195 GALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLFKEPHCFDV 254
            A+T  HK+N++   DGLF+ +  E+    +K Y  I+ +  IVD+   +   +PH FDV
Sbjct: 187 KAVTAVHKANIMKLGDGLFRNIITEI---GQKEYPDIDVSSIIVDNASMQAVAKPHQFDV 243

Query: 255 VVAPNLYGDLLSDGAAALVGSLGLVPSVNVGNNIIIGEP-CHGSAPDIAGRGIANPIATI 313
           +V P++YG +L +  AAL+G  GLV   N G +  + EP       DI G+ +ANP A I
Sbjct: 244 LVTPSMYGTILGNIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLDIKGQNVANPTAMI 303

Query: 314 RSVSLMLQFLGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNTTQEVLDDILARI 367
            S  LML  LGL E A+ I +AV   + + +  + D+GG ++T +  ++I+ ++
Sbjct: 304 LSSVLMLNHLGLNEYATRISKAVHETIAEGKHTTKDIGGSSSTTDFTNEIINKL 357

>KAFR0B06370 Chr2 complement(1317952..1319088) [1137 bp, 378 aa]
           {ON} Anc_5.473 YOR136W
          Length = 378

 Score =  181 bits (458), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 131/366 (35%), Positives = 197/366 (53%), Gaps = 37/366 (10%)

Query: 12  KATYATSKTLTIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLDAGWQTFLETGN 71
           K  +AT K  T+  I GDGIG E+     R ++ I +   +  ++E  D      ++   
Sbjct: 36  KPDHATGK-YTVSFIEGDGIGPEI----SRSVKDIFQAASVPITWETCDVS-PILVDGLT 89

Query: 72  ALPGATVEALRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANIRPVKSVSG--- 128
            +P   V+++ +   G L G + +P  K  G+ S  + LR+   L+AN+RP KSV G   
Sbjct: 90  TIPDEAVKSINKNLVG-LKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSVRGFKT 146

Query: 129 TGQPVDLVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLALQR 188
           T   VDLV++RENTE  Y   E           V ++IK I+  A+ER+    +R A + 
Sbjct: 147 TYDNVDLVLIRENTEGEYSGIEHVVTPG-----VVQSIKLITRDASERV----IRYAFEY 197

Query: 189 QRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLFKE 248
            +  GR  + V HKS +   +DGLF  V +E+ +  +K++ +IE + +++D+ V  +   
Sbjct: 198 AKAIGRPKVIVVHKSTIQRLSDGLFVNVAKELQK--EKNFQNIELDTELIDNTVLNVVMN 255

Query: 249 PHCFD--VVVAPNLYGDLLSDGAAAL-VGSLGLVPSVNVGNNIIIGEPCHGSAPDIAGRG 305
           P  +   V V PNLYGD+LSD  + L  GSLGL PS N+G+ I I E  HGSAPDIAG+ 
Sbjct: 256 PSKYSDAVFVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKISIFEAVHGSAPDIAGQN 315

Query: 306 IANPIATIRSVSLMLQFLGLEEAASDIDQAVTGNL----KDRQVVSPDLGGKNT----TQ 357
            ANP A + S  +ML  +GL E    I+ AV   +    K+R   + DLGG  T    T+
Sbjct: 316 KANPTALLLSSVMMLHHMGLNEYGDKIENAVLKTIAASSKNR---TGDLGGTATTTSFTE 372

Query: 358 EVLDDI 363
            V+D++
Sbjct: 373 AVIDNL 378

>NDAI0C01410 Chr3 complement(295178..296287) [1110 bp, 369 aa] {ON}
           Anc_5.473
          Length = 369

 Score =  180 bits (457), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 124/354 (35%), Positives = 185/354 (52%), Gaps = 28/354 (7%)

Query: 21  LTIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLDAGWQTFLETGNALPGATVEA 80
            T+  I GDGIG E+  + +++ +A      +   +E  D     F+     +P   V++
Sbjct: 37  FTVSFIEGDGIGPEISQSVKQIFDA----AKVPIDWEPCDVS-PLFINGLTTIPEPAVQS 91

Query: 81  LRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANIRPVKSVSGTG---QPVDLVI 137
           + +    AL G + +P  K  G+ S  + LR+  GL+AN+RP KS+ G       VDLVI
Sbjct: 92  INKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTIYDNVDLVI 148

Query: 138 VRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLALQRQRMGGRGAL 197
           +RENTE  Y   E           V ++IK I+  A+ER+    +R A +  R  GR  +
Sbjct: 149 IRENTEGEYSGIEHVVTPG-----VVQSIKLITRDASERV----IRYAYEYARAIGRPRV 199

Query: 198 TVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLFKEPHCFD--VV 255
            V HKS +    DGLF +V +E+     + Y  I+   +++D+ V  +   P  +   V 
Sbjct: 200 IVVHKSTIQRLADGLFVDVAKEL----SQEYPDIQLETELIDNTVLNVVSNPSSYSNAVS 255

Query: 256 VAPNLYGDLLSDGAAAL-VGSLGLVPSVNVGNNIIIGEPCHGSAPDIAGRGIANPIATIR 314
           V PNLYGD+LSD  + L  GSLGL PS N+G+ + I E  HGSAPDIAG+  ANP A + 
Sbjct: 256 VCPNLYGDILSDLNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAPDIAGQNKANPTALLL 315

Query: 315 SVSLMLQFLGLEEAASDIDQAVTGNLKD-RQVVSPDLGGKNTTQEVLDDILARI 367
           S  +ML  +GL   A  I++AV   +    +  + DL GK TT    D ++ R+
Sbjct: 316 SSVMMLNHMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKATTSSFTDAVIGRL 369

>AFR137C Chr6 complement(685586..686689) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR136W
           (IDH2)
          Length = 367

 Score =  180 bits (456), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 124/354 (35%), Positives = 188/354 (53%), Gaps = 30/354 (8%)

Query: 22  TIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLDAGWQTFLETG-NALPGATVEA 80
           T+  I GDG+G E+  + + +  A      +   +E+ D      L  G   +P   V +
Sbjct: 36  TVSFIEGDGVGPEISQSVKDIFSAA----SVPVEWEYCDV--TPLLVNGLTTIPEPAVAS 89

Query: 81  LRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANIRPVKSVSG---TGQPVDLVI 137
           + +    AL G + +P  K  G+ S  + LR+  GL+AN+RP KS+ G   T   VDLV+
Sbjct: 90  INKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGYKTTYSDVDLVL 146

Query: 138 VRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLALQRQRMGGRGAL 197
           +RENTE  Y     + ++      V ++IK I+  A+ER+    +R A +  R  GR  +
Sbjct: 147 IRENTEGEY-----SGIEHVVSPGVVQSIKLITREASERV----IRYAFEYARTVGRPKV 197

Query: 198 TVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLFKEPHCFDVVVA 257
            V HKS +    DGLF  V +E+     + Y  IE   +++D+ V  +  +P  +  VVA
Sbjct: 198 VVVHKSTIQRLADGLFVNVAQEL----GREYPDIELQTELLDNTVLNVVTKPEAYKDVVA 253

Query: 258 --PNLYGDLLSDGAAAL-VGSLGLVPSVNVGNNIIIGEPCHGSAPDIAGRGIANPIATIR 314
             PNLYGD+LSD  + L  GSLGL PS N+G+ + I E  HGSAPDIAG+  ANP A + 
Sbjct: 254 VCPNLYGDILSDLNSGLSAGSLGLTPSANIGHQVSIFEAVHGSAPDIAGQNRANPTALLL 313

Query: 315 SVSLMLQFLGLEEAASDIDQAVTGNL-KDRQVVSPDLGGKNTTQEVLDDILARI 367
           S  +ML  +GL E A  I++AV   +   R+  + DL G  +T    + ++ R+
Sbjct: 314 SSVMMLNHMGLHEHAGRIEKAVLSTIASSRENRTADLAGTASTSSFTNAVIERL 367

>Skud_15.300 Chr15 (534346..535455) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  179 bits (455), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 126/353 (35%), Positives = 183/353 (51%), Gaps = 28/353 (7%)

Query: 22  TIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLDAGWQTFLETGNALPGATVEAL 81
           T+  I GDGIG E+  + +++  A     ++   +E  D     F+     +P A V+++
Sbjct: 38  TVSFIEGDGIGPEISKSVKKIFNA----ANVPIEWESCDVN-PIFVNGLTTIPDAAVQSI 92

Query: 82  RERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANIRPVKSVSG---TGQPVDLVIV 138
                 AL G + +P  K  G+ S  + LR+  GL+AN+RP KSV G   T + VDLV++
Sbjct: 93  TNNLI-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLI 149

Query: 139 RENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLALQRQRMGGRGALT 198
           RENTE  Y   E           V ++IK I+  A+ER+    +R A +  R  GR  + 
Sbjct: 150 RENTEGEYSGIEHIVCPG-----VVQSIKLITRDASERV----IRYAFEYARAIGRPRVI 200

Query: 199 VTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLFKEPHCFD--VVV 256
           V HKS +    DGLF  V +E+     K Y  I    +++D+ V ++   P  +   V V
Sbjct: 201 VVHKSTIQRLADGLFVNVAKEL----SKEYPDIILETELIDNSVLKVVTNPSAYTNAVSV 256

Query: 257 APNLYGDLLSDGAAAL-VGSLGLVPSVNVGNNIIIGEPCHGSAPDIAGRGIANPIATIRS 315
            PNLYGD+LSD  + L  GSLGL PS N+G+ I I E  HGSAPDIAG+  ANP A + S
Sbjct: 257 CPNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFEAVHGSAPDIAGQDKANPTALLLS 316

Query: 316 VSLMLQFLGLEEAASDIDQAVTGNLKD-RQVVSPDLGGKNTTQEVLDDILARI 367
             +ML  +GL   A  I  AV   +    +  + DL G  TT    + ++ R+
Sbjct: 317 SVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369

>NCAS0B06290 Chr2 complement(1186838..1187917) [1080 bp, 359 aa]
           {ON} Anc_2.278
          Length = 359

 Score =  179 bits (454), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 125/351 (35%), Positives = 191/351 (54%), Gaps = 27/351 (7%)

Query: 21  LTIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLDAGWQTFLETGNALPGATVEA 80
           +T+ L+PGDG+GKE+  +   + +A     ++   +E +D   Q   E G     A VE+
Sbjct: 29  MTVTLLPGDGVGKEITDSVVSIFQA----ENVPIDWETVDIS-QLDHEDG---VNAAVES 80

Query: 81  LRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANIRPVKSVSG--TGQP-VDLVI 137
           L+ R +  L G   +   +V G+ S  VA R+QL +YAN+   KS+ G  T  P VDLVI
Sbjct: 81  LK-RNKIGLKGIWHTSADQV-GHGSLNVAFRKQLDIYANVAFCKSIPGVKTKIPNVDLVI 138

Query: 138 VRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLALQRQRMGGRGAL 197
           +RENTE  Y   E   V       V E++K +++  +ERIA+ +   A++  R      +
Sbjct: 139 IRENTEGEYSGLEHESVPG-----VVESLKIVTKVNSERIAKFAFDFAMRHDRK----MV 189

Query: 198 TVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLFKEPHCFDVVVA 257
           T  HK+N++  +DGLF+     V EA    Y  I+ +  IVD+   +   +PH FDV+V 
Sbjct: 190 TAVHKANIMKLSDGLFRNTVARVGEA----YPQIKNDSIIVDNASMQAVAKPHQFDVMVT 245

Query: 258 PNLYGDLLSDGAAALVGSLGLVPSVNVGNNIIIGEP-CHGSAPDIAGRGIANPIATIRSV 316
           P++YG +L +  AAL+G  GLVP VN G    + EP       DI G+ +ANP A I S 
Sbjct: 246 PSMYGTILGNIGAALIGGPGLVPGVNYGREYAVFEPGSRHVGLDIKGQNVANPTAMILSS 305

Query: 317 SLMLQFLGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNTTQEVLDDILARI 367
           +L+LQ LGL + AS I +AV   +K+    + D+GG  +T E    ++ ++
Sbjct: 306 TLLLQHLGLNDTASRISKAVYDVIKEGNATTKDIGGNASTTEFTKAVIDKL 356

>KNAG0B04070 Chr2 complement(778658..779779) [1122 bp, 373 aa] {ON}
           Anc_5.473 YOR136W
          Length = 373

 Score =  179 bits (455), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 130/366 (35%), Positives = 192/366 (52%), Gaps = 35/366 (9%)

Query: 12  KATYATSKTLTIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLDAGWQTFLETGN 71
           K   AT K   +  I GDGIG E+     + ++ I K  ++  ++E  D     F+    
Sbjct: 33  KPNPATGK-FDVSFIEGDGIGPEI----SQSVKDIFKAAEVPINWEFCDV-TPIFVNGLT 86

Query: 72  ALPGATVEALRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANIRPVKSVSG--- 128
            +P   V ++ +    AL G + +P  K  G+ S  + LR+   L+AN+RP KS+ G   
Sbjct: 87  TIPDPAVASINKNLI-ALKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSIEGFKT 143

Query: 129 TGQPVDLVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLALQR 188
           T   VDLV++RENTE  Y     + ++      V ++IK I+  A+ER+    +R A + 
Sbjct: 144 TYSDVDLVLIRENTEGEY-----SGIEHVVAPGVVQSIKLITRDASERV----IRYAFEY 194

Query: 189 QRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLFKE 248
            +  GR  + V HKS +    DGLF  V +E+     K Y  I+   +++D+ V  +   
Sbjct: 195 AKAIGRPRVVVVHKSTIQRLADGLFVNVAKEL----SKEYPEIKLETELIDNTVLNVVSN 250

Query: 249 PHCFD--VVVAPNLYGDLLSDGAAAL-VGSLGLVPSVNVGNNIIIGEPCHGSAPDIAGRG 305
           P  +   V V PNLYGD+LSD  + L  GSLGL PS N+GN I I E  HGSAPDIAG+ 
Sbjct: 251 PAGYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGNEISIFEAVHGSAPDIAGQN 310

Query: 306 IANPIATIRSVSLMLQFLGLEEAASDIDQAVTGNL----KDRQVVSPDLGGKNTTQEVLD 361
            ANP A + S  +ML  +GL + AS I++AV   +    K+R   + DLGG  TT    D
Sbjct: 311 KANPTALLLSSVMMLNHMGLVDQASRIERAVLTTIASSSKNR---TGDLGGSATTSSFTD 367

Query: 362 DILARI 367
            ++  +
Sbjct: 368 AVIKNL 373

>Smik_15.316 Chr15 (541618..542727) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  179 bits (454), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 125/353 (35%), Positives = 183/353 (51%), Gaps = 28/353 (7%)

Query: 22  TIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLDAGWQTFLETGNALPGATVEAL 81
           T+  I GDGIG E+  + +++  A     ++   +E  D     F+     +P   V+++
Sbjct: 38  TVSFIEGDGIGPEISKSVKKIFSA----ANVPIEWEFCDVN-PIFVNGLTTIPDPAVQSI 92

Query: 82  RERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANIRPVKSVSG---TGQPVDLVIV 138
            +    AL G + +P  K  G+ S  + LR+  GL+AN+RP KSV G   T + VDLV++
Sbjct: 93  TKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLI 149

Query: 139 RENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLALQRQRMGGRGALT 198
           RENTE  Y   E           V ++IK I+  A+ER+    +R A +  R  GR  + 
Sbjct: 150 RENTEGEYSGIEHIVCPG-----VVQSIKLITRDASERV----IRYAFEYARAIGRPRVI 200

Query: 199 VTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLFKEPHCFD--VVV 256
           V HKS +    DGLF  V +E+     K Y  I    +++D+ V ++   P  +   V V
Sbjct: 201 VVHKSTIQRLADGLFVNVAKEL----SKEYPDITLETELIDNSVLKVVTNPSAYTNAVSV 256

Query: 257 APNLYGDLLSDGAAAL-VGSLGLVPSVNVGNNIIIGEPCHGSAPDIAGRGIANPIATIRS 315
            PNLYGD+LSD  + L  GSLGL PS N+G+ I I E  HGSAPDIAG+  ANP A + S
Sbjct: 257 CPNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFEAVHGSAPDIAGQDKANPTALLLS 316

Query: 316 VSLMLQFLGLEEAASDIDQAVTGNLKD-RQVVSPDLGGKNTTQEVLDDILARI 367
             +ML  +GL   A  I  AV   +    +  + DL G  TT    + ++ R+
Sbjct: 317 SVMMLNHMGLTNYADQIQNAVLSTIASGPENRTGDLAGAATTSSFTEAVIKRL 369

>Kpol_440.12 s440 (32084..33190) [1107 bp, 368 aa] {ON}
           (32084..33190) [1107 nt, 369 aa]
          Length = 368

 Score =  179 bits (454), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 121/353 (34%), Positives = 186/353 (52%), Gaps = 28/353 (7%)

Query: 22  TIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLDAGWQTFLETGNALPGATVEAL 81
           T+  I GDG+G E+     + ++ I     +   +E  D G   F+     +P A V+++
Sbjct: 37  TVPFIEGDGVGPEI----SKSVKDIFAAAKVPIEWEPCDVG-PIFVNGLTTIPDAAVQSI 91

Query: 82  RERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANIRPVKSVSG---TGQPVDLVIV 138
            +    AL G + +P  K  G+ S  + LR+   L+AN+RP +SV     T Q VDLV++
Sbjct: 92  NKHLV-ALKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPARSVPNYKTTYQNVDLVLI 148

Query: 139 RENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLALQRQRMGGRGALT 198
           RENTE  Y     + ++      V ++IK I++ A+ER+    +R A +  R  GR  L 
Sbjct: 149 RENTEGEY-----SGIEHVISPGVIQSIKLITKDASERV----IRYAFEYTRAIGRPRLV 199

Query: 199 VTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLFKEPHCFD--VVV 256
           V HKS +    DGLF  V +E+       Y  IE   +++D+ +  +   P  +   V V
Sbjct: 200 VVHKSTIQRMADGLFVNVAKEL----ASEYPDIELQTELIDNTILNVVTHPESYTDAVSV 255

Query: 257 APNLYGDLLSDGAAAL-VGSLGLVPSVNVGNNIIIGEPCHGSAPDIAGRGIANPIATIRS 315
            PNLYGD+LSD  + L  GSLGL PS N+G+ + I E  HGSAPDIAG+  ANP A + S
Sbjct: 256 CPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGSAPDIAGQNKANPTALLLS 315

Query: 316 VSLMLQFLGLEEAASDIDQAVTGNLKD-RQVVSPDLGGKNTTQEVLDDILARI 367
             +ML  +GL E A+ I+ A+   +    +  + DL G  TT    + ++ ++
Sbjct: 316 SVMMLNHMGLNEHATKIENAILSTIASGSENRTGDLAGTATTSSFTEAVINKL 368

>Skud_14.293 Chr14 (538202..539287) [1086 bp, 361 aa] {ON} YNL037C
           (REAL)
          Length = 361

 Score =  179 bits (453), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 120/354 (33%), Positives = 191/354 (53%), Gaps = 32/354 (9%)

Query: 21  LTIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLDAGWQTF-LETGNALPGA--T 77
            T+ LIPGDG+GKE+  + + + EA           E +   W+T  ++  +   G    
Sbjct: 29  FTVTLIPGDGVGKEITDSVRTIFEA-----------ERIPVDWETINIKQTDHKEGVYEA 77

Query: 78  VEALRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANIRPVKSVSG--TGQP-VD 134
           VE+L+ R +  L G   +P  +  G+ S  VALR+QL +YAN+   KS+ G  T  P +D
Sbjct: 78  VESLK-RNKIGLKGLWHTPADQT-GHGSLNVALRKQLDIYANVALFKSLKGVKTRIPDID 135

Query: 135 LVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLALQRQRMGGR 194
           L+++RENTE  +   E   V       V E++K +++P TERIA    R A    +   R
Sbjct: 136 LIVIRENTEGEFSGLEHESVPG-----VVESLKVMTKPKTERIA----RFAFDFAKKYNR 186

Query: 195 GALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLFKEPHCFDV 254
            A+T  HK+N++   DGLF+ +  E+    +  Y  I+ +  IVD+   +   +PH FDV
Sbjct: 187 KAVTAVHKANIMKLGDGLFRNIITEI---GQTEYPDIDVSSIIVDNASMQAVAKPHQFDV 243

Query: 255 VVAPNLYGDLLSDGAAALVGSLGLVPSVNVGNNIIIGEP-CHGSAPDIAGRGIANPIATI 313
           +V P++YG +L +  AAL+G  GLV   N G +  + EP       DI G+ +ANP A I
Sbjct: 244 LVTPSMYGTILGNIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLDIKGQNVANPTAMI 303

Query: 314 RSVSLMLQFLGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNTTQEVLDDILARI 367
            S  LML  LGL E A+ I +AV   + + +  + D+GG ++T +  ++++ ++
Sbjct: 304 LSSVLMLNHLGLNENATRISKAVHETIAEGKHTTRDIGGSSSTTDFTNEVINKL 357

>SAKL0G03520g Chr7 (290768..291877) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 369

 Score =  178 bits (451), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 122/353 (34%), Positives = 187/353 (52%), Gaps = 28/353 (7%)

Query: 22  TIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLDAGWQTFLETGNALPGATVEAL 81
           T+  I GDG+G E+     + ++ I    ++   +E  D     F+     +P   V+++
Sbjct: 38  TVSFIEGDGVGPEI----SKSVKDIFAAAEVPVEWESCDV-TPLFINGLTTIPQPAVDSI 92

Query: 82  RERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANIRPVKSVSG---TGQPVDLVIV 138
            +    AL G + +P  K  G+ S  + LR+  GL+AN+RP KSV G   T + VDLV++
Sbjct: 93  NKNLI-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLI 149

Query: 139 RENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLALQRQRMGGRGALT 198
           RENTE  Y     + ++      V ++IK I+  A+ER+    +R A +  R  GR  + 
Sbjct: 150 RENTEGEY-----SGIEHVVSPGVVQSIKLITRDASERV----IRYAFEYARAVGRPKVM 200

Query: 199 VTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLFKEPHCF--DVVV 256
           V HKS +    DGLF +V +E+       Y  I+   Q++D+ V  +   P  +   V V
Sbjct: 201 VVHKSTIQRLADGLFVDVAKEL----SSEYPDIQLQLQLLDNTVLNVVSNPGAYADTVSV 256

Query: 257 APNLYGDLLSDGAAAL-VGSLGLVPSVNVGNNIIIGEPCHGSAPDIAGRGIANPIATIRS 315
            PNLYGD+LSD  + L  GSLGL PS N+G+ + I E  HGSAPDIAG+  ANP A + S
Sbjct: 257 CPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAPDIAGQNKANPTALLLS 316

