Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ADL213W2.288ON90890846920.0
Ecym_33272.288ON92689024070.0
NDAI0G006702.288ON96891623870.0
SAKL0E07634g2.288ON97488923650.0
KNAG0H019902.288ON97390822790.0
KLTH0G10406g2.288ON96388322760.0
Kwal_27.115182.288ON95390322670.0
KAFR0H033002.288ON96690722500.0
Smik_14.3082.288ON96590122430.0
CAGL0M06919g2.288ON95689722400.0
NCAS0G037802.288ON95790022380.0
YNL023C (FAP1)2.288ON96590322330.0
Suva_14.3242.288ON96890122260.0
TBLA0B059502.288ON99590122080.0
TDEL0G021902.288ON93689321900.0
KLLA0E08317g2.288ON92189021850.0
Skud_14.3062.288ON97091021770.0
ZYRO0A01936g2.288ON95389821490.0
TPHA0D015302.288ON96290921110.0
Kpol_1039.452.288ON96889620720.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADL213W
         (908 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADL213W Chr4 (329646..332372) [2727 bp, 908 aa] {ON} Syntenic ho...  1811   0.0  
Ecym_3327 Chr3 (626396..629176) [2781 bp, 926 aa] {ON} similar t...   931   0.0  
NDAI0G00670 Chr7 (146574..149480) [2907 bp, 968 aa] {ON} Anc_2.2...   924   0.0  
SAKL0E07634g Chr5 complement(616444..619368) [2925 bp, 974 aa] {...   915   0.0  
KNAG0H01990 Chr8 complement(349855..352776) [2922 bp, 973 aa] {O...   882   0.0  
KLTH0G10406g Chr7 (880042..882933) [2892 bp, 963 aa] {ON} simila...   881   0.0  
Kwal_27.11518 s27 complement(832986..835847) [2862 bp, 953 aa] {...   877   0.0  
KAFR0H03300 Chr8 complement(627520..630420) [2901 bp, 966 aa] {O...   871   0.0  
Smik_14.308 Chr14 complement(550650..553547) [2898 bp, 965 aa] {...   868   0.0  
CAGL0M06919g Chr13 complement(703702..706572) [2871 bp, 956 aa] ...   867   0.0  
NCAS0G03780 Chr7 complement(696877..699750) [2874 bp, 957 aa] {O...   866   0.0  
YNL023C Chr14 complement(588263..591160) [2898 bp, 965 aa] {ON} ...   864   0.0  
Suva_14.324 Chr14 complement(571146..574052) [2907 bp, 968 aa] {...   862   0.0  
TBLA0B05950 Chr2 (1404509..1407496) [2988 bp, 995 aa] {ON} Anc_2...   855   0.0  
TDEL0G02190 Chr7 (430157..432967) [2811 bp, 936 aa] {ON} Anc_2.2...   848   0.0  
KLLA0E08317g Chr5 complement(747272..750037) [2766 bp, 921 aa] {...   846   0.0  
Skud_14.306 Chr14 complement(558943..561855) [2913 bp, 970 aa] {...   843   0.0  
ZYRO0A01936g Chr1 (159749..162610) [2862 bp, 953 aa] {ON} simila...   832   0.0  
TPHA0D01530 Chr4 complement(313063..315951) [2889 bp, 962 aa] {O...   817   0.0  
Kpol_1039.45 s1039 (135833..138739) [2907 bp, 968 aa] {ON} (1358...   802   0.0  

>ADL213W Chr4 (329646..332372) [2727 bp, 908 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL023C (FAP1)
          Length = 908

 Score = 1811 bits (4692), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 885/908 (97%), Positives = 885/908 (97%)

Query: 1   MLRDMPLDATAKLEGIPYYEQTVLELRDGETYQCLICTVEMDASCPMYACHQCYRVYDYE 60
           MLRDMPLDATAKLEGIPYYEQTVLELRDGETYQCLICTVEMDASCPMYACHQCYRVYDYE
Sbjct: 1   MLRDMPLDATAKLEGIPYYEQTVLELRDGETYQCLICTVEMDASCPMYACHQCYRVYDYE 60