Query: 316 VSLMLQFLGLEEAASDIDQAVTGNLKD-RQVVSPDLGGKNTTQEVLDDILARI 367
             +ML  +GL E A  I++AV   +    +  + DL G  +T    + ++ R+
Sbjct: 317 SVMMLNHMGLYEKADSIEKAVLSTIASGPENRTADLAGSASTSSFTEAVIKRL 369

>YOR136W Chr15 (580250..581359) [1110 bp, 369 aa] {ON}  IDH2Subunit
           of mitochondrial NAD(+)-dependent isocitrate
           dehydrogenase, which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle;
           phosphorylated
          Length = 369

 Score =  177 bits (450), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 123/353 (34%), Positives = 183/353 (51%), Gaps = 28/353 (7%)

Query: 22  TIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLDAGWQTFLETGNALPGATVEAL 81
           T+  I GDGIG E+  + +++  A     ++   +E  D     F+     +P   V+++
Sbjct: 38  TVSFIEGDGIGPEISKSVKKIFSA----ANVPIEWESCDVS-PIFVNGLTTIPDPAVQSI 92

Query: 82  RERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANIRPVKSVSG---TGQPVDLVIV 138
            +    AL G + +P  K  G+ S  + LR+  GL+AN+RP KS+ G   T + VDLV++
Sbjct: 93  TKNLV-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLI 149

Query: 139 RENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLALQRQRMGGRGALT 198
           RENTE  Y   E           V ++IK I+  A+ER+    +R A +  R  GR  + 
Sbjct: 150 RENTEGEYSGIEHIVCPG-----VVQSIKLITRDASERV----IRYAFEYARAIGRPRVI 200

Query: 199 VTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLFKEPHCFD--VVV 256
           V HKS +    DGLF  V +E+     K Y  +    +++D+ V ++   P  +   V V
Sbjct: 201 VVHKSTIQRLADGLFVNVAKEL----SKEYPDLTLETELIDNSVLKVVTNPSAYTDAVSV 256

Query: 257 APNLYGDLLSDGAAAL-VGSLGLVPSVNVGNNIIIGEPCHGSAPDIAGRGIANPIATIRS 315
            PNLYGD+LSD  + L  GSLGL PS N+G+ I I E  HGSAPDIAG+  ANP A + S
Sbjct: 257 CPNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFEAVHGSAPDIAGQDKANPTALLLS 316

Query: 316 VSLMLQFLGLEEAASDIDQAVTGNLKD-RQVVSPDLGGKNTTQEVLDDILARI 367
             +ML  +GL   A  I  AV   +    +  + DL G  TT    + ++ R+
Sbjct: 317 SVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTATTSSFTEAVIKRL 369

>TBLA0B02240 Chr2 complement(524111..525232) [1122 bp, 373 aa] {ON}
           Anc_5.473 YOR136W
          Length = 373

 Score =  177 bits (450), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 117/354 (33%), Positives = 188/354 (53%), Gaps = 28/354 (7%)

Query: 21  LTIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLDAGWQTFLETGNALPGATVEA 80
            T+  I GDG+G E+     + ++ I K   +   +E+ D      +     +P   V+ 
Sbjct: 41  FTVPFIEGDGVGPEI----SKSVKDIFKAAQVPVDWEYCDVS-PLLINGLTTIPEPAVQQ 95

Query: 81  LRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANIRPVKSVSG---TGQPVDLVI 137
           + +  + AL G + +P  K  G+ S  + LR+  GL+AN+RP +S+ G   T + VDLV+
Sbjct: 96  INKH-KIALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPARSIRGYETTYKNVDLVL 152

Query: 138 VRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLALQRQRMGGRGAL 197
           +RENTE  Y     + ++      V ++IK I+  A+ER+    +R A +  R  GR  L
Sbjct: 153 IRENTEGEY-----SGIEHVVAPGVVQSIKLITRDASERV----IRYAYEYARAIGRPRL 203

Query: 198 TVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLFKEPHCFD--VV 255
            V HKS +    DGLF  + +E+       +  I+   +++D+ V  + ++P  +   V 
Sbjct: 204 VVVHKSTIQKLADGLFVNIAKEL----APEFPDIKLETELIDNTVLNVVRDPPSYTDAVT 259

Query: 256 VAPNLYGDLLSDGAAAL-VGSLGLVPSVNVGNNIIIGEPCHGSAPDIAGRGIANPIATIR 314
           V PNLYGD+LSD  + L  GSLGL PS N+GN + I E  HGSAPDIAG+  ANP A + 
Sbjct: 260 VCPNLYGDILSDLNSGLSAGSLGLTPSANIGNEVSIFEAVHGSAPDIAGQNKANPTALLL 319

Query: 315 SVSLMLQFLGLEEAASDIDQAVTGNLKD-RQVVSPDLGGKNTTQEVLDDILARI 367
           S  +ML ++GLE  ++ I+ A+   +    +  + DL G  TT    + ++  +
Sbjct: 320 SSCMMLNYMGLESYSNKIENAILNTIASGSENRTGDLAGTATTSSFTESVIKNL 373

>NDAI0B03590 Chr2 complement(901108..902187) [1080 bp, 359 aa] {ON}
           Anc_2.278
          Length = 359

 Score =  177 bits (448), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 119/351 (33%), Positives = 191/351 (54%), Gaps = 26/351 (7%)

Query: 21  LTIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLDAGWQTFLETGNALPGATVEA 80
            T+ L+PGDG+GKE+  +    + +I K  ++   +E +D       E   A     V++
Sbjct: 28  FTVTLLPGDGVGKEITDS----VVSIFKSENVPIDWETVDISGLDHTEGVKA----AVDS 79

Query: 81  LRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANIRPVKSVSG--TGQP-VDLVI 137
           L+ R +  L G   +P  +V G+ S  VA R+QL +YAN+   KS+ G  T  P VDLV+
Sbjct: 80  LK-RNKIGLKGIWHTPADQV-GHGSLNVAFRKQLDIYANVAIFKSIEGVKTKIPNVDLVV 137

Query: 138 VRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLALQRQRMGGRGAL 197
           +RENTE  Y   E   V       V E++K I++  +ERIA    R A    +   R ++
Sbjct: 138 IRENTEGEYSGLEHESVPG-----VVESLKIITKSKSERIA----RFAFDFAKRNNRKSV 188

Query: 198 TVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLFKEPHCFDVVVA 257
           T  HK+N++  +DGLF+    ++ E   + Y  I+ +  IVD+   +   +PH FDV+V 
Sbjct: 189 TAVHKANIMKLSDGLFRNTVSKIGE---EEYPEIQTSSIIVDNASMQAVAKPHQFDVMVT 245

Query: 258 PNLYGDLLSDGAAALVGSLGLVPSVNVGNNIIIGEP-CHGSAPDIAGRGIANPIATIRSV 316
           P++YG ++ +  AAL+G  GLVP VN G +  + EP       DI G+ +ANP A + S 
Sbjct: 246 PSMYGTIVGNIGAALIGGPGLVPGVNYGRDYAVFEPGSRHVGLDIKGQNVANPTAMLLSA 305

Query: 317 SLMLQFLGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNTTQEVLDDILARI 367
           +L+L  LGLE++A+ I  AV   + + +  + D+GG  +T E    ++ ++
Sbjct: 306 TLLLDHLGLEKSANRIKSAVYDVIAEGKATTQDIGGSASTTEFTQAVINKL 356

>KLTH0F15048g Chr6 complement(1232566..1233672) [1107 bp, 368 aa]
           {ON} highly similar to uniprot|P28241 Saccharomyces
           cerevisiae YOR136W IDH2 Subunit of mitochondrial NAD( )-
           dependent isocitrate dehydrogenase which catalyzes the
           oxidation of isocitrate to alpha-ketoglutarate in the
           TCA cycle
          Length = 368

 Score =  176 bits (446), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 124/353 (35%), Positives = 188/353 (53%), Gaps = 28/353 (7%)

Query: 22  TIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLDAGWQTFLETGNALPGATVEAL 81
           T+  I GDG+G E+  A + +  A   K  I+  +E  D     F+     +P    +++
Sbjct: 37  TVSFIEGDGVGPEISKAVKDIFAA--AKAPIQ--WESCDVS-PLFINGLTTIPQPAQDSI 91

Query: 82  RERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANIRPVKSVSGTGQP---VDLVIV 138
            +    AL G + +P  K  G+ S  + LR+  GL+AN+RP KSV G       VDLV++
Sbjct: 92  NKNLI-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSVQGYKTAYDNVDLVLI 148

Query: 139 RENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLALQRQRMGGRGALT 198
           RENTE  Y     + ++      V ++IK I++ A+ER+    +R A +  R   R  + 
Sbjct: 149 RENTEGEY-----SGIEHVVSPGVVQSIKLITQDASERV----IRYAFEYARAVERPKVV 199

Query: 199 VTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLFKEPHCFD--VVV 256
           V HKS +    DGLF  V  ++     K Y  IE   +++D+ V    ++P  +   VVV
Sbjct: 200 VVHKSTIQRLADGLFVSVAEQL----SKEYPDIELQTELIDNTVLHTVRDPTKYSDVVVV 255

Query: 257 APNLYGDLLSDGAAAL-VGSLGLVPSVNVGNNIIIGEPCHGSAPDIAGRGIANPIATIRS 315
            PNLYGD+LSD  + L  GSLGL PS N+G+ + I E  HGSAPDIAG+  ANP A + S
Sbjct: 256 CPNLYGDILSDMNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAPDIAGQNKANPTALLLS 315

Query: 316 VSLMLQFLGLEEAASDIDQAVTGNL-KDRQVVSPDLGGKNTTQEVLDDILARI 367
             +ML  +GL E A  I++AV   +    +  + DLGG  +T    + +++R+
Sbjct: 316 SVMMLNHMGLTEHADKIEKAVFTTIAAGPESRTGDLGGSASTSSFAEAVISRL 368

>Kwal_23.5012 s23 (964254..965339) [1086 bp, 361 aa] {ON} YNL037C
           (IDH1) - alpha-4-beta-4 subunit of mitochondrial
           isocitrate dehydrogenase 1 [contig 7] FULL
          Length = 361

 Score =  175 bits (444), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 121/354 (34%), Positives = 184/354 (51%), Gaps = 34/354 (9%)

Query: 22  TIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLDAGWQTF----LETGNALPGAT 77
           T+ LIPGDG+GKEV  +   + E+           E++   W+T     L+    +  A 
Sbjct: 31  TVTLIPGDGVGKEVTDSVVSIFES-----------ENIPIDWETVEISGLDNQEGVQKA- 78

Query: 78  VEALRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANIRPVKSVSGT---GQPVD 134
           VE+L+ R +  L G   +P+ +  G+ S  VALR+QL ++AN+   KSV G       VD
Sbjct: 79  VESLK-RNKVGLKGIWHTPSDQT-GHGSLNVALRKQLDIFANVALFKSVPGVPSRHSNVD 136

Query: 135 LVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLALQRQRMGGR 194
           +V++RENTE  Y   E   V       V E++K +++  +ERI   +   A++  R    
Sbjct: 137 MVVIRENTEGEYSGLEHESVPG-----VVESLKIMTKAKSERIGRFAFDFAVKNNRK--- 188

Query: 195 GALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLFKEPHCFDV 254
            ++   HK+N++   DGLF+    EV     K Y  I+    IVD+   +   +PH FDV
Sbjct: 189 -SVCAVHKANIMKLGDGLFRNCINEV---GAKEYPEIDVKNIIVDNASMQAVAKPHQFDV 244

Query: 255 VVAPNLYGDLLSDGAAALVGSLGLVPSVNVGNNIIIGEP-CHGSAPDIAGRGIANPIATI 313
           +V PNLYG +L +  AAL+G  GLVP  N G    + EP       DI G+ +ANP A I
Sbjct: 245 LVTPNLYGSILGNIGAALIGGPGLVPGANFGREYAVFEPGSRHVGLDIKGQNVANPTAMI 304

Query: 314 RSVSLMLQFLGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNTTQEVLDDILARI 367
            S SLML+ LGL   A  I +A    + + +  + D+GG  +T E  + I++++
Sbjct: 305 LSSSLMLRHLGLNAYADRISKATYDVIAEAKTTTQDIGGSASTTEFTEAIISKL 358

>Kpol_543.8 s543 (21411..22517) [1107 bp, 368 aa] {ON}
           (21411..22517) [1107 nt, 369 aa]
          Length = 368

 Score =  174 bits (442), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 124/363 (34%), Positives = 188/363 (51%), Gaps = 29/363 (7%)

Query: 12  KATYATSKTLTIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLDAGWQTFLETGN 71
           K   AT K  T+  I GDG+G E+  + +++  A      +   +   D G   F+    
Sbjct: 28  KPDPATGK-FTVPFIEGDGVGPEISESVKKIFSA----AKVPIEWVPCDVG-PIFVNGQT 81

Query: 72  ALPGATVEALRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANIRPVKSV---SG 128
            +P   VE + +    AL G + +P  K  G+ S  + LR+   L+AN+RP +S+     
Sbjct: 82  TIPEPAVELINKHLI-ALKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPARSIPNYKS 138

Query: 129 TGQPVDLVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLALQR 188
           T + VDLV++RENTE  Y   E           V ++IK I+  ATER+    +R A + 
Sbjct: 139 TYENVDLVLIRENTEGEYSGIEHVITPG-----VIQSIKLITREATERV----VRYAFEY 189

Query: 189 QRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLFKE 248
            +  GR  L V HKS +    DGLF +V  E+       Y  I+   +I+D  +  +  +
Sbjct: 190 TQAIGRPRLLVIHKSTIQRMADGLFVKVAEEL----ASEYPDIKLETEIIDKSILNVVSK 245

Query: 249 PHCFD--VVVAPNLYGDLLSDGAAAL-VGSLGLVPSVNVGNNIIIGEPCHGSAPDIAGRG 305
           P  +   V V PNLYGD+LSD  + L  GSLGL PS N+G+ + I E  HGSAPDIAG+ 
Sbjct: 246 PELYSDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGSAPDIAGQN 305

Query: 306 IANPIATIRSVSLMLQFLGLEEAASDIDQAVTGNLKD-RQVVSPDLGGKNTTQEVLDDIL 364
            ANP A + S  +ML+ +GL+E A+ I+ AV   +    +  + DL G  +T    ++++
Sbjct: 306 KANPTALLLSSVMMLKHMGLDEHANKIENAVLTTIASGSENRTADLSGTASTSSFTEEVI 365

Query: 365 ARI 367
            R+
Sbjct: 366 QRL 368

>SAKL0E07876g Chr5 complement(635705..636790) [1086 bp, 361 aa] {ON}
           highly similar to uniprot|P28834 Saccharomyces
           cerevisiae YNL037C IDH1 Subunit of mitochondrial NAD( )-
           dependent isocitrate dehydrogenase which catalyzes the
           oxidation of isocitrate to alpha-ketoglutarate in the
           TCA cycle
          Length = 361

 Score =  174 bits (440), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 126/370 (34%), Positives = 188/370 (50%), Gaps = 40/370 (10%)

Query: 13  ATYATSKTL--------TIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLDAGWQ 64
           AT AT + L        T+ LIPGDG+GKEV  +   + EA           E++   W+
Sbjct: 14  ATVATEQLLPKKYGGRYTVTLIPGDGVGKEVTDSVVSIFEA-----------ENVPIDWE 62

Query: 65  TFLETG-NALPGA--TVEALRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANIR 121
           T   TG ++  G    VE+L+ R +  L G   +P  +  G+ S  VA R+QL ++AN+ 
Sbjct: 63  TINITGVDSEEGVQKAVESLK-RNKIGLKGIWHTPADQT-GHGSLNVAFRKQLDIFANVA 120

Query: 122 PVKSVSGTGQP---VDLVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIA 178
             K+V G       +DLV++RENTE  Y   E   V       V E++K I++  +ERIA
Sbjct: 121 LFKNVPGVKTKLSNIDLVVIRENTEGEYSGLEHESVPG-----VVESLKIITKAKSERIA 175

Query: 179 EISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIV 238
             +   AL+  R     ++   HK+N++   DGLF+    EV       Y  I+    IV
Sbjct: 176 RFAFDFALKNNRK----SVCAVHKANIMKLGDGLFRNTVNEV---GASEYPEIDVKNIIV 228

Query: 239 DSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNVGNNIIIGEP-CHGS 297
           D+   +   +PH FDV+V PNLYG +L +  AAL+G  GLVP  N G    + EP     
Sbjct: 229 DNASMQAVAKPHQFDVLVTPNLYGSILGNIGAALIGGPGLVPGANFGREYAVFEPGSRHV 288

Query: 298 APDIAGRGIANPIATIRSVSLMLQFLGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNTTQ 357
             DI G+ +ANP A I S +LML+ LGL   A  I +A    + + +  + D+GG ++T 
Sbjct: 289 GLDIKGKDLANPTAMILSSTLMLRHLGLNGYADRISKATYDVIAEGKHTTKDIGGSSSTT 348

Query: 358 EVLDDILARI 367
           E    ++ ++
Sbjct: 349 EFTKSVIDKL 358

>Ecym_3316 Chr3 (608744..609832) [1089 bp, 362 aa] {ON} similar to
           Ashbya gossypii ADL223W
          Length = 362

 Score =  173 bits (439), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 121/354 (34%), Positives = 181/354 (51%), Gaps = 33/354 (9%)

Query: 22  TIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLDAGWQTF----LETGNALPGAT 77
           T+ LIPGDG+GKEV  +   + EA           E++   W++     LE         
Sbjct: 31  TVTLIPGDGVGKEVTDSVVNIFEA-----------ENVPIDWESVELSGLEENMEGVQKA 79

Query: 78  VEALRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANIRPVKSVSGTG---QPVD 134
           VE+L+ R +  L G   +P  +  G+ S  VA R+QL ++AN+   KS  G     + VD
Sbjct: 80  VESLK-RNKVGLKGIWSTPADQT-GHGSLNVAFRKQLDIFANVALFKSFPGVKTKLKDVD 137

Query: 135 LVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLALQRQRMGGR 194
           LVI+RENTE  Y   E   V       V E++K +++  +ERIA  +   AL+  R    
Sbjct: 138 LVIIRENTEGEYSGLEHESVPG-----VVESLKIMTKAKSERIARFAFDFALKNNRR--- 189

Query: 195 GALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLFKEPHCFDV 254
            ++   HK+N++   DGLF+    E+     K Y  +E    IVD+   +   +PH FDV
Sbjct: 190 -SVCAVHKANIMKLGDGLFRNTVNEI---GAKEYPELEVKSIIVDNASMQAVAKPHQFDV 245

Query: 255 VVAPNLYGDLLSDGAAALVGSLGLVPSVNVGNNIIIGEP-CHGSAPDIAGRGIANPIATI 313
           +V PNLYG +L +  AAL+GS GLVP  N G    + EP       DI G+ +ANP A I
Sbjct: 246 LVTPNLYGSILGNVGAALIGSPGLVPGANFGREYAVFEPGSRHVGLDIKGQDVANPTAMI 305

Query: 314 RSVSLMLQFLGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNTTQEVLDDILARI 367
            S +LML+ LGL + A  I +A    + + +  + D+GG  +T +    I+ ++
Sbjct: 306 LSSTLMLRHLGLNDYADRISKATYEVIAEGKHTTKDIGGHASTTQFTKAIVDKL 359

>TDEL0A03370 Chr1 (599855..600970) [1116 bp, 371 aa] {ON} Anc_5.473
           YOR136W
          Length = 371

 Score =  172 bits (437), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 128/358 (35%), Positives = 188/358 (52%), Gaps = 38/358 (10%)

Query: 22  TIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLDAGWQTFLETGNALPGATV--E 79
           T+  I GDG+G E+  + + +           F+   +   W++   T   + G T   E
Sbjct: 40  TVSFIEGDGVGPEISKSVKDI-----------FAAAKVPIVWESCPVTPLLVNGVTTIPE 88

Query: 80  ALRE---RCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANIRPVKSVSG---TGQPV 133
             +E   R   AL G + +P  K  G+ S  + LR+  GL+AN+RP KSV G   T + V
Sbjct: 89  QAQESINRNLVALKGPLATPIGK--GHRSMNLTLRKTFGLFANVRPAKSVEGFKTTYEDV 146

Query: 134 DLVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLALQRQRMGG 193
           DLV++RENTE  Y   E   V       V ++IK I+  A+ER+    +R A +  R  G
Sbjct: 147 DLVLIRENTEGEYAGIEHVIVPG-----VVQSIKLITREASERV----IRYAYEYARAVG 197

Query: 194 RGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLFKEPHCF- 252
           R  L V HKS +    DGLF  V +E+       +  I+   +++D+ V  +   P  + 
Sbjct: 198 RPKLVVVHKSTIQRLADGLFVTVAKEL----AHEFPDIQLQTELIDNTVLNVVSNPSKYS 253

Query: 253 DVV-VAPNLYGDLLSDGAAAL-VGSLGLVPSVNVGNNIIIGEPCHGSAPDIAGRGIANPI 310
           DVV V PNLYGD+LSD  + L  GSLGL PS N+G+ + I E  HGSAPDIAG+  ANP 
Sbjct: 254 DVVYVCPNLYGDILSDLNSGLSAGSLGLTPSGNIGHKVSIFEAVHGSAPDIAGQNKANPT 313

Query: 311 ATIRSVSLMLQFLGLEEAASDIDQAVTGNL-KDRQVVSPDLGGKNTTQEVLDDILARI 367
           A + S  +ML  +GL E AS I++AV   +    +  + DL G  +T    + +++R+
Sbjct: 314 ALLLSSVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSASTSSFTEAVISRL 371

>Kwal_55.21273 s55 complement(762121..763227) [1107 bp, 368 aa] {ON}
           YOR136W (IDH2) - NAD+-dependent isocitrate dehydrogenase
           [contig 130] FULL
          Length = 368

 Score =  172 bits (436), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 122/359 (33%), Positives = 187/359 (52%), Gaps = 40/359 (11%)

Query: 22  TIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLDAGWQT------FLETGNALPG 75
           T+  I GDG+G E+  A + +  A   K  I+         W+T      F+     +P 
Sbjct: 37  TVSFIEGDGVGPEISKAVKDIFAA--AKAPIQ---------WETCDVTPLFINGLTTIPQ 85

Query: 76  ATVEALRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANIRPVKSVSGTGQP--- 132
              +++ +    AL G + +P  K  G+ S  + LR+  GL+AN+RP KS+ G       
Sbjct: 86  PAQDSINKNLI-ALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIQGFKTAYDN 142

Query: 133 VDLVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLALQRQRMG 192
           VDLV++RENTE  Y     + ++      V ++IK I++ A+ER+    +R A +  R  
Sbjct: 143 VDLVLIRENTEGEY-----SGIEHVVAPGVVQSIKLITQDASERV----IRYAFEYARAV 193

Query: 193 GRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLFKEPHCF 252
            R  + V HKS +    DGLF  V  ++     K Y  IE   +++D+ V    ++P  +
Sbjct: 194 ERPKVLVVHKSTIQRLADGLFVSVAEKL----AKEYPDIELQTELIDNTVLHTVRDPLKY 249

Query: 253 D--VVVAPNLYGDLLSDGAAAL-VGSLGLVPSVNVGNNIIIGEPCHGSAPDIAGRGIANP 309
              VVV PNLYGD+LSD  + L  GSLGL PS N+G+ + I E  HGSAPDIAG+  ANP
Sbjct: 250 SDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAPDIAGQNKANP 309

Query: 310 IATIRSVSLMLQFLGLEEAASDIDQAVTGNLKD-RQVVSPDLGGKNTTQEVLDDILARI 367
            A + S  +ML  +GL E A  I++AV   +    +  + DL G  +T    + +++R+
Sbjct: 310 TALLLSSVMMLNHMGLTEHADKIEKAVFSTIASGPENRTGDLAGSASTSSFAEAVISRL 368

>KLLA0F04103g Chr6 (389159..390244) [1086 bp, 361 aa] {ON}
           uniprot|O94229 Kluyveromyces lactis KLLA0F04103g IDH1
           Isocitrate dehydrogenase subunit 1
          Length = 361

 Score =  171 bits (433), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 117/350 (33%), Positives = 182/350 (52%), Gaps = 26/350 (7%)

Query: 22  TIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLDAGWQTFLETGNALPGATVEAL 81
           T+ LIPGDG+GKEV  +  ++ E      +I   +E +D    + LE    +  A VE+L
Sbjct: 31  TVTLIPGDGVGKEVTDSVVKIFE----NENIPIDWETIDI---SGLENTENVQRA-VESL 82

Query: 82  RERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANIRPVKSVSGTG---QPVDLVIV 138
           + R +  L G   +P  +  G+ S  VALR+QL ++AN+   KS+ G       +D+VI+
Sbjct: 83  K-RNKVGLKGIWHTPADQT-GHGSLNVALRKQLDIFANVALFKSIPGVKTRLNNIDMVII 140

Query: 139 RENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLALQRQRMGGRGALT 198
           RENTE  Y   E   V       V E++K ++   +ERIA  +   AL+  R     ++ 
Sbjct: 141 RENTEGEYSGLEHESVPG-----VVESLKIMTRAKSERIARFAFDFALKNNRK----SVC 191

Query: 199 VTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLFKEPHCFDVVVAP 258
             HK+N++   DGLF+    E+       Y  ++    IVD+   +   +PH FDV+V P
Sbjct: 192 AVHKANIMKLGDGLFRNTVNEI---GANEYPELDVKNIIVDNASMQAVAKPHQFDVLVTP 248

Query: 259 NLYGDLLSDGAAALVGSLGLVPSVNVGNNIIIGEP-CHGSAPDIAGRGIANPIATIRSVS 317
           NLYG +L +  +AL+G  GLVP  N G    + EP       DI G+ +ANP A I S +
Sbjct: 249 NLYGSILGNIGSALIGGPGLVPGANFGREYAVFEPGSRHVGLDIKGQNVANPTAMILSST 308

Query: 318 LMLQFLGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNTTQEVLDDILARI 367
           LML+ LGL   A  I +A    + + +  + D+GG  +T E  + ++ ++
Sbjct: 309 LMLRHLGLNAYADRISKATYDVISEGKSTTRDIGGSASTSEFTNAVIEKL 358

>Kpol_1039.35 s1039 complement(108102..109181) [1080 bp, 359 aa]
           {ON} complement(108102..109181) [1080 nt, 360 aa]
          Length = 359

 Score =  170 bits (431), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 116/352 (32%), Positives = 180/352 (51%), Gaps = 31/352 (8%)

Query: 22  TIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLDAGWQTFLETG--NALPGATVE 79
           T+ L+PGDG+G+E+  +   + EA           E+L   W+    +G         VE
Sbjct: 30  TVTLLPGDGVGREITDSVVSIFEA-----------ENLPIDWERVELSGLEQEDVHTAVE 78

Query: 80  ALRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANIRPVKSVSGTGQ---PVDLV 136
           +L+    G     +   +   +G++S  VALR++L +YAN+   KS  G       VDLV
Sbjct: 79  SLKRNKIG--LKGIWHTSADHDGHTSWNVALRKELDIYANVAIFKSFKGVDTRIPDVDLV 136

Query: 137 IVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLALQRQRMGGRGA 196
           I+RENTE  Y   E   V       V E++K ++   TERIA  +   A++  R     +
Sbjct: 137 IIRENTEGEYSGLEHESVPG-----VVESLKIMTAQKTERIARFAFDYAMKYNRK----S 187

Query: 197 LTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLFKEPHCFDVVV 256
           +T  HK+N++   DGLF+ +  E+     K Y  +  +  IVD+   +   +PH FDV+V
Sbjct: 188 VTAVHKANIMKLGDGLFRNLVTEI---GAKEYPEVGVSSIIVDNASMQAVAKPHQFDVMV 244

Query: 257 APNLYGDLLSDGAAALVGSLGLVPSVNVGNNIIIGEP-CHGSAPDIAGRGIANPIATIRS 315
           AP++YG +L +  AAL+G  GLVP  N G +  + EP       DI  + IANP A I S
Sbjct: 245 APSMYGTILGNIGAALIGGPGLVPGANYGRDYAVFEPGSRHVGLDIENQNIANPTAMILS 304

Query: 316 VSLMLQFLGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNTTQEVLDDILARI 367
            +LML  LG    A+ I +AV   + + +  + D+GG  TT E  + ++A++
Sbjct: 305 ATLMLNHLGFRNDAARISKAVHEVIAEGKTTTRDIGGSATTTEFTNAVIAKL 356

>TDEL0C03840 Chr3 complement(673007..674092) [1086 bp, 361 aa] {ON}
           Anc_2.278 YNL037C
          Length = 361

 Score =  170 bits (431), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 123/351 (35%), Positives = 179/351 (50%), Gaps = 25/351 (7%)

Query: 21  LTIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLDAGWQTFLETGNALPGATVEA 80
             + LIPGDG+GKEV  +   + EA     ++   ++ +D       E   A     V++
Sbjct: 29  FVVTLIPGDGVGKEVTDSVVSIFEA----ENLPIDWDRVDISGLDHEEGVQA----AVDS 80

Query: 81  LRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANIRPVKSVSG--TGQP-VDLVI 137
           L+ R +  L G   +      G  S  VALR++L +YAN+   KSV G  T  P VDLV+
Sbjct: 81  LK-RNKIGLKGIWHTSAADQAGKGSLNVALRKELDIYANVALFKSVPGVKTKIPNVDLVV 139

Query: 138 VRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLALQRQRMGGRGAL 197
           +RENTE  Y   E   V       V E++K ++E  TERIA    R A    +   R A+
Sbjct: 140 IRENTEGEYSGLEHESVPG-----VVESLKIMTEDKTERIA----RFAFDFAKKYNRHAV 190

Query: 198 TVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLFKEPHCFDVVVA 257
           T  HK+N++   DGLF+ V   V E   + Y  ++    IVD+   +   +PH FDV+V 
Sbjct: 191 TAVHKANIMKLGDGLFRNVVTRVGE---QEYPDVKVGSIIVDNASMQTVAKPHQFDVLVT 247

Query: 258 PNLYGDLLSDGAAALVGSLGLVPSVNVGNNIIIGEP-CHGSAPDIAGRGIANPIATIRSV 316
           P++YG +L +  AAL+G  GLV   N G    + EP       DI  + IANP A I S 
Sbjct: 248 PSMYGTILGNIGAALIGGPGLVAGANYGREYAVFEPGSRHVGLDIKDKNIANPTAMILSA 307

Query: 317 SLMLQFLGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNTTQEVLDDILARI 367
           SLML  LGL  +A+ I  AV   + + +  +PD+GG  +T E    ++ ++
Sbjct: 308 SLMLDHLGLSTSATKISNAVHQVIAEGKSTTPDIGGSASTTEFTQAVIEKL 358

>KLTH0G10186g Chr7 (863151..864233) [1083 bp, 360 aa] {ON} highly
           similar to uniprot|P28834 Saccharomyces cerevisiae
           YNL037C IDH1 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 360

 Score =  169 bits (429), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 118/354 (33%), Positives = 182/354 (51%), Gaps = 34/354 (9%)

Query: 22  TIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLDAGWQTF----LETGNALPGAT 77
           T+ LIPGDG+GKEV  +   + E+           E++   W+T     L+    +  A 
Sbjct: 30  TVTLIPGDGVGKEVTDSVVSIFES-----------ENVPIDWETVEISGLDNEEGVQKA- 77

Query: 78  VEALRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANIRPVKSVSGT---GQPVD 134
           V++L+ R +  L G   +P+ +  G+ S  VALR+QL ++AN+   K+V G       VD
Sbjct: 78  VDSLK-RNKVGLKGIWHTPSDQT-GHGSLNVALRKQLDIFANVALFKTVPGVPSRHSNVD 135

Query: 135 LVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLALQRQRMGGR 194
           LV++RENTE  Y   E   V       V E++K +++  ++RI   +   AL+  R    
Sbjct: 136 LVVIRENTEGEYSGLEHESVPG-----VVESLKIMTKAKSDRIGRFAFDFALKNNRK--- 187

Query: 195 GALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLFKEPHCFDV 254
            ++   HK+N++   DGLF+    E+     K Y  IE    IVD+   +   +PH FDV
Sbjct: 188 -SVCAVHKANIMKLGDGLFRNCINEI---GAKEYPEIEVKNIIVDNASMQAVAKPHQFDV 243

Query: 255 VVAPNLYGDLLSDGAAALVGSLGLVPSVNVGNNIIIGEP-CHGSAPDIAGRGIANPIATI 313
           +V PNLYG +L +  AAL+G  GLVP  N G    + EP       DI G+ +ANP A I
Sbjct: 244 LVTPNLYGSILGNIGAALIGGPGLVPGANFGREFAVFEPGSRHVGLDIKGQNVANPTAMI 303

Query: 314 RSVSLMLQFLGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNTTQEVLDDILARI 367
            S +LML+ LGL   A  I +A    + + +  + D+GG  +T +    I+ ++
Sbjct: 304 LSSALMLRHLGLNSYADRISKATYDVIAEAKNTTKDIGGSASTTDFTQAIIEKL 357

>KNAG0A05280 Chr1 (780448..781533) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score =  168 bits (426), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 121/353 (34%), Positives = 178/353 (50%), Gaps = 31/353 (8%)

Query: 22  TIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLDAGWQTFLETG---NALPGATV 78
           T+ L+PGDG+GKE   +   V           F+ E++   W+    +G        A V
Sbjct: 28  TVTLLPGDGVGKECTDSVVSV-----------FNAENIPIDWEIVNISGLDHKEGVAAAV 76

Query: 79  EALRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANIRPVKSVSG--TGQP-VDL 135
           ++LR R +  L G   +      G+ S  VA R+QL +YAN+   KS+ G  T  P VDL
Sbjct: 77  QSLR-RNKIGLKGLWHTSNADQSGHGSLNVAFRKQLDIYANVAVFKSLKGVKTMIPDVDL 135

Query: 136 VIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLALQRQRMGGRG 195
           V++RENTE  +   E   V+      V E++K  + P TERIA    R A    +  GR 
Sbjct: 136 VVIRENTEGEFSGLEHESVEG-----VVESLKVTTLPKTERIA----RFAFNYAQKNGRK 186

Query: 196 ALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLFKEPHCFDVV 255
           A+   HK+N++   DGLF+     + E   K Y  IE +  IVD+   +   +PH FDV+
Sbjct: 187 AVCAVHKANIMKLGDGLFRNTVTSIGE---KEYPDIETSSIIVDNASMQAVAKPHQFDVL 243

Query: 256 VAPNLYGDLLSDGAAALVGSLGLVPSVNVGNNIIIGEP-CHGSAPDIAGRGIANPIATIR 314
           V P++YG ++ +  AAL+G  GLV   N G    + EP       DI G+ IANP A + 
Sbjct: 244 VTPSMYGTIIGNIGAALIGGPGLVAGANFGREYAVFEPGSRHVGLDIKGQNIANPTAMLL 303

Query: 315 SVSLMLQFLGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNTTQEVLDDILARI 367
           S +LML  LGL ++   I  AV   + +  V + D+GG  TT E    ++ ++
Sbjct: 304 SSALMLNHLGLTKSGKRISDAVREVIAEGDVRTKDIGGDATTTEFTQAVIEKL 356

>KAFR0J01410 Chr10 complement(256693..257745) [1053 bp, 350 aa] {ON}
           Anc_2.278 YNL037C
          Length = 350

 Score =  167 bits (424), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 117/355 (32%), Positives = 177/355 (49%), Gaps = 45/355 (12%)

Query: 21  LTIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLDAGWQTFLETGNALPGATVEA 80
             I LIPG+GIGKEV  + + + +A           E+L   W+             +E+
Sbjct: 23  FQITLIPGNGIGKEVTDSVRSIFQA-----------ENLPIDWEI----------VNIES 61

Query: 81  LRERCQGALFGAVQSPTTKVEGY--SSPI-----VALRRQLGLYANIRPVKSVSGTGQ-- 131
            R+  + A+  +++     ++G   S PI     VALR+QL ++AN+   KS        
Sbjct: 62  HRDGIKTAV-DSIKRNKIALKGIWSSDPIDGSLNVALRKQLDIFANVAIFKSFDNVNTRI 120

Query: 132 -PVDLVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLALQRQR 190
             VDLV++RENTE  +   E   VD      V E++K +++P TERIA    R A    +
Sbjct: 121 PNVDLVVIRENTEGEFSGLEHESVDG-----VVESLKIVTKPKTERIA----RFAFDFAK 171

Query: 191 MGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLFKEPH 250
              R  +T  HK+N++   DGLFK +   +       Y  I+ +  IVD+   +   +PH
Sbjct: 172 KHNRNHVTAVHKANIMKLGDGLFKNIVAHI---GNNEYPEIKNSSIIVDNASMQAVAKPH 228

Query: 251 CFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNVGNNIIIGEP-CHGSAPDIAGRGIANP 309
            FDV+V+P++YG +L +  AAL+G  GLVP  N G +  + EP       DI G+ +ANP
Sbjct: 229 QFDVLVSPSMYGTILGNIGAALIGGPGLVPGANFGRDYAVFEPGSRHVGLDIKGQNVANP 288

Query: 310 IATIRSVSLMLQFLGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNTTQEVLDDIL 364
            A I S + ML+ LGL   A  I  AV   +     V+ D+GG  +T E  D ++
Sbjct: 289 TAMILSATWMLRHLGLTSPAERITNAVKHVIAQGTTVTKDIGGTASTTEFTDAVI 343

>CAGL0G02673g Chr7 complement(246455..247531) [1077 bp, 358 aa] {ON}
           highly similar to uniprot|P28834 Saccharomyces
           cerevisiae YNL037c IDH1 or uniprot|P28241 Saccharomyces
           cerevisiae YOR136w IDH2
          Length = 358

 Score =  167 bits (422), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 118/352 (33%), Positives = 182/352 (51%), Gaps = 30/352 (8%)

Query: 22  TIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLDAGWQTFLETGNALPGAT--VE 79
           T+ LIPGDG+GKE+  +   + EA     +I   +E +D      + T + +   +  VE
Sbjct: 28  TVTLIPGDGVGKEITDSVVSIFEA----ENIPVDWERVD------ISTSDNIQDVSQAVE 77

Query: 80  ALRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANIRPVKSVSG--TGQP-VDLV 136
           +L+    G     +   +  +  + S  VALR+QL ++A++   KSV G  T  P VDLV
Sbjct: 78  SLKRNKIG--LKGIWHTSADIADHGSFNVALRKQLDMFAHVAFFKSVPGVKTKIPNVDLV 135

Query: 137 IVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLALQRQRMGGRGA 196
           ++RENTE  Y   E   V       V E++K I++  +ERIA    R A    +   R +
Sbjct: 136 VIRENTEGEYSGLEHESVPG-----VVESLKIITKAKSERIA----RFAFDFAKKYNRKS 186

Query: 197 LTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLFKEPHCFDVVV 256
           +   HK+N++   DGLF+    E+       Y  I+ +  IVD+   +   +PH FDV+V
Sbjct: 187 VCAVHKANIMKMGDGLFRNTVTEI---GANEYPDIQTSSIIVDNASMQAVAKPHQFDVMV 243

Query: 257 APNLYGDLLSDGAAALVGSLGLVPSVNVGNNIIIGEP-CHGSAPDIAGRGIANPIATIRS 315
            P++YG ++ +  AAL+G  GLV   + G    + EP       DI G+ +ANP A I S
Sbjct: 244 TPSMYGTIIGNIGAALIGGPGLVAGAHYGREHAVFEPGSQHVGLDIKGKNVANPTAMILS 303

Query: 316 VSLMLQFLGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNTTQEVLDDILARI 367
            +LMLQ LGL E+A  I +A    +   QV + D+GG  +T E  + I+ R+
Sbjct: 304 STLMLQHLGLTESAKRIAKATHDVISLGQVTTKDIGGSASTTEFTEAIIKRL 355

>ZYRO0D02838g Chr4 (223132..224217) [1086 bp, 361 aa] {ON} similar
           to uniprot|P28834 Saccharomyces cerevisiae YNL037C IDH1
           Subunit of mitochondrial NAD( )-dependent isocitrate
           dehydrogenase which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 361

 Score =  166 bits (419), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 124/380 (32%), Positives = 191/380 (50%), Gaps = 35/380 (9%)

Query: 1   MHRSSATSLIHKATYATSKTL--------TIGLIPGDGIGKEVIPAGQRVLEAIGKKHDI 52
           M R S T         T K L        T+ LIPGDG+GKEV  +    + +I K  ++
Sbjct: 1   MFRHSLTKRTLATVATTEKMLPKKYGGRYTVTLIPGDGVGKEVTDS----VVSIFKAENV 56

Query: 53  RFSYEHLD-AGWQTFLETGNALPGATVEALRERCQGALFGAVQSPTTKVEGYSSPIVALR 111
              ++ +D +G     +  +A     VE+L+ R +  L G   +      G+ S  VALR
Sbjct: 57  PVDWDRVDISGVDRAEDVKSA-----VESLK-RNRIGLKGIWHTSPADQAGHGSLNVALR 110

Query: 112 RQLGLYANIRPVKSVSGTG---QPVDLVIVRENTEDLYVQQERTYVDAATGKRVAEAIKR 168
           ++L +YAN+   KS+ G       VDLV++RENTE  +   E   V       V E++K 
Sbjct: 111 KELDIYANVARFKSIPGVQVKIPDVDLVVIRENTEGEFSGLEHESVPG-----VVESLKI 165

Query: 169 ISEPATERIAEISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSY 228
           +++   ERIA    R A    +   R  +   HK+N++   DGLFK + +EV E   K Y
Sbjct: 166 MTQDNIERIA----RFAFDYAKKNDRKQVVAVHKANIMKMGDGLFKNLVQEVGE---KEY 218

Query: 229 GSIEYNEQIVDSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNVGNNI 288
             ++    IVD+   +    PH FDV+V P++YG +L +  AAL+G  GLV   N G ++
Sbjct: 219 PELQVGNIIVDNASMQTVANPHQFDVLVTPSMYGTILGNIGAALIGGPGLVAGANYGRDV 278

Query: 289 IIGEP-CHGSAPDIAGRGIANPIATIRSVSLMLQFLGLEEAASDIDQAVTGNLKDRQVVS 347
            + EP       DI G+ +ANP A I S  L+L  LGL  +A  I +AV   + + + V+
Sbjct: 279 ALFEPGSRHVGLDIKGQNVANPTAMILSSVLLLNHLGLNTSADRISKAVHAVIAEGKSVT 338

Query: 348 PDLGGKNTTQEVLDDILARI 367
            D+GG  +T E  + ++ ++
Sbjct: 339 RDIGGTASTTEFTEAVINKL 358

>TBLA0B06910 Chr2 (1634845..1635942) [1098 bp, 365 aa] {ON} 
          Length = 365

 Score =  164 bits (415), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 120/350 (34%), Positives = 182/350 (52%), Gaps = 26/350 (7%)

Query: 22  TIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLDAGWQTFLETGNALPGATVEAL 81
           T+ LIPGDG+GKEV  +   +  A     ++   +E +D       E   A     V +L
Sbjct: 35  TVTLIPGDGVGKEVTDSVVSIFNA----ENLPIDWERVDISGLDHEEGVEA----AVNSL 86

Query: 82  RERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANIRPVKSVSG--TGQP-VDLVIV 138
           + R +  L G   +   + + + S  VALR+QL +YAN+   K++ G  T  P VDLVI+
Sbjct: 87  K-RNKIGLKGIWHTSAGQSD-HGSLNVALRKQLDIYANVAHFKTLPGVKTRIPDVDLVII 144

Query: 139 RENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLALQRQRMGGRGALT 198
           RENTE  Y   E   V       V E++K I++  +ERIA    R A    +   R  +T
Sbjct: 145 RENTEGEYSGLEHESVPG-----VVESLKIITKEKSERIA----RFAFDFAKRFDRKLVT 195

Query: 199 VTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLFKEPHCFDVVVAP 258
             HK+N++   DGLF+     + E     Y  I+ +  IVD+   +   +PH FDV+V P
Sbjct: 196 AVHKANIMKLGDGLFRNSVTSIGET---EYPDIKVSSIIVDNASMQSVAKPHQFDVLVTP 252

Query: 259 NLYGDLLSDGAAALVGSLGLVPSVNVGNNIIIGEP-CHGSAPDIAGRGIANPIATIRSVS 317
           ++YG +L +  AAL+G  GLVP  N G    + EP       DI G+ +ANP A I S +
Sbjct: 253 SMYGTILGNIGAALIGGPGLVPGANYGTECAVFEPGSRHVGLDIKGQNVANPTAMILSST 312