Query: 61  CIRRWALKATSTTVDRTWKCPNCYHVNRKVPPKNRHTCWCGKQVNLDPNYINPNSCGQTC 120
           CIRRWALKATSTTVDRTWKCPNCYHVNRKVPPKNRHTCWCGKQVNLDPNYINPNSCGQTC
Sbjct: 61  CIRRWALKATSTTVDRTWKCPNCYHVNRKVPPKNRHTCWCGKQVNLDPNYINPNSCGQTC 120

Query: 121 GAPICQHGCSKLCHLGPHEECMVRIDFKCRCGKLTEEIPCYEAKAAKRNFSCDQPCGLPM 180
           GAPICQHGCSKLCHLGPHEECMVRIDFKCRCGKLTEEIPCYEAKAAKRNFSCDQPCGLPM
Sbjct: 121 GAPICQHGCSKLCHLGPHEECMVRIDFKCRCGKLTEEIPCYEAKAAKRNFSCDQPCGLPM 180

Query: 181 PCGIHKCERVCHNGPCGPCKEEIAGDIKCYCGLTTRNKMVCSEVSVVARSKVSKYKSWIG 240
           PCGIHKCERVCHNGPCGPCKEEIAGDIKCYCGLTTRNKMVCSEVSVVARSKVSKYKSWIG
Sbjct: 181 PCGIHKCERVCHNGPCGPCKEEIAGDIKCYCGLTTRNKMVCSEVSVVARSKVSKYKSWIG 240

Query: 241 AFACDRMREVPYSCGKHSFHEKCIAPPSLPKRTPCPYSPENCTTCPCGKTQLAELGSTRT 300
           AFACDRMREVPYSCGKHSFHEKCIAPPSLPKRTPCPYSPENCTTCPCGKTQLAELGSTRT
Sbjct: 241 AFACDRMREVPYSCGKHSFHEKCIAPPSLPKRTPCPYSPENCTTCPCGKTQLAELGSTRT 300

Query: 301 ACTDHISSCGKVCGKQLSCGNHTCPMTCHDGNCMDPCLVITEQKCACEQRRFLVPCQFPH 360
           ACTDHISSCGKVCGKQLSCGNHTCPMTCHDGNCMDPCLVITEQKCACEQRRFLVPCQFPH
Sbjct: 301 ACTDHISSCGKVCGKQLSCGNHTCPMTCHDGNCMDPCLVITEQKCACEQRRFLVPCQFPH 360

Query: 361 SPSCTAKCESLMSCRRHRCAERCCSGXXXXXXXXXXXXXXXXXXXXXXXAQHVCLKDCNR 420
           SPSCTAKCESLMSCRRHRCAERCCSG                       AQHVCLKDCNR
Sbjct: 361 SPSCTAKCESLMSCRRHRCAERCCSGRPHSVKRNSRRRRESPDDESEVEAQHVCLKDCNR 420

Query: 421 VLLCGIHMCNYKCHAGKCPPCLESDSNDLICPCGKTIVPAPVRCGTKLPRCTHPCRNSLL 480
           VLLCGIHMCNYKCHAGKCPPCLESDSNDLICPCGKTIVPAPVRCGTKLPRCTHPCRNSLL
Sbjct: 421 VLLCGIHMCNYKCHAGKCPPCLESDSNDLICPCGKTIVPAPVRCGTKLPRCTHPCRNSLL 480

Query: 481 DTWPCGHSPPSHNCHPLDEPCPPCTITVKKTCRCGKNEIRTFCYNDDVSCSRPCKKPLSY 540
           DTWPCGHSPPSHNCHPLDEPCPPCTITVKKTCRCGKNEIRTFCYNDDVSCSRPCKKPLSY
Sbjct: 481 DTWPCGHSPPSHNCHPLDEPCPPCTITVKKTCRCGKNEIRTFCYNDDVSCSRPCKKPLSY 540

Query: 541 CNHFCQVPCHSDGQCQQTCKQACGLPRKACEHVCKAKCHGHTACPESPCTEKKTITCSCG 600
           CNHFCQVPCHSDGQCQQTCKQACGLPRKACEHVCKAKCHGHTACPESPCTEKKTITCSCG
Sbjct: 541 CNHFCQVPCHSDGQCQQTCKQACGLPRKACEHVCKAKCHGHTACPESPCTEKKTITCSCG 600