Query: 318 LMLQFLGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNTTQEVLDDILARI 367
           L+L+ LGL   A  I+ AV   + + +V + D+GG  +T E  ++I+ ++
Sbjct: 313 LLLKHLGLNNEAKKIEDAVYKTIAEGKVTTRDIGGSASTTEFTNEIIKKL 362

>TPHA0E01480 Chr5 complement(300222..301355) [1134 bp, 377 aa] {ON}
           Anc_5.473 YOR136W
          Length = 377

 Score =  163 bits (412), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 114/342 (33%), Positives = 178/342 (52%), Gaps = 29/342 (8%)

Query: 22  TIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLDAGWQTFLETGNALPGATVEAL 81
           T+  I GDG+G E+     + +  I K   +   + + D G    +     +P   V+ +
Sbjct: 46  TVPFIEGDGVGPEI----SKSVRTIFKAAKVPIDWVNCDIG-PLLINGETTIPQTAVDQI 100

Query: 82  RERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANIRPVKSV---SGTGQPVDLVIV 138
                 AL G + +P    +G+ S  + LR+  GL+AN+RP KS+   + T + VDL+++
Sbjct: 101 NNSLI-ALKGPLATPVG--QGHRSINLTLRKTFGLFANVRPAKSIPNLASTYENVDLIVI 157

Query: 139 RENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLALQRQRMGGRGALT 198
           RENTE  Y   E   V       V ++IK I+  A+E++    ++ A +  R  GR  L 
Sbjct: 158 RENTEGEYSGIEHEIVPG-----VVQSIKLITRKASEKV----IKYAFEYTRSIGRSNLI 208

Query: 199 VTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLFKEPHCF--DVVV 256
           V HK+ +  + DGLF +  +E+ +     Y  +    +++D+ V      P  +   V V
Sbjct: 209 VVHKATIQRRGDGLFVQTAQEMAD----KYPDVNLKLELIDNTVLNCIMNPEKYADSVSV 264

Query: 257 APNLYGDLLSDGAAAL-VGSLGLVPSVNVGNNIIIGEPCHGSAPDIAGRGIANPIATIRS 315
            PNLYGD+LSD  + L  GSLGL PS N+G  ++  E  HGSAPDIAG+  ANP A + S
Sbjct: 265 CPNLYGDILSDLNSGLSTGSLGLTPSANIGETVLY-EAVHGSAPDIAGQDKANPTALLLS 323

Query: 316 VSLMLQFLGLEEAASDIDQAVTGNLKD-RQVVSPDLGGKNTT 356
             +ML  +GL++ A  I+ AV   +   ++  + DLGG  TT
Sbjct: 324 SVMMLNHMGLQKYADMIETAVLTTITSGKEFRTADLGGSATT 365

>ZYRO0D11220g Chr4 (946652..947758) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 368

 Score =  162 bits (410), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 119/353 (33%), Positives = 184/353 (52%), Gaps = 30/353 (8%)

Query: 23  IGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLDAGWQTFLETG-NALPGATVEAL 81
           +  I GDGIG E+  + + +  A      +   +E +    +  L  G  ++P    +++
Sbjct: 38  VSFIEGDGIGPEISKSVKDIFAAA----KVPVDFESVVV--KPILVNGVTSIPEEAQKSI 91

Query: 82  RERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANIRPVKSVSGTG---QPVDLVIV 138
                 AL G + +P  K  G+ S  + LR+  GL+AN+RP KSV G       V+LV++
Sbjct: 92  NTNLV-ALKGPLATPVGK--GHRSMNLTLRKTFGLFANLRPAKSVEGFKTIYDNVNLVLI 148

Query: 139 RENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLALQRQRMGGRGALT 198
           RENTE  Y   E   V       V ++IK I+  A+ER+    +R A +  R   R  L 
Sbjct: 149 RENTEGEYAGIEHAIVPG-----VVQSIKLITREASERV----IRFAYEYARAAERPRLI 199

Query: 199 VTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLFKEPHCFD--VVV 256
           V HKS +   +DGLF +V +E+    +  +  I+   +++D+ V     +P  +   V V
Sbjct: 200 VVHKSTIQRLSDGLFVDVAKEL----QSEFPDIKLETELIDNAVLNTVTDPTKYSDAVSV 255

Query: 257 APNLYGDLLSDGAAAL-VGSLGLVPSVNVGNNIIIGEPCHGSAPDIAGRGIANPIATIRS 315
            PNLYGD+LSD  + L  GSLGL PS N+G+ + I E  HGSAPDIAG+  ANP A + S
Sbjct: 256 CPNLYGDILSDMNSGLSAGSLGLTPSGNIGHKVSIFEAVHGSAPDIAGKDKANPTALLLS 315

Query: 316 VSLMLQFLGLEEAASDIDQAVTGNL-KDRQVVSPDLGGKNTTQEVLDDILARI 367
             +ML  +GL E AS I++AV   +    +  + DL G  +T    + ++ ++
Sbjct: 316 SVMMLHHMGLHEHASQIEKAVLTTIAAGPESRTGDLKGSASTSSFTEAVIKKL 368

>KLLA0D04906g Chr4 (420903..421991) [1089 bp, 362 aa] {ON} highly
           similar to uniprot|P04173 Saccharomyces cerevisiae
           YCL018W LEU2 Beta-isopropylmalate dehydrogenase
           catalyzes the third step in the leucine biosynthesis
           pathway
          Length = 362

 Score =  154 bits (389), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 124/365 (33%), Positives = 190/365 (52%), Gaps = 38/365 (10%)

Query: 22  TIGLIPGDGIGKEVIPAGQRVLEAIGK-KHDIRFSYEHLDAGWQTFLETGNALPGATVEA 80
            I ++PGD +GKEV     +VL AI + + +I+F+++H   G      TG  LP   +EA
Sbjct: 4   NIVVLPGDHVGKEVTDEAIKVLNAIAEVRPEIKFNFQHHLIGGAAIDATGTPLPDEALEA 63

Query: 81  LRERCQGALFGAVQSPTTKVEGYSSP---IVALRRQLGLYANIRPVKSVSGT-------- 129
             ++    L GAV  P     G   P   ++ +R++LGLYAN+RP    S +        
Sbjct: 64  -SKKADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELGLYANLRPCNFASDSLLDLSPLK 121

Query: 130 ---GQPVDLVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLAL 186
               +  D V+VRE    +Y  + +       G  VA   ++ S P  +RI  ++  LAL
Sbjct: 122 PEYAKGTDFVVVRELVGGIYFGERKE----DEGDGVAWDSEKYSVPEVQRITRMAAFLAL 177

Query: 187 QRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLF 246
           Q+       +L    K+NVL+ +  L++   + V E  K  +  +    Q++DS    L 
Sbjct: 178 QQNPPLPIWSL---DKANVLASSR-LWR---KTVEETIKTEFPQLTVQHQLIDSAAMILV 230

Query: 247 KEPHCFD-VVVAPNLYGDLLSDGAAALVGSLGLVPSVNVGN----NIIIG--EPCHGSAP 299
           K P   + VV+  N++GD++SD A+ + GSLGL+PS ++ +    N   G  EPCHGSAP
Sbjct: 231 KSPTKLNGVVITNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNKAFGLYEPCHGSAP 290

Query: 300 DIAGRGIANPIATIRSVSLMLQF-LGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNTTQE 358
           D+    + NPIATI S ++ML+  L L E    +++AV  N+ D  V + DLGG N+T E
Sbjct: 291 DLPANKV-NPIATILSAAMMLKLSLDLVEEGRALEEAVR-NVLDAGVRTGDLGGSNSTTE 348

Query: 359 VLDDI 363
           V D I
Sbjct: 349 VGDAI 353

>Suva_14.302 Chr14 (546468..547370) [903 bp, 300 aa] {ON} YNL037C
           (REAL)
          Length = 300

 Score =  151 bits (382), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 105/293 (35%), Positives = 157/293 (53%), Gaps = 26/293 (8%)

Query: 21  LTIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLDAGWQTFLETGNALPGATVEA 80
            T+ LIPGDG+GKEV  + + + EA     +I   +E ++       E  N      VE+
Sbjct: 29  FTVTLIPGDGVGKEVTDSVKTIFEA----ENIPIDWETINIKQTDHKEGVNE----AVES 80

Query: 81  LRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANIRPVKSVSG--TGQP-VDLVI 137
           LR R +  L G   +P  +  G+ S  VALR+QL +YAN+   KS+ G  T  P +DL++
Sbjct: 81  LR-RNKIGLKGLWHTPADQT-GHGSLNVALRKQLDIYANVALFKSLKGVKTRIPDIDLIV 138

Query: 138 VRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLALQRQRMGGRGAL 197
           +RENTE  +   E   V       V E++K +++P TERIA    R A    +   R A+
Sbjct: 139 IRENTEGEFSGLEHESVPG-----VVESLKIMTKPKTERIA----RFAFDFAKKYNRKAV 189

Query: 198 TVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLFKEPHCFDVVVA 257
           T  HK+N++   DGLF+ +  E+    +K Y  I+ +  IVD+   +   +PH FDV+V 
Sbjct: 190 TAVHKANIMKLGDGLFRNIITEI---GQKEYPDIDVSSIIVDNASMQAVAKPHQFDVLVT 246

Query: 258 PNLYGDLLSDGAAALVGSLGLVPSVNVGNNIIIGEP-CHGSAPDIAGRGIANP 309
           P++YG +L +  AAL+G  GLV   N G +  + EP       DI G+ +ANP
Sbjct: 247 PSMYGTILGNIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLDIKGQNVANP 299

>Ecym_1296 Chr1 (602530..603621) [1092 bp, 363 aa] {ON} similar to
           Ashbya gossypii AAL012C
          Length = 363

 Score =  152 bits (385), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 126/369 (34%), Positives = 188/369 (50%), Gaps = 38/369 (10%)

Query: 18  SKTLTIGLIPGDGIGKEVIPAGQRVLEAIGK-KHDIRFSYEHLDAGWQTFLETGNALPGA 76
           S T  + ++PGD IG+EVI    +VL AI + +  I F +E+   G      TG  L   
Sbjct: 2   SSTKKVVVLPGDYIGQEVIAETIKVLNAIQEARPSINFEFEYHLIGGAAINATGAPLSDK 61

Query: 77  TVEALRERCQGALFGAVQSPTTKVEGYSSP---IVALRRQLGLYANIRPVKSVSGT---- 129
           T+EA +      L GAV  P     G   P   ++A+R++LGLYAN+RP   +S +    
Sbjct: 62  TIEAAKA-ADAVLLGAVGGPEWD-SGAVRPEQGLLAIRKELGLYANLRPCSFISKSLLGL 119

Query: 130 -------GQPVDLVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISL 182
                   Q  D VI+RE    +Y   ER   D   G  VA   ++ +    ERI  +  
Sbjct: 120 SPLKPEIAQGTDFVILRELVGGIYFG-ERKEDD---GDGVAWDSEKYTVSEVERITRMGA 175

Query: 183 RLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMV 242
            LALQ         L    K+NVL+ +  L++   R V E  K+ +  +    Q++DS  
Sbjct: 176 FLALQHDP---PLPLWSFDKANVLASSR-LWR---RTVNETIKREFPQLSVQHQLIDSAA 228

Query: 243 YRLFKEPHCFD-VVVAPNLYGDLLSDGAAALVGSLGLVPSVNVG------NNIIIGEPCH 295
             + K P  F+ +V+  N++GD++SD A+ + GSLGL+PS ++       N   + EPCH
Sbjct: 229 MIMIKNPRKFNGIVITSNIFGDIISDAASVIPGSLGLLPSASLASEPDKNNAFGLYEPCH 288

Query: 296 GSAPDIAGRGIANPIATIRSVSLMLQF-LGLEEAASDIDQAVTGNLKDRQVVSPDLGGKN 354
           GSAPD+  +G ANPIA I S ++ML+  L + +    I+ AV   + +  + + DLGG N
Sbjct: 289 GSAPDLE-KGQANPIACILSAAMMLKLSLNMVDEGKAIENAVK-QVIESGIRTGDLGGNN 346

Query: 355 TTQEVLDDI 363
           TT EV D +
Sbjct: 347 TTTEVGDAV 355

>TBLA0C01500 Chr3 complement(347212..348309) [1098 bp, 365 aa] {ON}
           Anc_1.402 YCL018W
          Length = 365

 Score =  150 bits (379), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 120/372 (32%), Positives = 199/372 (53%), Gaps = 42/372 (11%)

Query: 22  TIGLIPGDGIGKEVIPAGQRVLEAIG-KKHDIRFSYEHLDAGWQTFLETGNALPGATVEA 80
            I ++PGD +G+E++    +VL+ +  K+H ++F++++   G     +TG+ LP  T+EA
Sbjct: 6   NIVVLPGDHVGQEIVEEAVKVLKIVEEKRHGVKFNFQYHLIGGDAIDKTGDPLPDETLEA 65

Query: 81  LRERCQGALFGAVQSP---TTKVEGYSSPIVALRRQLGLYANIRPVKSVSG--------- 128
            ++     L GAV  P   T KV      ++ +R++LGLY N+RP K +S          
Sbjct: 66  AKQ-SDAVLLGAVGGPKWGTGKVRPEQG-LLKIRKELGLYGNLRPCKFISDKLIGLSPLK 123

Query: 129 --TGQPVDLVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLAL 186
               +  D V+VRE    +Y   ER   D   G  VA   ++ S    +RI +++  L+L
Sbjct: 124 EEVCKGTDFVVVRELVGGIYFG-ERQEDD---GSGVAWDSEKYSIEEVKRITKMAAFLSL 179

Query: 187 QRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLF 246
           Q        +L    K+NVL+ +      + R   +     + +++   Q++DS    L 
Sbjct: 180 QNDPPLPIWSL---DKANVLASS-----RLWRAAVDETIAEFPNLKVQHQLIDSAAMMLV 231

Query: 247 KEPHCFD-VVVAPNLYGDLLSDGAAALVGSLGLVPSVNVGN----NIIIG--EPCHGSAP 299
           K P   + +++  N++GD++SD A+ + GSLGL+PS ++ +    N   G  EPCHGSAP
Sbjct: 232 KNPTQLNGIILTNNMFGDIISDEASVIPGSLGLLPSASLASLPDKNKAFGLYEPCHGSAP 291

Query: 300 DIAGRGIANPIATIRSVSLMLQF-LGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNTTQE 358
           D+A RG  NP+ATI S ++ML+  L + +    I++AV+  L DR + + DLGG +TT E
Sbjct: 292 DLA-RGKVNPVATILSAAMMLKLSLDMVQEGEAIERAVSVVL-DRGIRTADLGGNSTTSE 349

Query: 359 VLDDI---LARI 367
           + D +   L RI
Sbjct: 350 LGDAVAQELGRI 361

>TDEL0B06000 Chr2 (1060828..1061916) [1089 bp, 362 aa] {ON}
           Anc_1.402 YCL018W
          Length = 362

 Score =  150 bits (378), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 118/365 (32%), Positives = 189/365 (51%), Gaps = 38/365 (10%)

Query: 22  TIGLIPGDGIGKEVIPAGQRVLEAIGK-KHDIRFSYEHLDAGWQTFLETGNALPGATVEA 80
            I ++PGD +G+E+     +VL+AI + + +  F+++H   G      TG  LP   +EA
Sbjct: 4   NIVVLPGDHVGQEITEEAIKVLKAISEVRPNATFNFQHHLIGGAAIDATGVPLPDEALEA 63

Query: 81  LRERCQGALFGAVQSPTTKVEGYSSP---IVALRRQLGLYANIRPVKSVSGT-------- 129
             ++    L GAV  P     G   P   ++ +R++L LYAN+RP    S +        
Sbjct: 64  -SKKADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELQLYANLRPCNFASDSLLELSPLK 121

Query: 130 ---GQPVDLVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLAL 186
               Q  D V+VRE    +Y  + +       G  VA   ++ S P  +RI  ++  LAL
Sbjct: 122 AQYAQGTDFVVVRELVGGIYFGERKE----DEGDGVAWDSEQYSVPEVQRITRMAAFLAL 177

Query: 187 QRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLF 246
           Q        +L    K+NVL+ +    K V + +    K+ + ++  N Q++DS    L 
Sbjct: 178 QHNPPLPIWSL---DKANVLASSRLWRKTVEKTI----KEEFPTLSVNHQLIDSAAMILV 230

Query: 247 KEPHCFD-VVVAPNLYGDLLSDGAAALVGSLGLVPSVNVGN----NIIIG--EPCHGSAP 299
           K P   + +++  N++GD++SD A+ + GSLGL+PS ++ +    N   G  EPCHGSAP
Sbjct: 231 KNPTQLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAP 290

Query: 300 DIAGRGIANPIATIRSVSLMLQF-LGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNTTQE 358
           D+A +G  NP+ATI S ++ML+  L + E    I++AV   L D  + + DLGG N+T E
Sbjct: 291 DLA-KGKVNPVATILSAAMMLKLSLNMVEEGVAIEKAVKKVLDD-GIRTGDLGGSNSTSE 348

Query: 359 VLDDI 363
           V D +
Sbjct: 349 VGDAV 353

>Smik_3.66 Chr3 (89718..90812) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score =  147 bits (372), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 117/364 (32%), Positives = 188/364 (51%), Gaps = 38/364 (10%)

Query: 23  IGLIPGDGIGKEVIPAGQRVLEAIGK-KHDIRFSYEHLDAGWQTFLETGNALPGATVEAL 81
           I ++PGD +G+E+     +VL+AI + + D+ F +E+   G      TG  LP   +EA 
Sbjct: 7   IVVLPGDHVGQEITAEAIKVLKAISEVRSDVNFDFENHLIGGAAIDATGVPLPDEALEA- 65

Query: 82  RERCQGALFGAVQSPTTKVEGYSSP---IVALRRQLGLYANIRPVKSVSGT--------- 129
            ++    L GAV  P     G   P   ++ +R++L LYAN+RP    S +         
Sbjct: 66  SKKADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPIKP 124

Query: 130 --GQPVDLVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLALQ 187
              +  D V+VRE    +Y  + +       G  VA   ++ + P  +RI  ++  +ALQ
Sbjct: 125 QFAKGTDFVVVRELVGGIYFGKRKE----DDGDGVAWDSEQYTVPEVQRITRMAAFMALQ 180

Query: 188 RQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLFK 247
            +      +L    K+NVL+ +  L++   + V E  K  + +++   Q++DS    L K
Sbjct: 181 HEPPLPIWSL---DKANVLASSR-LWR---KTVEETIKNEFPTLKVQHQLIDSAAMILVK 233

Query: 248 EP-HCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNVGN----NIIIG--EPCHGSAPD 300
            P H   +++  N++GD++SD A+ + GSLGL+PS ++ +    N   G  EPCHGSAPD
Sbjct: 234 NPTHLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPD 293

Query: 301 IAGRGIANPIATIRSVSLMLQF-LGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNTTQEV 359
           +    + NPIATI S ++ML+  L L E    I+ AV   L D  + + DLGG N+T EV
Sbjct: 294 LPKNKV-NPIATILSAAMMLKLSLNLPEEGKAIEDAVKKVL-DAGIRTGDLGGSNSTTEV 351

Query: 360 LDDI 363
            D +
Sbjct: 352 GDAV 355

>Kwal_0.225 s0 (111017..112111) [1095 bp, 364 aa] {ON} YCL018W
           (LEU2) - beta-IPM (isopropylmalate) dehydrogenase
           [contig 82] FULL
          Length = 364

 Score =  146 bits (369), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 119/365 (32%), Positives = 191/365 (52%), Gaps = 38/365 (10%)

Query: 18  SKTLTIGLIPGDGIGKEVIPAGQRVLEAIGK-KHDIRFSYEHLDAGWQTFLETGNALPGA 76
           S T  I ++PGD +G+E+     +VL+AI + + + +F +++   G      TG  LP A
Sbjct: 2   STTKKIVVLPGDHVGQEITEEAVKVLKAISEVRPEKQFEFQYHLIGGAAIDATGEPLPDA 61

Query: 77  TVEALRERCQGALFGAVQSPTTKVEGYSSP---IVALRRQLGLYANIRPVKSVSGT---- 129
           ++EA + +    L GAV  P     G   P   ++ +R++L LYAN+RP    S +    
Sbjct: 62  SLEAAK-KSDAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELQLYANLRPCNFASESLLDL 119

Query: 130 -------GQPVDLVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISL 182
                   +  D V+VRE    +Y  + +      TG  VA   ++ S P  +RI  ++ 
Sbjct: 120 SPLKPECARGTDFVVVRELVGGIYFGERKE----DTGDGVAWDSEQYSVPEVQRITRMAA 175

Query: 183 RLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMV 242
            LALQ        +L    K+NVL+ +  L++   + V E  K  + ++    Q++DS  
Sbjct: 176 FLALQHSPPLPVWSL---DKANVLASSR-LWR---KTVEETIKNEFPTLTVQHQLIDSAA 228

Query: 243 YRLFKEPHCFD-VVVAPNLYGDLLSDGAAALVGSLGLVPSVNVG----NNIIIG--EPCH 295
             L K P   + V++  N++GD++SD A+ + GSLGL+PS ++     +N   G  EPCH
Sbjct: 229 MILVKNPTQLNGVIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYEPCH 288

Query: 296 GSAPDIAGRGIANPIATIRSVSLMLQF-LGLEEAASDIDQAVTGNLKDRQVVSPDLGGKN 354
           GSAPD+  +G  NPIATI S ++ML+  L + E  + +++AV   L D  V + DL G +
Sbjct: 289 GSAPDLP-KGKVNPIATILSAAMMLKLSLDMFEEGAAVEEAVRKVL-DSGVRTADLKGTS 346

Query: 355 TTQEV 359
           TT EV
Sbjct: 347 TTSEV 351

>KLTH0H12188g Chr8 (1039347..1040441) [1095 bp, 364 aa] {ON} highly
           similar to uniprot|P04173 Saccharomyces cerevisiae
           YCL018W LEU2 Beta-isopropylmalate dehydrogenase
           catalyzes the third step in the leucine biosynthesis
           pathway
          Length = 364

 Score =  146 bits (368), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 116/364 (31%), Positives = 190/364 (52%), Gaps = 38/364 (10%)

Query: 23  IGLIPGDGIGKEVIPAGQRVLEAIGK-KHDIRFSYEHLDAGWQTFLETGNALPGATVEAL 81
           I ++PGD +G+E+     +VL+AI + +  ++F ++    G      TG  LP A++EA 
Sbjct: 7   IVVLPGDHVGQEITDEAIKVLKAISEVRSSVKFEFQQHLIGGAAIDATGEPLPDASLEAA 66

Query: 82  RERCQGALFGAVQSPTTKVEGYSSP---IVALRRQLGLYANIRPVKSVSGT--------- 129
           + +    L GAV  P     G   P   ++ +R++L LYAN+RP    S +         
Sbjct: 67  K-KADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELQLYANLRPCNFASESLLDLSPLKA 124

Query: 130 --GQPVDLVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLALQ 187
              +  D V+VRE    +Y  + +       G  VA   ++ S P  +RI  ++  LALQ
Sbjct: 125 EHARGTDFVVVRELVGGIYFGERKE----DEGDGVAWDSEKYSVPEVQRITRMAAFLALQ 180

Query: 188 RQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLFK 247
                   +L    K+NVL+ +  L++   + V E  K  + ++    Q++DS    + K
Sbjct: 181 HNPPLPVWSL---DKANVLASSR-LWR---KTVEETIKNEFPTLTVQHQLIDSAAMIMVK 233

Query: 248 EPHCFD-VVVAPNLYGDLLSDGAAALVGSLGLVPSVNVGN----NIIIG--EPCHGSAPD 300
            P   + V++  N++GD++SD A+ + GSLGL+PS ++ +    N   G  EPCHGSAPD
Sbjct: 234 NPTQLNGVIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPD 293

Query: 301 IAGRGIANPIATIRSVSLMLQF-LGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNTTQEV 359
           +  +G  NPIATI S ++ML+  L + E  + +++AV   L D  + + DL G N+TQEV
Sbjct: 294 LE-KGKVNPIATILSAAMMLELSLDMFEEGTAVEEAVRRVL-DSGIRTGDLRGSNSTQEV 351

Query: 360 LDDI 363
            D +
Sbjct: 352 GDAV 355

>YCL018W Chr3 (91324..92418) [1095 bp, 364 aa] {ON}
           LEU2Beta-isopropylmalate dehydrogenase (IMDH), catalyzes
           the third step in the leucine biosynthesis pathway
          Length = 364

 Score =  146 bits (368), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 116/364 (31%), Positives = 188/364 (51%), Gaps = 38/364 (10%)

Query: 23  IGLIPGDGIGKEVIPAGQRVLEAIGK-KHDIRFSYEHLDAGWQTFLETGNALPGATVEAL 81
           I ++PGD +G+E+     +VL+AI   + +++F +E+   G      TG  LP   +EA 
Sbjct: 7   IVVLPGDHVGQEITAEAIKVLKAISDVRSNVKFDFENHLIGGAAIDATGVPLPDEALEA- 65

Query: 82  RERCQGALFGAVQSPTTKVEGYSSP---IVALRRQLGLYANIRPVKSVSGT--------- 129
            ++    L GAV  P     G   P   ++ +R++L LYAN+RP    S +         
Sbjct: 66  SKKADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPIKP 124

Query: 130 --GQPVDLVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLALQ 187
              +  D V+VRE    +Y  + +       G  VA   ++ + P  +RI  ++  +ALQ
Sbjct: 125 QFAKGTDFVVVRELVGGIYFGKRKE----DDGDGVAWDSEQYTVPEVQRITRMAAFMALQ 180

Query: 188 RQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLFK 247
            +      +L    K+NVL+ +  L++   + V E  K  + +++   Q++DS    L K
Sbjct: 181 HEPPLPIWSL---DKANVLASSR-LWR---KTVEETIKNEFPTLKVQHQLIDSAAMILVK 233

Query: 248 EP-HCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNVGN----NIIIG--EPCHGSAPD 300
            P H   +++  N++GD++SD A+ + GSLGL+PS ++ +    N   G  EPCHGSAPD
Sbjct: 234 NPTHLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPD 293

Query: 301 IAGRGIANPIATIRSVSLMLQF-LGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNTTQEV 359
           +    + NPIATI S ++ML+  L L E    I+ AV   L D  + + DLGG N+T EV
Sbjct: 294 LPKNKV-NPIATILSAAMMLKLSLNLPEEGKAIEDAVKKVL-DAGIRTGDLGGSNSTTEV 351

Query: 360 LDDI 363
            D +
Sbjct: 352 GDAV 355

>CAGL0H03795g Chr8 (356535..357632) [1098 bp, 365 aa] {ON}
          Length = 365

 Score =  145 bits (367), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 119/368 (32%), Positives = 185/368 (50%), Gaps = 39/368 (10%)

Query: 20  TLTIGLIPGDGIGKEVIPAGQRVLEAIG--KKHDIRFSYEHLDAGWQTFLETGNALPGAT 77
           T TI ++PGD +G+E+     +VL AI   +   + F ++H   G      TG  LP   
Sbjct: 4   TKTIVVLPGDHVGQEITEEAIKVLNAIQECRPDKVNFKFDHHLIGGAAIDATGVPLPDEA 63

Query: 78  VEALRERCQGALFGAVQSPTTKVEGYSSP---IVALRRQLGLYANIRPVKSVSGT----- 129
           +EA  ++    L GAV  P     G   P   ++ +R++L LYAN+RP    S +     
Sbjct: 64  LEA-SKKADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLS 121

Query: 130 ------GQPVDLVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLR 183
                  +  D V+VRE    +Y  + +       G  VA   ++ S P  +RI  ++  
Sbjct: 122 PLKPEIARGTDFVVVRELVGGIYFGERKE----DEGDGVAWDSEKYSVPEVQRITRMAAF 177

Query: 184 LALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVY 243
           +ALQ        +L    K+NVL+ +  L++   + V E  K  +  +    Q++DS   
Sbjct: 178 MALQHNPPLPIWSL---DKANVLASSR-LWR---KTVEETIKNEFPQLTVQHQLIDSAAM 230

Query: 244 RLFKEP-HCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNVGN----NIIIG--EPCHG 296
            L K P H   +++  N++GD++SD A+ + GSLGL+PS ++ +    N   G  EPCHG
Sbjct: 231 ILVKNPTHLNGIIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHG 290

Query: 297 SAPDIAGRGIANPIATIRSVSLMLQF-LGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNT 355
           SAPD+  +G  NP+ATI S ++ML+  L L E    I+QAV   L D  + + DL G N+
Sbjct: 291 SAPDLP-KGKVNPVATILSAAMMLKLSLDLFEEGEIIEQAVKKVL-DSGIRTADLKGTNS 348

Query: 356 TQEVLDDI 363
           T EV D +
Sbjct: 349 TTEVGDAV 356

>Skud_3.43 Chr3 (70293..71387) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score =  145 bits (366), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 118/364 (32%), Positives = 189/364 (51%), Gaps = 38/364 (10%)

Query: 23  IGLIPGDGIGKEVIPAGQRVLEAIGK-KHDIRFSYEHLDAGWQTFLETGNALPGATVEAL 81
           I ++PGD +G+E+     +VL+AI   + +++F +E+   G      TG  LP   +EA 
Sbjct: 7   IVVLPGDHVGQEITAEAIKVLKAISDVRSNVKFDFENHLIGGAAIDATGVPLPDEALEA- 65

Query: 82  RERCQGALFGAVQSPTTKVEGYSSP---IVALRRQLGLYANIRPVKSVSGT--------- 129
            ++    L GAV  P     G   P   ++ +R++L LYAN+RP    S +         
Sbjct: 66  SKKADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASESLLDLSPIKP 124

Query: 130 --GQPVDLVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLALQ 187
              +  D V+VRE    +Y   ER   D   G  VA   ++ + P  +RI  ++  +ALQ
Sbjct: 125 QFAKGTDFVVVRELVGGIYFG-ERKEDD---GDGVAWDCEQYTVPEVQRITRMAAFMALQ 180

Query: 188 RQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLFK 247
            +      +L    K+NVL+ +  L++   + V E  K  + +++   Q++DS    L K
Sbjct: 181 HEPPLPIWSL---DKANVLASSR-LWR---KTVEETIKNEFPTLKVQHQLIDSAAMILVK 233

Query: 248 EP-HCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNVGN----NIIIG--EPCHGSAPD 300
            P H   +++  N++GD++SD A+ + GSLGL+PS ++ +    N   G  EPCHGSAPD
Sbjct: 234 NPTHLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPD 293

Query: 301 IAGRGIANPIATIRSVSLMLQF-LGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNTTQEV 359
           +    + NP+ATI S ++ML+  L L E    I+ AV   L D  + + DLGG N+T EV
Sbjct: 294 LPKNKV-NPVATILSAAMMLKLSLNLPEEGKAIEDAVKRVL-DAGIRTGDLGGSNSTTEV 351

Query: 360 LDDI 363
            D +
Sbjct: 352 GDAV 355

>NDAI0G04230 Chr7 complement(1015689..1016780) [1092 bp, 363 aa]
           {ON} Anc_1.402
          Length = 363

 Score =  145 bits (365), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 119/367 (32%), Positives = 188/367 (51%), Gaps = 38/367 (10%)

Query: 20  TLTIGLIPGDGIGKEVIPAGQRVLEAIGK-KHDIRFSYEHLDAGWQTFLETGNALPGATV 78
           T  I ++PGD +G+E+     +VL+AI +  + I F +++   G      TG  LP   +
Sbjct: 3   TKKIVVLPGDHVGEEITAEAVKVLKAIAEVDNSINFDFQYHLIGGAAIDATGVPLPDEAL 62

Query: 79  EALRERCQGALFGAVQSPTTKVEGYSSP---IVALRRQLGLYANIRPVKSVSGT------ 129
           EA  +     L GAV  P     G   P   ++ +R++LGLYAN+RP    S +      
Sbjct: 63  EA-SKNSDAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELGLYANLRPCNFASESLLGLSP 120

Query: 130 -----GQPVDLVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRL 184
                 +  D ++VRE    +Y  + +       G  VA   ++ S P  +RI  ++  L
Sbjct: 121 LRPEIAKGTDFMVVRELVGGIYFGKRKE----DEGDGVAWDSEQYSVPEVQRITRMAAFL 176

Query: 185 ALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYR 244
           ALQ        +L    K+NVL+ +  L++   + V E  K  + ++    Q++DS    
Sbjct: 177 ALQHNPPLPIWSL---DKANVLASSR-LWR---KTVEETIKNEFPTLTVQNQLIDSAAMI 229

Query: 245 LFKEPHCFD-VVVAPNLYGDLLSDGAAALVGSLGLVPSVNVGN----NIIIG--EPCHGS 297
           L K P   + +++  N++GD++SD A+ + GSLGL+PS ++ +    N   G  EPCHGS
Sbjct: 230 LVKNPTQLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGS 289

Query: 298 APDIAGRGIANPIATIRSVSLMLQF-LGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNTT 356
           APD+  +G  NPIATI S ++ML+  L L +    I++AV   L D  + + DLGG N+T
Sbjct: 290 APDLP-KGKVNPIATILSAAMMLKLSLNLVKQGDAIEEAVKKVL-DAGIRTGDLGGSNST 347

Query: 357 QEVLDDI 363
            EV D I
Sbjct: 348 TEVGDAI 354

>KNAG0I01280 Chr9 complement(245603..246946) [1344 bp, 447 aa] {ON}
           Anc_1.402 YCL018W
          Length = 447

 Score =  146 bits (369), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 123/376 (32%), Positives = 189/376 (50%), Gaps = 38/376 (10%)

Query: 11  HKATYATSKTLTIGLIPGDGIGKEVIPAGQRVLEAIGK-KHDIRFSYEHLDAGWQTFLET 69
           H  T     T  I ++PGD +G+E+     +VL AI   + ++ F ++H   G      T
Sbjct: 78  HSTTAMAQTTKHIVVLPGDHVGQEITEEAIKVLNAISSVRPNVNFDFQHHLIGGAAIDAT 137

Query: 70  GNALPGATVEALRERCQGALFGAVQSPTTKVEGYSSP---IVALRRQLGLYANIRPVKSV 126
           G  LP   +EA  ++    L GAV  P     G   P   ++ +R++L LYAN+RP    
Sbjct: 138 GVPLPDEALEA-SKKADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFA 195

Query: 127 SGT-----------GQPVDLVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATE 175
           S +            +  D+ IVRE    +Y  + +       G  VA   ++ S    +
Sbjct: 196 SDSLLDLSPLKPEIVKGTDICIVRELVGGIYFGERK----EDEGDGVAWDSEKYSVSEVQ 251

Query: 176 RIAEISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNE 235
           RI  ++  LALQ        +L    K+NVL+ +  L++   + V E  K  + ++    
Sbjct: 252 RITRMAGFLALQHNPPLPVWSLD---KANVLASSR-LWR---KTVEETIKNEFPTLTVQH 304

Query: 236 QIVDSMVYRLFKEP-HCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNVGN----NIII 290
           Q++DS    L K P H   VV+A N++GD++SD A+ + GSLGL+PS ++ +    N   
Sbjct: 305 QLIDSAAMILVKNPTHLNGVVIANNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAF 364

Query: 291 G--EPCHGSAPDIAGRGIANPIATIRSVSLMLQF-LGLEEAASDIDQAVTGNLKDRQVVS 347
           G  EPCHGSAPD+  +G  NP+ATI SV++ML+  L + E    +++AV   L D  V +
Sbjct: 365 GLYEPCHGSAPDLP-KGKVNPVATILSVAMMLKLSLNMTEEGIAVEKAVKQVL-DSGVRT 422

Query: 348 PDLGGKNTTQEVLDDI 363
            DL G N+T EV D I
Sbjct: 423 ADLRGSNSTSEVGDAI 438

>KAFR0I02200 Chr9 (449737..450834) [1098 bp, 365 aa] {ON} Anc_1.402
           YCL018W
          Length = 365

 Score =  144 bits (362), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 125/367 (34%), Positives = 187/367 (50%), Gaps = 42/367 (11%)

Query: 18  SKTLTIGLIPGDGIGKEVIPAGQRVLEAIGK-KHDIRFSYEHLDAGWQTFLETGNALPGA 76
           S    I + PGD IG E++    +VL+AI +   ++ F Y +   G      TG  L   
Sbjct: 2   SSVKNITVFPGDHIGTEIVRETVKVLDAIAEVSPNVSFKYNYQLIGGAAIDATGEPL--- 58

Query: 77  TVEALR--ERCQGALFGAVQSPTTKVEGYSSP---IVALRRQLGLYANIRPVKSVSGT-- 129
           T EAL+  +     L GAV  P     G   P   ++ +R++LG+YAN+RP + VS T  
Sbjct: 59  TDEALQVAKNSDAILLGAVGGPKWG-HGLVRPEQGLLKIRKELGVYANLRPCQFVSETLL 117

Query: 130 ---------GQPVDLVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEI 180
                     Q  D VIVRE    +Y  + +   D      VA   +  S P  +RI  +
Sbjct: 118 DLSPLKREIVQGTDFVIVRELVGGIYFGERQEAGDDG----VAWDKESYSVPEIQRITRM 173

Query: 181 SLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDS 240
           +  LALQ        +L    K+NVL+ T  L++   + V E  K  + ++  N  ++DS
Sbjct: 174 AAFLALQHNPPLPVWSL---DKANVLA-TSRLWR---KTVEETIKNEFPTLTINHHLIDS 226

Query: 241 MVYRLFKEPHCFD-VVVAPNLYGDLLSDGAAALVGSLGLVPSVNVGN----NIIIG--EP 293
               L + P   + VV+  N++GD++SD A+ + GSLGL+PS ++ +    N  +G  EP
Sbjct: 227 AAMTLVQNPTKLNGVVITTNMFGDIISDEASVIPGSLGLLPSASLASLPDKNDALGLYEP 286

Query: 294 CHGSAPDIAGRGIANPIATIRSVSLMLQF-LGLEEAASDIDQAVTGNLKDRQVVSPDLGG 352
           CHGSAPD+     ANPIATI S ++M +  L L +  + I++AV   + D  + + DLGG
Sbjct: 287 CHGSAPDLPADH-ANPIATILSAAMMCKLSLNLTKEGNAIEEAVKRTI-DAGIKTGDLGG 344

Query: 353 KNTTQEV 359
           KNTT EV
Sbjct: 345 KNTTTEV 351

>AAL012C Chr1 complement(320148..321266) [1119 bp, 372 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCL018W
           (LEU2)
          Length = 372

 Score =  140 bits (353), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 116/364 (31%), Positives = 187/364 (51%), Gaps = 38/364 (10%)

Query: 23  IGLIPGDGIGKEVIPAGQRVLEAIGKK-HDIRFSYEHLDAGWQTFLETGNALPGATVEAL 81
           I ++PGD IG+EV+    +VL A+ +   D+ F +++   G      TG+ALP   + A 
Sbjct: 7   IVVLPGDHIGREVVEEAVKVLGAVEQSLSDVHFDFQYHLVGGAAIDATGSALPDEALGAA 66

Query: 82  RERCQGALFGAVQSPTTKVEGYSSP---IVALRRQLGLYANIRPVKSVSGT--------- 129
           +E     L GAV  P  +  G   P   ++ LR++LG+YAN+RP    + +         
Sbjct: 67  KE-ADAVLLGAVGGPKWQ-GGAVRPEQGLLKLRQELGVYANLRPCNFAADSLLELSPLRP 124

Query: 130 --GQPVDLVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLALQ 187
              +  D+++VRE     Y  +         G  VA    + +    +RIA ++  LALQ
Sbjct: 125 EIARDTDIMVVRELLGGSYFGERHE----DEGDGVAWDTDKYTVKEVQRIARMAGFLALQ 180

Query: 188 RQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLFK 247
                   +L    K+NVL+ +  L+++   E +++    + +++   Q++DS    L K
Sbjct: 181 HDPPLPVWSL---DKANVLASSR-LWRKTVEETFQSE---FPNVQLQHQLIDSAAMILVK 233

Query: 248 EPHCFD-VVVAPNLYGDLLSDGAAALVGSLGLVPSVNVG------NNIIIGEPCHGSAPD 300
            P  F+ VVV  N++GD++SD A+ + GSLGL+PS ++       +   + EPCHGSAPD
Sbjct: 234 NPRAFNGVVVTSNMFGDIISDEASVIPGSLGLLPSASLASLPDSKSAFGLYEPCHGSAPD 293

Query: 301 IAGRGIANPIATIRSVSLMLQF-LGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNTTQEV 359
           +   G ANPI  I S ++ML+  L +  A   ++QAV   L D  V + DL G ++T EV
Sbjct: 294 LPA-GKANPIGCILSAAMMLKLSLNMVAAGEAVEQAVQEVL-DSGVRTGDLLGSSSTSEV 351

Query: 360 LDDI 363
            D I
Sbjct: 352 GDAI 355

>Kpol_1048.63 s1048 (182096..183190) [1095 bp, 364 aa] {ON}
           (182096..183190) [1095 nt, 365 aa]
          Length = 364

 Score =  140 bits (352), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 115/368 (31%), Positives = 185/368 (50%), Gaps = 39/368 (10%)

Query: 20  TLTIGLIPGDGIGKEVIPAGQRVLEAIGKKHD--IRFSYEHLDAGWQTFLETGNALPGAT 77
           T  I ++PGD +G+E++    +VLEA+       I+F ++    G  +   TG  LP   
Sbjct: 3   TKKIVVLPGDHVGEEIVDEAIKVLEAVASSSSKGIKFEFQRHLIGGASIDATGTPLPDEA 62

Query: 78  VEALRERCQGALFGAVQSPTTKVEGYSSP---IVALRRQLGLYANIRPVKSVSGT----- 129
           ++A +      L GAV  P     G   P   ++ +R++L LYAN+RP   VS +     
Sbjct: 63  LDAAK-NSDAVLLGAVGGPKWGT-GDVRPEQGLLKIRKELQLYANLRPCNFVSDSLLGLS 120

Query: 130 ------GQPVDLVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLR 183
                  +  D  +VRE    +Y    +       G   A   ++ + P  +RI  ++  
Sbjct: 121 PLKEEIAKGTDFTVVRELVGGIYFGDRKE----DDGDGSAWDCEKYTIPEVQRITRMAAF 176

Query: 184 LALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVY 243
           LALQ        +L    K+NVL+ +  L++   + V E  K  + +++   Q++DS   
Sbjct: 177 LALQHDPPLPIWSL---DKANVLASSR-LWR---KTVEETIKNEFPNLKVQHQLIDSAAM 229

Query: 244 RLFKEPHCFD-VVVAPNLYGDLLSDGAAALVGSLGLVPSVNVGN----NIIIG--EPCHG 296
            L K P   + +++  N++GD++SD A+ + GSLGL+PS ++ +    N   G  EPCHG
Sbjct: 230 ILVKSPRQLNGIIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHG 289

Query: 297 SAPDIAGRGIANPIATIRSVSLMLQF-LGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNT 355
           SAPD+  +G  NPIATI S ++ML+  L L +    I+QAV   L D  + + DL G N+
Sbjct: 290 SAPDLP-KGKVNPIATILSAAMMLKLSLNLVDEGIAIEQAVKQVL-DAGIRTADLKGSNS 347

Query: 356 TQEVLDDI 363
           T EV D +
Sbjct: 348 TSEVGDAV 355

>Suva_3.3 Chr3 (1464..2558) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score =  139 bits (351), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 115/369 (31%), Positives = 189/369 (51%), Gaps = 38/369 (10%)

Query: 18  SKTLTIGLIPGDGIGKEVIPAGQRVLEAIGK-KHDIRFSYEHLDAGWQTFLETGNALPGA 76
           S T  I ++PGD +G+E+     +VL+AI + + +++F +E+   G      TG  L   
Sbjct: 2   STTKKIVVLPGDHVGQEITEEAIKVLKAISEVRPNVKFDFEYHLIGGAAIDATGVPLTDE 61

Query: 77  TVEALRERCQGALFGAVQSPTTKVEGYSSP---IVALRRQLGLYANIRPVKSVSGT---- 129
            +EA  ++    L GAV  P     G   P   ++ +R++L LYAN+RP    S +    
Sbjct: 62  ALEA-SKKADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASESLLEL 119

Query: 130 -------GQPVDLVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISL 182
                   +  D V+VRE    +Y  + +       G  VA   ++ + P  +RI  ++ 
Sbjct: 120 SPIKPQFARGTDFVVVRELVGGIYFGKRKE----DDGDGVAWDSEQYTVPEVQRITRMAA 175

Query: 183 RLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMV 242
            +ALQ Q      +L    K+NVL+ +  L++   + V E  K  + +++   Q++DS  
Sbjct: 176 FMALQHQPPLPIWSL---DKANVLASSR-LWR---KTVEETIKNEFPTLKVQHQLIDSAA 228