Query: 601 HKSSTKICSEYAGKDDGIGASQHLSCDEDCAKFQRHQQLMRAFGVVEKATSEEDEALLLA 660
           HKSSTKICSEYAGKDDGIGASQHLSCDEDCAKFQRHQQLMRAFGVVEKATSEEDEALLLA
Sbjct: 601 HKSSTKICSEYAGKDDGIGASQHLSCDEDCAKFQRHQQLMRAFGVVEKATSEEDEALLLA 660

Query: 661 QRSQSFDDLHLPFTEYVLSVFTKQSQWCTQIEQYLIKLMDDSSPKALHFKPMRAAQRRFV 720
           QRSQSFDDLHLPFTEYVLSVFTKQSQWCTQIEQYLIKLMDDSSPKALHFKPMRAAQRRFV
Sbjct: 661 QRSQSFDDLHLPFTEYVLSVFTKQSQWCTQIEQYLIKLMDDSSPKALHFKPMRAAQRRFV 720

Query: 721 HELSSSFGLYSESQDPEPKRSVYVKKTGISRVPAIGLSKAAPLYTSFKKLEREFKANSES 780
           HELSSSFGLYSESQDPEPKRSVYVKKTGISRVPAIGLSKAAPLYTSFKKLEREFKANSES
Sbjct: 721 HELSSSFGLYSESQDPEPKRSVYVKKTGISRVPAIGLSKAAPLYTSFKKLEREFKANSES 780

Query: 781 AVTKKLVSVHIDDSPESQHDAAINAILLSGLTSFASESALRDCFADYFSQTLLNCPQYVV 840
           AVTKKLVSVHIDDSPESQHDAAINAILLSGLTSFASESALRDCFADYFSQTLLNCPQYVV
Sbjct: 781 AVTKKLVSVHIDDSPESQHDAAINAILLSGLTSFASESALRDCFADYFSQTLLNCPQYVV 840

Query: 841 RGTEGYIFPTDYLSLSANAEKDLTKLAGYFRLLFQEQNLWTDISTCKLDSNLNRIGSCES 900
           RGTEGYIFPTDYLSLSANAEKDLTKLAGYFRLLFQEQNLWTDISTCKLDSNLNRIGSCES
Sbjct: 841 RGTEGYIFPTDYLSLSANAEKDLTKLAGYFRLLFQEQNLWTDISTCKLDSNLNRIGSCES 900

Query: 901 PAADCLGQ 908
           PAADCLGQ
Sbjct: 901 PAADCLGQ 908

>Ecym_3327 Chr3 (626396..629176) [2781 bp, 926 aa] {ON} similar to
           Ashbya gossypii ADL213W
          Length = 926

 Score =  931 bits (2407), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/890 (50%), Positives = 589/890 (66%), Gaps = 5/890 (0%)

Query: 9   ATAKLEGIPYYEQTVLELRDGETYQCLICTVEMDASCPMYACHQCYRVYDYECIRRWALK 68
           + A  +G+PYYE+ + ++++G  YQCLICTVE+D++C MYAC  CYRVYDYECI  WA K
Sbjct: 21  SEADDDGLPYYEKAIKDIQNGYLYQCLICTVEIDSTCRMYACSNCYRVYDYECIMEWAKK 80

Query: 69  ATSTTVDRTWKCPNCYHVNRKVPPKNRHTCWCGKQVNLDPNYINPNSCGQTCGAPICQHG 128
           ++  + D TWKCPNCYH   KV PK R TCWCGKQ+N + N   PNSCGQTCGA IC+HG
Sbjct: 81  SSKRSADSTWKCPNCYHSYNKVLPKKRSTCWCGKQINPEKNATYPNSCGQTCGASICKHG 140