Query: 243 YRLFKEPHCFD-VVVAPNLYGDLLSDGAAALVGSLGLVPSVNVGN----NIIIG--EPCH 295
             L K P   + +++  N++GD++SD A+ + GSLGL+PS ++ +    N   G  EPCH
Sbjct: 229 MILVKNPTQLNGIIITSNMFGDIISDEASCIPGSLGLLPSASLASLPDKNTAFGLYEPCH 288

Query: 296 GSAPDIAGRGIANPIATIRSVSLMLQF-LGLEEAASDIDQAVTGNLKDRQVVSPDLGGKN 354
           GSAPD+    + NPIATI S ++ML+  L +      I+ AV   L D  + + DLGG N
Sbjct: 289 GSAPDLPKNKV-NPIATILSAAMMLKLSLNMTAEGQAIEDAVKKVL-DAGIRTGDLGGSN 346

Query: 355 TTQEVLDDI 363
           +T EV D +
Sbjct: 347 STIEVGDAV 355

>ZYRO0E04796g Chr5 (362881..363969) [1089 bp, 362 aa] {ON}
           uniprot|Q96WI0 Zygosaccharomyces rouxii LEU2 3-
           isopropylmalate dehydrogenase
          Length = 362

 Score =  139 bits (350), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 118/365 (32%), Positives = 188/365 (51%), Gaps = 38/365 (10%)

Query: 22  TIGLIPGDGIGKEVIPAGQRVLEAIGK-KHDIRFSYEHLDAGWQTFLETGNALPGATVEA 80
            I ++PGD  G+E+     +VLEAI +   + +F+++H   G      TG+ LP   + A
Sbjct: 4   NIVVLPGDHAGQEIAQEAIKVLEAISEVSPEAKFNFQHHLIGGAAIDATGSPLPDDALAA 63

Query: 81  LRERCQGALFGAVQSPTTKVEGYSSP---IVALRRQLGLYANIRPVKSVSGT-------- 129
            ++     L GAV  P     G   P   ++ +R++L LYAN+RP    S +        
Sbjct: 64  AKKADA-VLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASESLLDLSPLK 121

Query: 130 ---GQPVDLVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLAL 186
               +  D V+VRE    +Y  + +       G  VA   ++ ++P  +R+  ++  LAL
Sbjct: 122 PQHAKGTDFVVVRELVGGIYFGERKE----DEGDGVAWDSEKYTKPEVQRLTRMAAFLAL 177

Query: 187 QRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLF 246
           Q        +L    K+NVL+ +  L++   + V E  K  +  ++ N Q++DS    L 
Sbjct: 178 QHNPPLPIWSL---DKANVLASSR-LWR---KTVEETIKNEFPQLKLNHQLIDSAAMILV 230

Query: 247 KEPHCFD-VVVAPNLYGDLLSDGAAALVGSLGLVPSVNVGN----NIIIG--EPCHGSAP 299
           K P   + +V+  NL+GD++SD A+ + GSLGL+PS ++ +    N   G  EPCHGSAP
Sbjct: 231 KSPTQLNGIVLTSNLFGDIISDEASVIPGSLGLLPSASLASLPDTNEAFGLYEPCHGSAP 290

Query: 300 DIAGRGIANPIATIRSVSLMLQF-LGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNTTQE 358
           D+  +G  NPIA I S ++ML+  L L +    +++AV   L D  V + DLGG N+T E
Sbjct: 291 DLP-KGKVNPIAMILSAAMMLKLSLNLSKEGEAVEKAVKQVL-DSGVRTGDLGGSNSTSE 348

Query: 359 VLDDI 363
           V D I
Sbjct: 349 VGDAI 353

>SAKL0D08690g Chr4 complement(723302..724396) [1095 bp, 364 aa] {ON}
           highly similar to uniprot|P04173 Saccharomyces
           cerevisiae YCL018W LEU2 Beta-isopropylmalate
           dehydrogenase catalyzes the third step in the leucine
           biosynthesis pathway
          Length = 364

 Score =  139 bits (349), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 117/368 (31%), Positives = 192/368 (52%), Gaps = 38/368 (10%)

Query: 23  IGLIPGDGIGKEVIPAGQRVLEAIGK-KHDIRFSYEHLDAGWQTFLETGNALPGATVEAL 81
           I ++PGD +G+E+     RVL+AI + + D++F Y++   G      TG  LP   ++A 
Sbjct: 7   IVVLPGDHVGQEITAEAIRVLDAISEVRPDVKFDYQYHLIGGAAIDATGVPLPDEALDAA 66

Query: 82  RERCQGALFGAVQSPTTKVEGYSSP---IVALRRQLGLYANIRPVKSVSGT--------- 129
           ++     L GAV  P     G   P   ++ +R++L LYAN+RP    S +         
Sbjct: 67  KKADA-VLLGAVGGPKWGT-GQVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPLKP 124

Query: 130 --GQPVDLVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLALQ 187
              +  D V+VRE    +Y  + +       G  VA   ++ S P  +RI  ++  LALQ
Sbjct: 125 EYAKGTDFVVVRELVGGIYFGERKE----DEGDGVAWDSEKYSVPEVQRITRMAAFLALQ 180

Query: 188 RQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLFK 247
           +       +L    K+NVL+ +  L++   + V E  K  + ++    Q++DS    L K
Sbjct: 181 QNPPLPIWSL---DKANVLASSR-LWR---KTVEETIKNEFPTLTVQHQLIDSAAMILVK 233

Query: 248 EPHCFD-VVVAPNLYGDLLSDGAAALVGSLGLVPSVNVG----NNIIIG--EPCHGSAPD 300
            P   + +V+  N++GD++SD A+ + GSLGL+PS ++     +N   G  EPCHGSAPD
Sbjct: 234 SPTKLNGIVITSNMFGDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYEPCHGSAPD 293

Query: 301 IAGRGIANPIATIRSVSLMLQF-LGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNTTQEV 359
           +    + NPIATI S ++ML+  L L E  + +++AV   L D  + + DL G+N+T EV
Sbjct: 294 LPKNKV-NPIATILSAAMMLKLSLNLVEEGNAVEEAVRRVL-DAGIRTADLRGENSTSEV 351

Query: 360 LDDILARI 367
            D ++  +
Sbjct: 352 GDAVVKAV 359

>NCAS0C04870 Chr3 complement(993177..994274) [1098 bp, 365 aa] {ON}
           Anc_1.402
          Length = 365

 Score =  139 bits (349), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 119/371 (32%), Positives = 186/371 (50%), Gaps = 41/371 (11%)

Query: 18  SKTLTIGLIPGDGIGKEVIPAGQRVLEAIGK--KHDIRFSYEHLDAGWQTFLETGNALPG 75
           S T  I ++PGD +G E+     +VL+AI +     ++F +++   G       G  L  
Sbjct: 2   STTKKIVVLPGDHVGGEITEEAIKVLKAIEQVESSKVKFDFQYHLIGGAAIDAAGVPLTD 61

Query: 76  ATVEALRERCQGALFGAVQSPTTKVEGYSSP---IVALRRQLGLYANIRPVKSVSG---- 128
             +EA  ++    L GAV  P     G   P   ++ +R++LGLYAN+RP    S     
Sbjct: 62  EALEA-SKKADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELGLYANLRPCNFASEPLLG 119

Query: 129 -------TGQPVDLVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEIS 181
                    +  D ++VRE    +Y   ER   D   G  VA   ++ S P  ERI  ++
Sbjct: 120 LSPLRPEIAKGTDFMVVRELVGGIYFG-ERKEDD---GDGVAWDSEKYSVPEVERITRMA 175

Query: 182 LRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEAN-KKSYGSIEYNEQIVDS 240
             LALQ        +L    K+NVL+ +      + R+  EA  K  + ++    Q++DS
Sbjct: 176 AFLALQHNPPLPIWSL---DKANVLASS-----RLWRKTVEATIKNEFPTLTVQNQLIDS 227

Query: 241 MVYRLFKEPHCFD-VVVAPNLYGDLLSDGAAALVGSLGLVPSVNVG----NNIIIG--EP 293
               L K P   + +++  N++GD++SD A+ + GSLGL+PS ++     +N   G  EP
Sbjct: 228 AAMILVKNPTQLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYEP 287

Query: 294 CHGSAPDIAGRGIANPIATIRSVSLMLQF-LGLEEAASDIDQAVTGNLKDRQVVSPDLGG 352
           CHGSAPD+    + NP+ATI S ++ML+  L + +    +++AV   L D  V + DLGG
Sbjct: 288 CHGSAPDLPKNKV-NPVATILSAAMMLKLSLNMVKEGEAVEEAVRRVL-DAGVRTGDLGG 345

Query: 353 KNTTQEVLDDI 363
            N+TQEV D I
Sbjct: 346 SNSTQEVGDAI 356

>TPHA0B03730 Chr2 complement(878199..879296) [1098 bp, 365 aa] {ON}
           Anc_1.402 YCL018W
          Length = 365

 Score =  131 bits (330), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 110/368 (29%), Positives = 185/368 (50%), Gaps = 43/368 (11%)

Query: 22  TIGLIPGDGIGKEVIPAGQRVLEAIG--KKHDIRFSYEHLDAGWQTFLETGNALPGATVE 79
            I ++PGD +G EV     ++L+AI   + + ++F++E+   G      TGN LP  ++E
Sbjct: 6   NIVVLPGDHVGGEVTEEAVKILKAIEEVRNNKVKFNFEYHLIGGAAIDATGNPLPDESLE 65

Query: 80  ALRERCQGALFGAVQSPTTKVEGYSSP---IVALRRQLGLYANIRPVKSVSGT------- 129
           A  +R    L GAV  P     G   P   ++ +R++L LYAN+RP    S +       
Sbjct: 66  A-SKRADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPL 123

Query: 130 ----GQPVDLVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLA 185
                +  D  +VRE    +Y  + +       G  VA   ++ S P  +RI  ++  LA
Sbjct: 124 KEKYAKGTDFTVVRELVGGIYFGKRKE----DDGDGVAWDSEQYSVPEVQRITRMAAFLA 179

Query: 186 LQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRL 245
           +Q        +L    K+NVL+ +  L+++   E  +     + S++ + Q++DS    L
Sbjct: 180 MQHNPPLPIWSL---DKANVLASSR-LWRKTVEETIQ---NEFPSLKVSHQLIDSAAMIL 232

Query: 246 FKEPHCFD-VVVAPNLYGDLLSDGAAALVG--------SLGLVPSVNVGNNIIIGEPCHG 296
            K P   + +++  N++GD++SD A+ + G        SL  +P  N    +   EPCHG
Sbjct: 233 VKNPTQLNGIIITNNMFGDIISDEASVIPGSLGLLPSASLSSLPDTNSAFGLY--EPCHG 290

Query: 297 SAPDIAGRGIANPIATIRSVSLMLQF-LGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNT 355
           SAPD+  +G  NPI TI SV++ML+  L L+E    +++AV   L D  + + DLGG N+
Sbjct: 291 SAPDLP-KGKVNPIGTILSVAMMLKLSLNLKEEGIAVEEAVRRVL-DNNIRTADLGGSNS 348

Query: 356 TQEVLDDI 363
           T ++ D +
Sbjct: 349 TSDIGDAV 356

>YDL066W Chr4 (334835..336121) [1287 bp, 428 aa] {ON}
           IDP1Mitochondrial NADP-specific isocitrate
           dehydrogenase, catalyzes the oxidation of isocitrate to
           alpha-ketoglutarate; not required for mitochondrial
           respiration and may function to divert
           alpha-ketoglutarate to biosynthetic processes
          Length = 428

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 52/171 (30%), Positives = 82/171 (47%), Gaps = 12/171 (7%)

Query: 132 PVDLVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLALQRQRM 191
           P  L +V + ++    Q +   V    G  VA A+    E + E  A  S +LA+ ++  
Sbjct: 165 PGSLELVYKPSDPTTAQPQTLKVYDYKGSGVAMAMYNTDE-SIEGFAHSSFKLAIDKKL- 222

Query: 192 GGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGS---IEYNEQIVDSMVYRLFKE 248
                L ++ K+ +L + DG FK++ +EVYEA  KS      I Y  +++D MV ++ K 
Sbjct: 223 ----NLFLSTKNTILKKYDGRFKDIFQEVYEAQYKSKFEQLGIHYEHRLIDDMVAQMIKS 278

Query: 249 PHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNV--GNNIIIGEPCHGS 297
              F ++   N  GD+ SD  A   GSLGL+ S+ V         E  HG+
Sbjct: 279 KGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGT 328

>AER061C Chr5 complement(749709..750986) [1278 bp, 425 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL066W
           (IDP1)
          Length = 425

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 45/133 (33%), Positives = 66/133 (49%), Gaps = 11/133 (8%)

Query: 170 SEPATERIAEISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYG 229
           +E +    A  S RLAL +Q       L ++ K+ +L Q DG FK+V  E+Y+A  K+  
Sbjct: 202 TEESIRGFAHASFRLALAKQL-----NLFLSTKNTILKQYDGRFKDVFEELYQAQYKAEF 256

Query: 230 S---IEYNEQIVDSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNV-- 284
               I Y  +++D MV ++ K    F ++   N  GD+ SD  A   GSLGL+ SV V  
Sbjct: 257 ERLGIYYEHRLIDDMVAQMVKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSVLVTP 315

Query: 285 GNNIIIGEPCHGS 297
                  E  HG+
Sbjct: 316 DGKTFESEAAHGT 328

>Skud_4.189 Chr4 (330300..331589) [1290 bp, 429 aa] {ON} YDL066W
           (REAL)
          Length = 429

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 47/144 (32%), Positives = 72/144 (50%), Gaps = 12/144 (8%)

Query: 159 GKRVAEAIKRISEPATERIAEISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCR 218
           G  VA A+    E + E  A  S +LA+ ++       L ++ K+ +L + DG FK++ +
Sbjct: 193 GSGVAMAMYNTDE-SIEGFAHSSFKLAIDKKL-----NLFLSTKNTILKKYDGRFKDIFQ 246

Query: 219 EVYEANKKSYGS---IEYNEQIVDSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGS 275
           EVYEA  KS      I Y  +++D MV ++ K    F ++   N  GD+ SD  A   GS
Sbjct: 247 EVYEAEYKSKFEKLGIHYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGS 305

Query: 276 LGLVPSVNV--GNNIIIGEPCHGS 297
           LGL+ S+ V         E  HG+
Sbjct: 306 LGLMTSILVTPDGKTFESEAAHGT 329

>NCAS0A08720 Chr1 complement(1722511..1723752) [1242 bp, 413 aa]
           {ON} Anc_1.396
          Length = 413

 Score = 59.3 bits (142), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 45/130 (34%), Positives = 63/130 (48%), Gaps = 11/130 (8%)

Query: 173 ATERIAEISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGS-- 230
           A E  A  S +LAL+RQ       L  T K+ +L + DG FK V  ++YE   K      
Sbjct: 190 AIEGFARSSFQLALERQL-----PLYSTTKNTILKKYDGKFKSVFEDMYEREYKQQFEDL 244

Query: 231 -IEYNEQIVDSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNVGNN-- 287
            I Y  +++D MV ++ K    F ++   N  GD+ SD  A   GSLGL+ SV V  +  
Sbjct: 245 GIWYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVAPDGK 303

Query: 288 IIIGEPCHGS 297
               E  HG+
Sbjct: 304 TFESEAAHGT 313

>KLTH0D14476g Chr4 complement(1184813..1186075) [1263 bp, 420 aa]
           {ON} highly similar to uniprot|P21954 Saccharomyces
           cerevisiae YDL066W IDP1 Mitochondrial NADP-specific
           isocitrate dehydrogenase catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate not required for
           mitochondrial respiration and may function to divert
           alpha- ketoglutarate to biosynthetic processes
          Length = 420

 Score = 58.9 bits (141), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 63/126 (50%), Gaps = 11/126 (8%)

Query: 177 IAEISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKK---SYGSIEY 233
            A  S RLAL +Q       L +  K+ +L Q DG FK++ +++Y+A  +       I Y
Sbjct: 201 FAHASFRLALSKQL-----NLFLATKNTILKQYDGRFKDLFQQLYDAEYREAFERAGISY 255

Query: 234 NEQIVDSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNV--GNNIIIG 291
             +++D MV ++ K    F V+   N  GD+ SD  A   GSLGL+ SV +    N    
Sbjct: 256 EHRLIDDMVAQMIKSRGGF-VLALKNYDGDVQSDIVAQGFGSLGLMSSVLITPDGNAFES 314

Query: 292 EPCHGS 297
           E  HG+
Sbjct: 315 EAAHGT 320

>Kwal_23.4210 s23 (619516..620784) [1269 bp, 422 aa] {ON} YDL066W
           (IDP1) - Mitochondrial form of NADP-specific isocitrate
           dehydrogenase [contig 1] FULL
          Length = 422

 Score = 58.5 bits (140), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 61/218 (27%), Positives = 97/218 (44%), Gaps = 33/218 (15%)

Query: 177 IAEISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSY---GSIEY 233
            A  S +LAL +     R  L ++ K+ +L Q DG FK++ +EVY    ++      I Y
Sbjct: 202 FAHASFKLALSK-----RLNLFMSTKNTILKQYDGRFKDIFQEVYAQEYQTQFRDEGISY 256

Query: 234 NEQIVDSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNV--GNNIIIG 291
             +++D MV ++ K    F V+   N  GD+LSD  A   GSLGL+ S+ V         
Sbjct: 257 EHRLIDDMVAQMIKSRGGF-VMALKNYDGDVLSDIVAQGFGSLGLMTSMLVTPDGKTFES 315

Query: 292 EPCHGS----------APDIAGRGIANPIATIRSVSLMLQFLG---LEEAASDIDQAVTG 338
           E  HG+            + +   IA+  A  R +    +  G   + E A  ++ A   
Sbjct: 316 EAAHGTVTRHFRQHQQGKETSTNSIASIFAWSRGLGKRGELDGTPDVVEFARKLEAATIE 375

Query: 339 NLKDRQVVSPDL----GGKN-----TTQEVLDDILARI 367
            ++   +++ DL    G  N     TT E LD + AR+
Sbjct: 376 TVQQHGIMTKDLALACGNANRDAYVTTNEFLDAVEARL 413

>Smik_4.169 Chr4 (311244..312530) [1287 bp, 428 aa] {ON} YDL066W
           (REAL)
          Length = 428

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 46/144 (31%), Positives = 72/144 (50%), Gaps = 12/144 (8%)

Query: 159 GKRVAEAIKRISEPATERIAEISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCR 218
           G  VA A+    E + E  A  S +LA+ ++       L ++ K+ +L + DG FK++ +
Sbjct: 192 GSGVAMAMYNTDE-SIEGFAHSSFKLAIDKKL-----NLFLSTKNTILKKYDGRFKDIFQ 245

Query: 219 EVYEANKKSYGS---IEYNEQIVDSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGS 275
           +VYEA  KS      I Y  +++D MV ++ K    F ++   N  GD+ SD  A   GS
Sbjct: 246 KVYEAQYKSKFEALGIHYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGS 304

Query: 276 LGLVPSVNV--GNNIIIGEPCHGS 297
           LGL+ S+ V         E  HG+
Sbjct: 305 LGLMTSILVTPDGKTFESEAAHGT 328

>KAFR0H03160 Chr8 complement(602807..604072) [1266 bp, 421 aa] {ON}
           Anc_1.396 YLR174W
          Length = 421

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 41/126 (32%), Positives = 64/126 (50%), Gaps = 11/126 (8%)

Query: 177 IAEISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGS---IEY 233
            A  S  +AL+R     +  L  T K+ VL + DG FK++ +E+YE++ K       I Y
Sbjct: 195 FARASFEMALKR-----KMPLFFTTKNTVLKRYDGKFKDIFQEMYESDYKVQFDEIGILY 249

Query: 234 NEQIVDSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNVGNN--IIIG 291
             +++D MV ++ K    F ++   N  GD+ SD  A   GSLGL+ S+ V  +      
Sbjct: 250 EHRLIDDMVAQMLKSTGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSMLVAPDGKTFES 308

Query: 292 EPCHGS 297
           E  HG+
Sbjct: 309 EAAHGT 314

>Kwal_0.191 s0 (98033..99268) [1236 bp, 411 aa] {ON} YLR174W (IDP2)
           - Cytosolic form of NADP-dependent isocitrate
           dehydrogenase [contig 82] FULL
          Length = 411

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 44/126 (34%), Positives = 60/126 (47%), Gaps = 11/126 (8%)

Query: 177 IAEISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGS---IEY 233
            A  S  LALQR     R  L  T K+ +L + DG FK+V   +Y A  +S      I Y
Sbjct: 192 FARASFELALQR-----RMPLYSTTKNTILKKYDGKFKDVFEAMYAAEYQSRFEELGIWY 246

Query: 234 NEQIVDSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNV--GNNIIIG 291
             +++D MV ++ K    F ++   N  GD+ SD  A   GSLGL+ SV V         
Sbjct: 247 EHRLIDDMVAQMLKSTGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKTFES 305

Query: 292 EPCHGS 297
           E  HG+
Sbjct: 306 EAAHGT 311

>Kpol_1055.78 s1055 (207889..209172) [1284 bp, 427 aa] {ON}
           (207889..209172) [1284 nt, 428 aa]
          Length = 427

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 59/218 (27%), Positives = 98/218 (44%), Gaps = 33/218 (15%)

Query: 177 IAEISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGS---IEY 233
            A  S +LA+ ++       L ++ K+ +L + DG FK++ +E+YE++ KS      I Y
Sbjct: 203 FAHSSFKLAINKKL-----NLFLSTKNTILKKYDGRFKDIFQEIYESDYKSQFENLGISY 257

Query: 234 NEQIVDSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNV--GNNIIIG 291
             +++D MV ++ K    F ++   N  GD+ SD  A   GSLGL+ SV V         
Sbjct: 258 EHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKTFES 316

Query: 292 EPCHGSAP------DIAGRGIANPIATIRSVSLMLQFLGLEEAASDI-------DQAVTG 338
           E  HG+        +       N IA+I + S  L   G  ++  D+       + A   
Sbjct: 317 EAAHGTVTRHYRQYEQGKETSTNSIASIFAWSRGLAKRGELDSTPDVIKFANLLESATLN 376

Query: 339 NLKDRQVVSPDLG---GKN------TTQEVLDDILARI 367
            ++   +++ DL    GK       TT E LD +  R+
Sbjct: 377 TVQQDGIMTKDLALACGKTERSAYVTTDEFLDAVATRL 414

>ZYRO0E05016g Chr5 complement(379654..380889) [1236 bp, 411 aa] {ON}
           highly similar to uniprot|P41939 Saccharomyces
           cerevisiae YLR174W IDP2 Cytosolic NADP-specific
           isocitrate dehydrogenase catalyzes oxidation of
           isocitrate to alpha- ketoglutarate levels are elevated
           during growth on non- fermentable carbon sources and
           reduced during growth on glucose
          Length = 411

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/141 (31%), Positives = 70/141 (49%), Gaps = 12/141 (8%)

Query: 162 VAEAIKRISEPATERIAEISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVY 221
           VA A+   +E + E  A+ S  LAL+R++      L  T K+ +L + DG FK++   +Y
Sbjct: 179 VAMAMYNTTE-SIEGFAKASFELALERKQ-----PLYSTTKNTILKKYDGKFKDIFEAMY 232

Query: 222 EANKKSYGS---IEYNEQIVDSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGL 278
           E   +S      I Y  +++D MV ++ K    + ++   N  GD+ SD  A   GSLGL
Sbjct: 233 EKEYRSQFEKLGIWYEHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVQSDIVAQGFGSLGL 291

Query: 279 VPSVNV--GNNIIIGEPCHGS 297
           + SV V         E  HG+
Sbjct: 292 MTSVLVTPDGKTFESEAAHGT 312

>CAGL0D00770g Chr4 (95715..96986) [1272 bp, 423 aa] {ON} highly
           similar to uniprot|P21954 Saccharomyces cerevisiae
           YDL066w IDP1 isocitrate dehydrogenase or uniprot|P41939
           Saccharomyces cerevisiae YLR174w IDP2 or uniprot|P53982
           Saccharomyces cerevisiae YNL009w IDP3
          Length = 423

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 67/126 (53%), Gaps = 11/126 (8%)

Query: 177 IAEISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEAN-KKSYG--SIEY 233
            A  S +LALQ++       L ++ K+ +L + DG FK++ +EVY++  K+ +   +I Y
Sbjct: 204 FAHSSFKLALQKKL-----NLFLSTKNTILKKYDGRFKDIFQEVYDSEYKQKFAELNITY 258

Query: 234 NEQIVDSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNV--GNNIIIG 291
             +++D MV ++ K    F ++   N  GD+ SD  A   GSLGL+ S+ +         
Sbjct: 259 EHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILITPDGKTFES 317

Query: 292 EPCHGS 297
           E  HG+
Sbjct: 318 EAAHGT 323

>TDEL0E01160 Chr5 (234217..235488) [1272 bp, 423 aa] {ON} Anc_4.254
           YDL066W
          Length = 423

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 65/126 (51%), Gaps = 11/126 (8%)

Query: 177 IAEISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSY---GSIEY 233
            A  S +LAL ++       L ++ K+ +L + DG FK++ +E+++A  K+     +I Y
Sbjct: 204 FAHASFKLALNKKL-----NLFLSTKNTILKKYDGRFKDIFQEIFDAEYKTQFEAANISY 258

Query: 234 NEQIVDSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNV--GNNIIIG 291
             +++D MV ++ K    F ++   N  GD+ SD  A   GSLGL+ SV V         
Sbjct: 259 EHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKTFES 317

Query: 292 EPCHGS 297
           E  HG+
Sbjct: 318 EAAHGT 323

>SAKL0H02860g Chr8 (280944..282209) [1266 bp, 421 aa] {ON} highly
           similar to uniprot|P21954 Saccharomyces cerevisiae
           YDL066W IDP1 Mitochondrial NADP-specific isocitrate
           dehydrogenase catalyzes the oxidation of isocitrate to
           alpha-ketoglutarate not required for mitochondrial
           respiration and may function to divert alpha-
           ketoglutarate to biosynthetic processes
          Length = 421

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 42/133 (31%), Positives = 68/133 (51%), Gaps = 11/133 (8%)

Query: 170 SEPATERIAEISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEAN-KKSY 228
           +E +    A  S +LAL ++       L ++ K+ +L + DG FK++ +E+Y+A  KK +
Sbjct: 195 TEESIRGFAHASFKLALTKKL-----NLYLSTKNTILKKYDGRFKDIFQELYDAEYKKQF 249

Query: 229 --GSIEYNEQIVDSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNV-- 284
               I Y  +++D MV ++ K    F ++   N  GD+ SD  A   GSLGL+ SV V  
Sbjct: 250 EAAGIYYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSVLVTP 308

Query: 285 GNNIIIGEPCHGS 297
                  E  HG+
Sbjct: 309 DGKTFESEAAHGT 321

>KLTH0H12012g Chr8 (1026586..1027827) [1242 bp, 413 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174W IDP2 Cytosolic NADP-specific isocitrate
           dehydrogenase catalyzes oxidation of isocitrate to
           alpha- ketoglutarate levels are elevated during growth
           on non- fermentable carbon sources and reduced during
           growth on glucose
          Length = 413

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 59/126 (46%), Gaps = 11/126 (8%)

Query: 177 IAEISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSY---GSIEY 233
            A  S  LALQR+       L  T K+ +L + DG FK+    +YEA  +       I Y
Sbjct: 194 FARASFELALQRKM-----PLYSTTKNTILKRYDGRFKDEFEAMYEAEYRERFERAGIWY 248

Query: 234 NEQIVDSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNV--GNNIIIG 291
             +++D MV ++ K    F V+   N  GD+ SD  A   GSLGL+ SV V         
Sbjct: 249 EHRLIDDMVAQMLKSAGGF-VIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGRAFES 307

Query: 292 EPCHGS 297
           E  HG+
Sbjct: 308 EAAHGT 313

>AAL022W Chr1 (302946..304193) [1248 bp, 415 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR174W (IDP2) and
           YNL009W (IDP3)
          Length = 415

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 61/126 (48%), Gaps = 11/126 (8%)

Query: 177 IAEISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSY---GSIEY 233
            A+ S  LALQR+       L  T K+ +L + DG FK++   +Y A  K       I Y
Sbjct: 194 FAKSSFELALQRKM-----PLYSTTKNTILKKYDGKFKDIFEGMYAAEYKEKFEAAGIWY 248

Query: 234 NEQIVDSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNVGNN--IIIG 291
             +++D MV ++ K    F ++   N  GD+ SD  A   GSLGL+ SV V  +      
Sbjct: 249 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVSPDGKTFES 307

Query: 292 EPCHGS 297
           E  HG+
Sbjct: 308 EAAHGT 313

>KNAG0D04410 Chr4 complement(799414..800700) [1287 bp, 428 aa] {ON}
           Anc_4.254 YDL066W
          Length = 428

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 64/126 (50%), Gaps = 11/126 (8%)

Query: 177 IAEISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSY---GSIEY 233
            A  S +LAL ++       L ++ K+ +L + DG FK++ +E+++A  K       I+Y
Sbjct: 209 FAHASFKLALSKKL-----DLFLSTKNTILKRYDGRFKDLFQEIFDAEYKQQFEESGIQY 263

Query: 234 NEQIVDSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNV--GNNIIIG 291
             +++D MV ++ K    F ++   N  GD+ SD  A   GSLGL+ SV V         
Sbjct: 264 QHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKTFES 322

Query: 292 EPCHGS 297
           E  HG+
Sbjct: 323 EAAHGT 328

>KAFR0I02130 Chr9 (438428..439654) [1227 bp, 408 aa] {ON} Anc_1.396
           YLR174W
          Length = 408

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 40/130 (30%), Positives = 62/130 (47%), Gaps = 11/130 (8%)

Query: 173 ATERIAEISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGS-- 230
           + E  A  S  +A++R+       L  T K+ +L Q DG FK++ + VYE   K      
Sbjct: 186 SIESFARASFTMAIERKL-----PLYSTTKNTILKQYDGQFKDIFKTVYENEYKETFEEL 240

Query: 231 -IEYNEQIVDSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNVGNN-- 287
            I Y  +++D MV ++ K    F ++   N  GD+ SD  A   GSLGL+ S  +  +  
Sbjct: 241 GIWYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSTLIAADGK 299

Query: 288 IIIGEPCHGS 297
               E  HG+
Sbjct: 300 TFESEAAHGT 309

>TBLA0C01290 Chr3 complement(283624..284880) [1257 bp, 418 aa] {ON}
           Anc_1.396 YLR174W
          Length = 418

 Score = 55.5 bits (132), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 63/124 (50%), Gaps = 10/124 (8%)

Query: 162 VAEAIKRISEPATERIAEISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVY 221
           VA  +   +E  T+  A+ S   AL+R     +  L  T K+ +L Q DG FK++  E+Y
Sbjct: 184 VAMTMYNTTESITD-FAKASFEFALER-----KIPLYSTTKNTILKQYDGKFKDIFEEMY 237

Query: 222 EA---NKKSYGSIEYNEQIVDSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGL 278
                +K    +I Y  +++D MV ++ K    F ++   N  GD+ SD  A   GSLGL
Sbjct: 238 AKEYEDKFKVLNIWYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVESDVVAQGFGSLGL 296

Query: 279 VPSV 282
           + SV
Sbjct: 297 MTSV 300

>Suva_4.184 Chr4 (324382..325671) [1290 bp, 429 aa] {ON} YDL066W
           (REAL)
          Length = 429

 Score = 55.5 bits (132), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 64/236 (27%), Positives = 105/236 (44%), Gaps = 34/236 (14%)

Query: 159 GKRVAEAIKRISEPATERIAEISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCR 218
           G  VA A+    E + E  A  S ++A+ ++       L ++ K+ +L + DG FK++ +
Sbjct: 193 GSGVAMAMYNTDE-SIEGFAHSSFKMAIDKKL-----NLFLSTKNTILKKYDGRFKDIFQ 246

Query: 219 EVYEANKKSYGS---IEYNEQIVDSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGS 275
            +YEA  K       I Y  +++D MV ++ K    F ++   N  GD+ SD  A   GS
Sbjct: 247 NIYEAQYKPKFEELGIHYEHRLIDDMVAQMVKSKGGF-IMALKNYDGDVQSDIVAQGFGS 305

Query: 276 LGLVPSVNV--GNNIIIGEPCHGSAP------DIAGRGIANPIATIRSVSLMLQFLG--- 324
           LGL+ S+ V         E  HG+                N IA+I + S  L   G   
Sbjct: 306 LGLMTSILVTPDGKTFESEAAHGTVTRHYRKYQQGEETSTNSIASIFAWSRGLLKRGELD 365

Query: 325 ----LEEAASDIDQAVTGNLKDRQVVSPDLG---GKN------TTQEVLDDILARI 367
               L + A+ ++ A    ++   +++ DL    GKN      TT+E LD +  R+
Sbjct: 366 NTPSLCKFANILESATLNTVQQDGIMTKDLALACGKNDRSAYVTTEEFLDAVEKRL 421

>KNAG0H01670 Chr8 (298481..299755) [1275 bp, 424 aa] {ON} Anc_1.396
           YLR174W
          Length = 424

 Score = 55.5 bits (132), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 68/130 (52%), Gaps = 11/130 (8%)

Query: 173 ATERIAEISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGS-- 230
           + E  A+ S  LAL+R+       L    K+ +L + DGLFK++  ++Y+ + K+     
Sbjct: 191 SIESFAKSSFELALKRKL-----PLFFATKNTILKEYDGLFKDIFEKLYKDHYKTKFEEL 245

Query: 231 -IEYNEQIVDSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNV--GNN 287
            I +  +++D MV ++ K    F ++   N  GD+ SD  A   GSLGL+ S+ V   ++
Sbjct: 246 GITFEHRLIDDMVAQMLKSNGGF-ILSLKNYDGDVQSDIVAQGFGSLGLMTSMLVTPDDS 304

Query: 288 IIIGEPCHGS 297
           +   E  HG+
Sbjct: 305 VFESEAAHGT 314

>Ecym_1306 Chr1 complement(619565..620812) [1248 bp, 415 aa] {ON}
           similar to Ashbya gossypii AAL022W
          Length = 415

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 41/126 (32%), Positives = 60/126 (47%), Gaps = 11/126 (8%)

Query: 177 IAEISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGS---IEY 233
            A+ S  LAL+R+       L  T K+ +L + DG FK++   +YE   K       I Y
Sbjct: 194 FAKSSFELALERKM-----PLYSTTKNTILKKYDGQFKDIFEGMYEREYKQKFEAVGIWY 248

Query: 234 NEQIVDSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNVG--NNIIIG 291
             +++D MV ++ K    F ++   N  GD+ SD  A   GSLGL+ SV V         
Sbjct: 249 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVSPDGKTFES 307

Query: 292 EPCHGS 297
           E  HG+
Sbjct: 308 EAAHGT 313

>NDAI0D04360 Chr4 (1024297..1025571) [1275 bp, 424 aa] {ON}
           Anc_4.254
          Length = 424

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 43/144 (29%), Positives = 72/144 (50%), Gaps = 12/144 (8%)

Query: 159 GKRVAEAIKRISEPATERIAEISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCR 218
           G  VA A+    E + E  A  S +LA+ ++       L ++ K+ +L + DG FK++ +
Sbjct: 192 GSGVALAMYNTDE-SIEGFAHSSFKLAIDKKL-----NLFLSTKNTILKKYDGRFKDIFQ 245

Query: 219 EVYEANKKSYG---SIEYNEQIVDSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGS 275
            +YE + K+     +I Y  +++D MV ++ K    F ++   N  GD+ SD  A   GS
Sbjct: 246 SIYETHYKAKFQQLNINYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGS 304

Query: 276 LGLVPSVNV--GNNIIIGEPCHGS 297
           LGL+ S+ V         E  HG+
Sbjct: 305 LGLMTSILVTPDGKTFESEAAHGT 328

>KNAG0I01320 Chr9 complement(255478..256716) [1239 bp, 412 aa] {ON}
           Anc_1.396 YLR174W
          Length = 412

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 66/133 (49%), Gaps = 11/133 (8%)

Query: 170 SEPATERIAEISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYG 229
           ++ + E  A+ S +LA++R+       L  T K+ +L + DG+FK++   +YE   K   
Sbjct: 188 TKESIEGFAKASFQLAVERKM-----PLYSTTKNTILKKYDGMFKDIFEGMYEREYKEKF 242

Query: 230 S---IEYNEQIVDSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNV-- 284
               I Y  +++D MV ++ K    + ++   N  GD+ SD  A   GSLGL+ SV +  
Sbjct: 243 EELGIWYEHRLIDDMVAQMLKSSGGY-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLITP 301

Query: 285 GNNIIIGEPCHGS 297
                  E  HG+
Sbjct: 302 DGKTFESEAAHGT 314

>CAGL0H03663g Chr8 (337533..338789) [1257 bp, 418 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174w IDP2 isocitrate dehydrogenase or uniprot|P53982
           Saccharomyces cerevisiae YNL009w IDP3 or uniprot|P21954
           Saccharomyces cerevisiae YDL066w IDP1
          Length = 418

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 62/126 (49%), Gaps = 11/126 (8%)

Query: 177 IAEISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGS---IEY 233
            A  S  LA++R+       L  T K+ +L + DG FK++ +++Y+ + K       I Y
Sbjct: 193 FARASFELAIKRKL-----PLFFTTKNTILKKYDGRFKDIFQKMYDEDYKGKFKELGISY 247

Query: 234 NEQIVDSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPS--VNVGNNIIIG 291
             +++D MV ++ K    F ++   N  GD+ SD  A   GSLGL+ S  +     I   
Sbjct: 248 EHRLIDDMVAQMIKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSTLLTPDGKIFES 306

Query: 292 EPCHGS 297
           E  HG+
Sbjct: 307 EAAHGT 312

>KLLA0B03355g Chr2 (303444..304733) [1290 bp, 429 aa] {ON} highly
           similar to uniprot|P21954 Saccharomyces cerevisiae
           YDL066W IDP1 Mitochondrial NADP-specific isocitrate
           dehydrogenase catalyzes the oxidation of isocitrate to
           alpha-ketoglutarate not required for mitochondrial
           respiration and may function to divert alpha-
           ketoglutarate to biosynthetic processes
          Length = 429

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 64/126 (50%), Gaps = 11/126 (8%)

Query: 177 IAEISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGS---IEY 233
            A  S +LA+ ++       L ++ K+ +L + DG FK++ +E+Y++  KS      I Y
Sbjct: 210 FAHASFKLAITKKL-----NLYLSTKNTILKKYDGRFKDIFQEIYDSEYKSEFEKLGIWY 264

Query: 234 NEQIVDSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNV--GNNIIIG 291
             +++D MV ++ K    F ++   N  GD+ SD  A   GSLGL+ SV V         
Sbjct: 265 EHRLIDDMVAQMIKSKGGF-ILAFKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKAFES 323

Query: 292 EPCHGS 297
           E  HG+
Sbjct: 324 EAAHGT 329

>TDEL0B06100 Chr2 complement(1076365..1077609) [1245 bp, 414 aa]
           {ON} Anc_1.396 YLR174W
          Length = 414

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 41/126 (32%), Positives = 61/126 (48%), Gaps = 11/126 (8%)

Query: 177 IAEISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGS---IEY 233
            A+ S  LAL+R+       L  T K+ +L + DG FK+V  ++Y    +S      I Y
Sbjct: 191 FAKASFELALERKL-----PLYSTTKNTILKKYDGKFKDVFEQMYADQYQSRFEELGIWY 245

Query: 234 NEQIVDSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNV--GNNIIIG 291
             +++D MV ++ K    F ++   N  GD+ SD  A   GSLGL+ SV V         
Sbjct: 246 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVESDIVAQGFGSLGLMTSVLVTPDGKTFES 304

Query: 292 EPCHGS 297
           E  HG+
Sbjct: 305 EAAHGT 310

>KLLA0F12342g Chr6 (1137608..1138855) [1248 bp, 415 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174W IDP2 Cytosolic NADP-specific isocitrate
           dehydrogenase catalyzes oxidation of isocitrate to
           alpha- ketoglutarate levels are elevated during growth
           on non- fermentable carbon sources and reduced during
           growth on glucose
          Length = 415

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 40/126 (31%), Positives = 61/126 (48%), Gaps = 11/126 (8%)

Query: 177 IAEISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKS---YGSIEY 233
            A  S ++AL+R        L  T K+ +L + DG FK+V   +YE+  KS      I Y
Sbjct: 195 FAHASFKMALERGL-----PLYSTTKNTILKKYDGKFKDVFESLYESQYKSAFEAKGIWY 249

Query: 234 NEQIVDSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNV--GNNIIIG 291
             +++D MV ++ K    + ++   N  GD+ SD  A   GSLGL+ SV +         
Sbjct: 250 EHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMTSVLITPDGKAFES 308

Query: 292 EPCHGS 297
           E  HG+
Sbjct: 309 EAAHGT 314

>KAFR0G03260 Chr7 complement(675642..676907) [1266 bp, 421 aa] {ON}
           Anc_4.254 YDL066W
          Length = 421

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 54/225 (24%), Positives = 103/225 (45%), Gaps = 33/225 (14%)

Query: 170 SEPATERIAEISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYG 229
           ++ + E  A  S ++AL ++       L +  K+ +L + DG FK++ +++Y    K+  
Sbjct: 197 TDESIEGFAHSSFQVALNKKL-----NLFLATKNTILKKYDGRFKDIFQQIYNGQYKAKF 251

Query: 230 S---IEYNEQIVDSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNVG- 285
               I Y  +++D MV ++ K    F ++   N  GD+ SD  A   GSLGL+ S+ V  
Sbjct: 252 EQLGITYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILVSP 310

Query: 286 -NNIIIGEPCHGS----------APDIAGRGIANPIATIRSVSLMLQFLGLEEA---ASD 331
                  E  HG+            + +   IA+  A  R ++   +  G ++    A+ 
Sbjct: 311 DGKTFESEAAHGTVTRHFRRHQMGEETSTNSIASIFAWSRGLAKRGELDGTKDVIAFANK 370

Query: 332 IDQAVTGNLKDRQVVSPDLG---GKN------TTQEVLDDILARI 367
           ++ A   ++++  +++ DL    GKN       T E +D + AR+
Sbjct: 371 LEAATLDSVQEDGIMTKDLALASGKNNRSDYVNTDEFIDAVEARL 415

>CAGL0B04917g Chr2 complement(477939..479174) [1236 bp, 411 aa] {ON}
           highly similar to uniprot|P41939 Saccharomyces
           cerevisiae YLR174w IDP2 isocitrate dehydrogenase or
           uniprot|P53982 Saccharomyces cerevisiae YNL009w IDP3 or
           uniprot|P21954 Saccharomyces cerevisiae YDL066w IDP1
          Length = 411

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 58/221 (26%), Positives = 96/221 (43%), Gaps = 39/221 (17%)

Query: 177 IAEISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSY---GSIEY 233
            A  S  +AL+ +       L  T K+ +L + DG FK+    +YEA  K       I Y
Sbjct: 192 FARASFNMALEHEM-----PLYSTTKNTILKKYDGKFKDTFESMYEAEYKEQFEAKGIWY 246

Query: 234 NEQIVDSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNVGNN--IIIG 291
             +++D MV ++ K    F ++   N  GD+ SD  A   GSLGL+ SV +  +      
Sbjct: 247 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVESDIVAQGFGSLGLMTSVLISPDGKTFES 305

Query: 292 EPCHGSA----------PDIAGRGIANPIATIRSVSLMLQFLGLEEAASDI------DQA 335
           E  HG+            + +   IA+  A  R +   +Q   L+E A  +      ++A
Sbjct: 306 EAAHGTVTRHYRQHQQGKETSTNSIASIFAWTRGI---IQRGKLDETADVVKFGELLERA 362

Query: 336 VTGNLKDRQVVSPDLG---GKN------TTQEVLDDILARI 367
               +++  +++ DL    GK       TT+E +D +  RI
Sbjct: 363 TVDTVQEDGIMTKDLALILGKTDRSAYVTTEEFIDAVENRI 403

>NCAS0G03620 Chr7 complement(675224..676480) [1257 bp, 418 aa] {ON}
           Anc_1.396
          Length = 418

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 64/133 (48%), Gaps = 11/133 (8%)

Query: 170 SEPATERIAEISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYG 229
           + P+ E  A  S ++A+++     +  L  T K+ +L + DG FK++  E+Y    K   
Sbjct: 189 TTPSIEGFARASFQMAIKK-----KIPLYFTTKNTILKKYDGTFKDIFMEMYLNEYKDEF 243

Query: 230 S---IEYNEQIVDSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNV-- 284
               I Y  +++D MV ++ K    F ++   N  GD+ SD  A   GSLGL+ SV +  
Sbjct: 244 DKLGIFYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLITP 302

Query: 285 GNNIIIGEPCHGS 297
                  E  HG+
Sbjct: 303 DGKTFQSEAAHGT 315

>Skud_14.318 Chr14 (581597..582859) [1263 bp, 420 aa] {ON} YNL009W
           (REAL)
          Length = 420

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 41/133 (30%), Positives = 64/133 (48%), Gaps = 11/133 (8%)

Query: 170 SEPATERIAEISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYG 229
           +  + E  A+ S  LAL+R     R  L  T K+ +L   D  FKE+  ++++A  K   
Sbjct: 185 TNDSIEGFAKASFELALKR-----RLPLFFTTKNTILKSYDNQFKEIFDKLFDAEYKEKF 239

Query: 230 S---IEYNEQIVDSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNVGN 286
               I Y  +++D MV ++ K    F +V   N  GD+ SD  A   GSLGL+ S+ +  
Sbjct: 240 QALGITYEHRLIDDMVAQMLKSRGGF-IVAMKNYDGDVQSDIVAQGFGSLGLMTSLLITP 298

Query: 287 N--IIIGEPCHGS 297
           +      E  HG+
Sbjct: 299 DAKTFESEAAHGT 311

>Smik_12.235 Chr12 (451719..452957) [1239 bp, 412 aa] {ON} YLR174W
           (REAL)
          Length = 412

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 41/130 (31%), Positives = 66/130 (50%), Gaps = 11/130 (8%)

Query: 173 ATERIAEISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVY-EANKKSYGS- 230
           + E  A+ S  LA++R+       L  T K+ +L + DG FK+V   +Y E+ K+ + S 
Sbjct: 188 SIEGFAKASFELAIERKL-----PLYSTTKNTILKKYDGKFKDVFEGMYAESYKEKFESL 242

Query: 231 -IEYNEQIVDSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNV--GNN 287
            I Y  +++D MV ++ K    + ++   N  GD+ SD  A   GSLGL+ SV +     
Sbjct: 243 GIWYEHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMTSVLITPDGK 301

Query: 288 IIIGEPCHGS 297
               E  HG+
Sbjct: 302 TFESEAAHGT 311

>NCAS0A02510 Chr1 complement(476363..477643) [1281 bp, 426 aa] {ON}
           Anc_4.254
          Length = 426

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 64/126 (50%), Gaps = 11/126 (8%)

Query: 177 IAEISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGS---IEY 233
            A  S +LAL ++       L ++ K+ +L + DG FK++ +E+++   K+  +   I Y
Sbjct: 207 FAHSSFKLALTKKL-----NLFLSTKNTILKKYDGRFKDIFQEIFDMEYKTKFANLGISY 261

Query: 234 NEQIVDSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNV--GNNIIIG 291
             +++D MV ++ K    F ++   N  GD+ SD  A   GSLGL+ S+ V         
Sbjct: 262 EHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFES 320

Query: 292 EPCHGS 297
           E  HG+
Sbjct: 321 EAAHGT 326

>TPHA0B03660 Chr2 (863280..864548) [1269 bp, 422 aa] {ON} Anc_1.396
           YLR174W
          Length = 422

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 63/127 (49%), Gaps = 13/127 (10%)

Query: 177 IAEISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVC----REVYEANKKSYGSIE 232
            A  S   AL+R+       L  T K+ +L + DG FK++     +E YE   K+  +I 
Sbjct: 203 FARSSFEFALERKL-----PLYSTTKNTILKKYDGQFKDIFESMYKEEYEEKFKAL-NIW 256

Query: 233 YNEQIVDSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNVGNN--III 290
           Y  +++D MV ++ K    F ++   N  GD+ SD  A   GSLGL+ SV + ++     
Sbjct: 257 YEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLISDDGKTFE 315

Query: 291 GEPCHGS 297
            E  HG+
Sbjct: 316 SEAAHGT 322

>Kpol_1048.70 s1048 complement(198298..199557) [1260 bp, 419 aa]
           {ON} complement(198298..199557) [1260 nt, 420 aa]
          Length = 419

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 61/126 (48%), Gaps = 11/126 (8%)

Query: 177 IAEISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSY---GSIEY 233
            A  S   AL++        L  T K+ +L + DG +K++  ++YE + K       I Y
Sbjct: 197 FAHSSFEFALEKGL-----PLYSTTKNTILKKYDGQYKDIFNDMYEKDYKDKFEAKGIWY 251

Query: 234 NEQIVDSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNVGNN--IIIG 291
             +++D MV ++ K    F V+   N  GD+ SD  A   GSLGL+ S+ + ++      
Sbjct: 252 EHRLIDDMVAQMLKSKGGF-VIAMKNYDGDVQSDVVAQGFGSLGLMSSILISDDGKTFES 310

Query: 292 EPCHGS 297
           E  HG+
Sbjct: 311 EAAHGT 316

>Skud_12.239 Chr12 (451342..452580) [1239 bp, 412 aa] {ON} YLR174W
           (REAL)
          Length = 412

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 40/130 (30%), Positives = 65/130 (50%), Gaps = 11/130 (8%)

Query: 173 ATERIAEISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEAN-KKSYGS- 230
           + E  A+ S  LA++R+       L  T K+ +L + DG FK+V   +Y  N K+ + S 
Sbjct: 188 SIEGFAKASFELAIERKL-----PLYSTTKNTILKKYDGKFKDVFEAMYAENYKEKFESL 242

Query: 231 -IEYNEQIVDSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNV--GNN 287
            I Y  +++D MV ++ K    + ++   N  GD+ SD  A   GSLGL+ S+ +     
Sbjct: 243 GIWYEHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMTSMLITPDGK 301

Query: 288 IIIGEPCHGS 297
               E  HG+
Sbjct: 302 TFESEAAHGT 311

>SAKL0D08426g Chr4 (705189..706424) [1236 bp, 411 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174W IDP2 Cytosolic NADP-specific isocitrate
           dehydrogenase catalyzes oxidation of isocitrate to
           alpha- ketoglutarate levels are elevated during growth
           on non- fermentable carbon sources and reduced during
           growth on glucose
          Length = 411

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 68/141 (48%), Gaps = 12/141 (8%)

Query: 162 VAEAIKRISEPATERIAEISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVY 221
           VA A+   +E  T   A+ S  LAL+R+       L  T K+ +L + DG FK++   +Y
Sbjct: 178 VAMAMYNTTESIT-GFAKASFELALERKL-----PLYSTTKNTILKRYDGKFKDIFESMY 231

Query: 222 EAN---KKSYGSIEYNEQIVDSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGL 278
            ++   K     I Y  +++D MV ++ K    + ++   N  GD+ SD  A   GSLGL
Sbjct: 232 ASDYQDKFEVIGIWYEHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGL 290

Query: 279 VPSVNV--GNNIIIGEPCHGS 297
           + SV V         E  HG+
Sbjct: 291 MSSVLVTPDGKTFESEAAHGT 311

>ZYRO0B12496g Chr2 complement(1007086..1008354) [1269 bp, 422 aa]
           {ON} highly similar to uniprot|P21954 Saccharomyces
           cerevisiae YDL066W IDP1 Mitochondrial NADP-specific
           isocitrate dehydrogenase catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate not required for
           mitochondrial respiration and may function to divert
           alpha- ketoglutarate to biosynthetic processes
          Length = 422

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 58/214 (27%), Positives = 99/214 (46%), Gaps = 33/214 (15%)

Query: 181 SLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKS---YGSIEYNEQI 237
           S +LAL ++       L ++ K+ +L + DG FK++ +E+Y+   K+      I Y  ++
Sbjct: 207 SFKLALDKKL-----NLYLSTKNTILKKYDGRFKDIFQELYDTQYKAEFEKAGIFYEHRL 261

Query: 238 VDSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNV--GNNIIIGEPCH 295
           +D MV ++ K    F ++   N  GD+ SD  A   GSLGL+ SV +         E  H
Sbjct: 262 IDDMVAQMVKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSVLITPDGKTFESEAAH 320

Query: 296 GSAP-----DIAGRGIA-NPIATIRSVSLMLQFLG-------LEEAASDIDQAVTGNLKD 342
           G+          GR  + N IA+I + S  L   G       + + A+ ++ A    ++ 
Sbjct: 321 GTVTRHYRQHQQGRETSTNSIASIFAWSRGLAKRGELDSTPEVTKFANLLESATLDTVQK 380

Query: 343 RQVVSPDLG---GKN------TTQEVLDDILARI 367
             +++ DL    GKN      TT E L+ +  R+
Sbjct: 381 DGIMTKDLAFACGKNDRSAWVTTNEFLEAVEKRL 414

>TPHA0B02210 Chr2 (509945..511246) [1302 bp, 433 aa] {ON} Anc_4.254
           YDL066W
          Length = 433

 Score = 52.4 bits (124), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 65/126 (51%), Gaps = 11/126 (8%)

Query: 177 IAEISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYG---SIEY 233
            A  S +LA+ +     +  L ++ K+ +L + DG FK+V +EV+++  K      +I+Y
Sbjct: 214 FAHSSFKLAIDK-----KLDLFLSTKNTILKKYDGRFKDVFQEVFDSTYKDKFEALNIKY 268

Query: 234 NEQIVDSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNV--GNNIIIG 291
             +++D MV ++ K    + ++   N  GD+ SD  A   GSLGL+ S+ V         
Sbjct: 269 EHRLIDDMVAQMIKSKGGY-IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFES 327

Query: 292 EPCHGS 297
           E  HG+
Sbjct: 328 EAAHGT 333

>YLR174W Chr12 (504591..505829) [1239 bp, 412 aa] {ON}
           IDP2Cytosolic NADP-specific isocitrate dehydrogenase,
           catalyzes oxidation of isocitrate to
           alpha-ketoglutarate; levels are elevated during growth
           on non-fermentable carbon sources and reduced during
           growth on glucose
          Length = 412

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 40/130 (30%), Positives = 65/130 (50%), Gaps = 11/130 (8%)

Query: 173 ATERIAEISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVY-EANKKSYGS- 230
           + E  A+ S  LA++R+       L  T K+ +L + DG FK+V   +Y  + K+ + S 
Sbjct: 188 SIEGFAKASFELAIERKL-----PLYSTTKNTILKKYDGKFKDVFEAMYARSYKEKFESL 242

Query: 231 -IEYNEQIVDSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNV--GNN 287
            I Y  +++D MV ++ K    + ++   N  GD+ SD  A   GSLGL+ SV +     
Sbjct: 243 GIWYEHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMTSVLITPDGK 301

Query: 288 IIIGEPCHGS 297
               E  HG+
Sbjct: 302 TFESEAAHGT 311

>Ecym_3265 Chr3 (504267..505541) [1275 bp, 424 aa] {ON} similar to
           Ashbya gossypii AER061C
          Length = 424

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 57/109 (52%), Gaps = 9/109 (8%)

Query: 177 IAEISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKS---YGSIEY 233
            A  S +LAL ++       L ++ K+ +L   DG FK++ +E+Y+   K+      I Y
Sbjct: 205 FAHASFKLALTKKL-----NLFLSTKNTILKTYDGRFKDIFQELYDTQYKTEFENHGIYY 259

Query: 234 NEQIVDSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSV 282
             +++D MV ++ K    F ++   N  GD+ SD  A   GSLGL+ S+
Sbjct: 260 EHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSI 307

>NDAI0G05160 Chr7 complement(1250883..1252145) [1263 bp, 420 aa]
           {ON} Anc_1.396
          Length = 420

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/130 (30%), Positives = 64/130 (49%), Gaps = 11/130 (8%)

Query: 173 ATERIAEISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGS-- 230
           + E  A  S +LAL+R+       L  T K+ +L + DG FK++   +YE   +      
Sbjct: 196 SIEGFALSSFKLALERKM-----PLYSTTKNTILKRYDGKFKDIFENMYEEQFREQFEEL 250

Query: 231 -IEYNEQIVDSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNVGNN-- 287
            I Y  +++D MV ++ K    F ++   N  GD+ SD  A   GSLGL+ SV + ++  
Sbjct: 251 GIWYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLISSDGK 309

Query: 288 IIIGEPCHGS 297
               E  HG+
Sbjct: 310 SFESEAAHGT 319

>Suva_14.339 Chr14 (594794..596047) [1254 bp, 417 aa] {ON} YNL009W
           (REAL)
          Length = 417

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 60/126 (47%), Gaps = 11/126 (8%)

Query: 177 IAEISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGS---IEY 233
            A+ S  LAL+R+       L  T K+ +L   D  FK++  ++++A  K       I Y
Sbjct: 192 FAKASFELALKRKL-----PLFFTTKNTILKNYDNQFKQIFDKLFDAEYKEQFQALGITY 246

Query: 234 NEQIVDSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNV--GNNIIIG 291
             +++D MV ++ K    F ++   N  GD+ SD  A   GSLGL+ S+ +         
Sbjct: 247 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSILITPDGKTFES 305

Query: 292 EPCHGS 297
           E  HG+
Sbjct: 306 EAAHGT 311

>Suva_10.271 Chr10 (476726..477964) [1239 bp, 412 aa] {ON} YLR174W
           (REAL)
          Length = 412

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 63/126 (50%), Gaps = 11/126 (8%)

Query: 177 IAEISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVY-EANKKSYGS--IEY 233
            A+ S  LAL+R+       L  T K+ +L + DG FK+V   +Y E  K+ + +  I Y
Sbjct: 192 FAKASFELALERKL-----PLYSTTKNTILKKYDGKFKDVFEAMYAEVYKEKFEALGIWY 246

Query: 234 NEQIVDSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNV--GNNIIIG 291
             +++D MV ++ K    + ++   N  GD+ SD  A   GSLGL+ S+ +         
Sbjct: 247 EHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMTSLLITPDGKTFES 305

Query: 292 EPCHGS 297
           E  HG+
Sbjct: 306 EAAHGT 311

>Smik_14.319 Chr14 (573167..574423) [1257 bp, 418 aa] {ON} YLR174W
           (REAL)
          Length = 418

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 40/131 (30%), Positives = 62/131 (47%), Gaps = 13/131 (9%)

Query: 173 ATERIAEISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVC----REVYEANKKSY 228
           + E  A+ S  LAL+R     +  L  T K+ +L   D  FK++      E Y    ++ 
Sbjct: 188 SIEGFAKASFELALKR-----KLPLFFTTKNTILKNYDNQFKQIFDGLFNEKYREKFQAL 242

Query: 229 GSIEYNEQIVDSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNV--GN 286
           G I+Y  +++D MV ++ K    F ++   N  GD+ SD  A   GSLGL+ S+ V    
Sbjct: 243 G-IKYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSILVTPDG 300

Query: 287 NIIIGEPCHGS 297
                E  HG+
Sbjct: 301 KTFESEAAHGT 311

>TBLA0A08010 Chr1 (1981576..1982862) [1287 bp, 428 aa] {ON}
           Anc_4.254 YDL066W
          Length = 428

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 51/89 (57%), Gaps = 4/89 (4%)

Query: 197 LTVTHKSNVLSQTDGLFKEVCREVYEAN-KKSYG--SIEYNEQIVDSMVYRLFKEPHCFD 253
           L +  K+ +L + DG FK++ +E+YE   KK +   +I Y  +++D MV ++ K    + 
Sbjct: 222 LFLATKNTILKKYDGRFKDIFQEIYENEYKKEFERLNITYEHRLIDDMVAQMIKSKGGY- 280

Query: 254 VVVAPNLYGDLLSDGAAALVGSLGLVPSV 282
           ++   N  GD+ SD  A   GSLGL+ S+
Sbjct: 281 IMALKNYDGDVQSDIVAQGFGSLGLMTSI 309

>YNL009W Chr14 (614821..616083) [1263 bp, 420 aa] {ON}
           IDP3Peroxisomal NADP-dependent isocitrate dehydrogenase,
           catalyzes oxidation of isocitrate to alpha-ketoglutarate
           with the formation of NADP(H+), required for growth on
           unsaturated fatty acids
          Length = 420

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 58/126 (46%), Gaps = 11/126 (8%)

Query: 177 IAEISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYG---SIEY 233
            A+ S  LAL+R+       L  T K+ +L   D  FK++   +++   K       I Y
Sbjct: 192 FAKASFELALKRKL-----PLFFTTKNTILKNYDNQFKQIFDNLFDKEYKEKFQALKITY 246

Query: 234 NEQIVDSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNV--GNNIIIG 291
             +++D MV ++ K    F ++   N  GD+ SD  A   GSLGL+ S+ +         
Sbjct: 247 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSILITPDGKTFES 305

Query: 292 EPCHGS 297
           E  HG+
Sbjct: 306 EAAHGT 311

>NDAI0G00850 Chr7 (179074..180333) [1260 bp, 419 aa] {ON} Anc_1.396
          Length = 419

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 59/126 (46%), Gaps = 11/126 (8%)

Query: 177 IAEISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGS---IEY 233
            A+ S  +AL+R+       L +  K+ +L + DG FK +  ++Y+   K       + Y
Sbjct: 195 FAKASFIMALKRKL-----PLFLATKNTILKKYDGRFKSIFDDMYQNEFKEKFEKLGLTY 249

Query: 234 NEQIVDSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPS--VNVGNNIIIG 291
             +++D MV ++ K    F ++   N  GD+ SD  A   GSLGL+ S  +         
Sbjct: 250 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSQLITPDGKTFQS 308

Query: 292 EPCHGS 297
           E  HG+
Sbjct: 309 EAAHGT 314

>Suva_14.303 Chr14 (547367..547525) [159 bp, 53 aa] {ON} YNL037C
           (REAL)
          Length = 53

 Score = 34.3 bits (77), Expect = 0.031,   Method: Composition-based stats.
 Identities = 16/50 (32%), Positives = 32/50 (64%)

Query: 318 LMLQFLGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNTTQEVLDDILARI 367
           LML  LGL E+A+ I +AV   + + +  + D+GG ++T +  ++I+ ++
Sbjct: 1   LMLNHLGLNESATRISKAVHETIAEGKHTTRDIGGSSSTTDFTNEIINKL 50

>KAFR0D00210 Chr4 (24617..25582) [966 bp, 321 aa] {ON} Anc_1.12
           YCL055W
          Length = 321

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 43/98 (43%), Gaps = 9/98 (9%)

Query: 168 RISEPATERI---AEISLRLALQRQRMGGRGALTVTHKSNVLSQTDG------LFKEVCR 218
           + +EP T+R+   A                G+    H SN+ +  DG      LF+E  R
Sbjct: 11  KTNEPKTKRVSFRATKEFHTNNYTNHYVHNGSFPQKHVSNIENTVDGYPKLQKLFQEKER 70

Query: 219 EVYEANKKSYGSIEYNEQIVDSMVYRLFKEPHCFDVVV 256
           ++     K +G     +QIV ++   + K+  CFDVV+
Sbjct: 71  QIANYATKPFGCKVNIDQIVPTLNKWIQKDHLCFDVVM 108

>CAGL0H06809g Chr8 complement(678341..678784) [444 bp, 147 aa] {ON}
           some similarities with uniprot|P36116 Saccharomyces
           cerevisiae YKR020w
          Length = 147

 Score = 31.6 bits (70), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 28/48 (58%), Gaps = 2/48 (4%)

Query: 317 SLMLQFLGLEEAASDIDQAVTGNL--KDRQVVSPDLGGKNTTQEVLDD 362
           SL+ ++  LE+ A+  D+ VTG +  +D   +  D G +   +EVL+D
Sbjct: 19  SLLKEYYHLEDGATKTDEPVTGEVHEQDNNTLQTDTGNEEVVKEVLED 66

>Suva_16.483 Chr16 complement(831888..833729) [1842 bp, 613 aa] {ON}
           YPR155C (REAL)
          Length = 613

 Score = 31.6 bits (70), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 28/138 (20%), Positives = 61/138 (44%), Gaps = 14/138 (10%)

Query: 158 TGKRVAEAIKRISEPATERIAEISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVC 217
           T +R+ ++ + I+    E + +++L L  Q  +   +    +    + L Q   + ++VC
Sbjct: 3   TNRRILKSFEEINHSLEESLQKVTLDLQQQLVQDDNKETRELARLQDQLQQVRSIVEKVC 62

Query: 218 REVYEANKKSYGSIEYNEQIVDSMVYRLFKEPHCFDVVVAPNLY--GDLLSDGAAALVGS 275
             +   N +SY SI ++       +Y + K+      +  P+ +  GDL    + A+   
Sbjct: 63  VSIKSDNVESYCSISFDS------LYNICKD------IADPSSFEDGDLQYLVSQAIFEY 110

Query: 276 LGLVPSVNVGNNIIIGEP 293
           + L+   +V N  + G P
Sbjct: 111 IILLCYYSVTNECVQGLP 128

>ZYRO0F15202g Chr6 complement(1243693..1245000) [1308 bp, 435 aa]
           {ON} highly similar to uniprot|P80210 Saccharomyces
           cerevisiae YNL220W ADE12 Adenylosuccinate synthase
           catalyzes the first committed step in the 'de novo'
           biosynthesis of adenosine
          Length = 435

 Score = 31.2 bits (69), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 47/104 (45%), Gaps = 13/104 (12%)

Query: 194 RGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLFKE---PH 250
           R  + V H  N   ++  +F+ + R + E  KK YG  EY+ +  +   ++ +KE   P 
Sbjct: 148 RSGIRVHHLVNDNPESWTVFENMYRRLLETRKKRYGDFEYDAE-GELARFKKYKEDLKPF 206

Query: 251 CFDVVV----APNLYGDLLSDGAAALV-----GSLGLVPSVNVG 285
             D VV    A      +L +GA AL+     G+   V S N G
Sbjct: 207 VVDSVVFMHKAIEAKKKILVEGANALMLDIDFGTYPFVTSSNTG 250

>NCAS0A13880 Chr1 complement(2723605..2726001) [2397 bp, 798 aa]
           {ON} Anc_7.309
          Length = 798

 Score = 31.2 bits (69), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 30/60 (50%), Gaps = 1/60 (1%)

Query: 191 MGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYR-LFKEP 249
            G   AL V      + +T GL  E   E+Y  +   +GSI +N++I +  V R LFK P
Sbjct: 540 WGSLNALGVVCVFFTVYETSGLTLEEIDELYRESANCFGSIAWNKKIRERPVNRPLFKFP 599

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.378 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 35,196,335
Number of extensions: 1433337
Number of successful extensions: 3841
Number of sequences better than 10.0: 140
Number of HSP's gapped: 3536
Number of HSP's successfully gapped: 140
Length of query: 367
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 256
Effective length of database: 40,753,473
Effective search space: 10432889088
Effective search space used: 10432889088
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)