Query: 129 CSKLCHLGPHEECMVRIDFKCRCGKLTEEIPCYEAKAAKRNFSCDQPCGLPMPCGIHKCE 188
           C+  CHLGPH +CMV +  KC+CGK+TE+I CY+ KA K   SC  PCGLP+PCG+H C+
Sbjct: 141 CASTCHLGPHPKCMVPVGLKCKCGKITEQISCYQTKAVKPKLSCKLPCGLPLPCGVHTCQ 200

Query: 189 RVCHNGPCGPCKEEIAGDIKCYCGLTTRNKMVCSEVSVVARSKVSKYKSWIGAFACDRMR 248
           ++CH+GPCG C   ++G  KCYCG    + ++C +V+V   S+  K+K WIG F+C  +R
Sbjct: 201 KICHSGPCGRCNTVMSGKFKCYCGSNHLDSIICKDVAVTKMSRSGKHKKWIGVFSCKNIR 260

Query: 249 EVPYSCGKHSFHEKCIAPPSLPKRTPCPYSPENCTTCPCGKTQLAELGSTRTACTDHISS 308
           EV Y C +HSF+E C   PS   R  CPYSP  C TC CG T L ++   R  CTD I +
Sbjct: 261 EVRYRCKEHSFNESCKPSPSPDARIQCPYSPNICKTCCCGNTTLIDMQQKREKCTDPIPT 320

Query: 309 CGKVCGKQLSCGNHTCPMTCHDGNCMDPCLVITEQKCACEQRRFLVPCQFPHSPSCTAKC 368
           C + CGK LSCG HTCPMTCH G CMDPCL I E+KC+C++R FL PCQF   PSC  KC
Sbjct: 321 CDQRCGKPLSCGKHTCPMTCHPGKCMDPCLQIEERKCSCQERTFLTPCQFDGKPSCNIKC 380

Query: 369 ESLMSCRRHRCAERCCSGX-XXXXXXXXXXXXXXXXXXXXXXAQHVCLKDCNRVLLCGIH 427
           E+LMSCRRHRC +RCCSG                        A+H+C K+CNR L CG+H
Sbjct: 381 ENLMSCRRHRCIKRCCSGKPLALARSSTITPWLDKNDESLIEAEHICFKNCNRKLSCGLH 440

Query: 428 MCNYKCHAGKCPPCLESDSNDLICPCGKTIVPAPVRCGTKLPRCTHPCRNSLLDTWPCGH 487
            C  KCH GKCPPCLESDSNDL+CPCGK+++ APVRCGT  P C +PC N+L  + PCGH
Sbjct: 441 HCTNKCHPGKCPPCLESDSNDLVCPCGKSVILAPVRCGTVRPNCNYPCINTLRGSMPCGH 500

Query: 488 SPPSHNCHPLDEPCPPCTITVKKTCRCGK-NEIRTFCYNDDVSCSRPCKKPLSYCNHFCQ 546
             P H CHP  E CPPCT  V K C+CGK    RT C+ +D+SC R C   L+ C+H CQ
Sbjct: 501 RAPFHKCHPSTEDCPPCTAFVYKPCKCGKLTAARTICFQNDISCGRKCAAKLTNCHHLCQ 560

Query: 547 VPCHSDGQCQQTCKQACGLPRKACEHVCKAKCHGHTACPESPCTEKKTITCSCGHKSSTK 606
             CH  G+C  TC + CGL R ACEH+C A CHG   CP+ PC E+  ++C CG +S   
Sbjct: 561 KQCHPPGECPNTCTEVCGLKRSACEHLCTANCHGDEICPDVPCLEEVVVSCGCGRRSLKV 620

Query: 607 ICSEYAGKDDGIGASQHLSCDEDCAKFQRHQQLMRAFGVVEKATSEEDEALLLAQRSQSF 666
            C  Y  K+    A+Q L CD+DCAK Q+HQ L++     E     E  +  +  +  S+
Sbjct: 621 PCGAYKDKESAT-ATQSLLCDDDCAKVQKHQMLLQTLRSSESTNKAEHGSSSVINKPTSY 679

Query: 667 DDLHLPFTEYVLSVFTKQSQWCTQIEQYLIKLMDDSSPKALHFKPMRAAQRRFVHELSSS 726
           +DL LP++E ++ VF+KQ+ WC  I+  LI+L++D S K+LHFKPM+A QR+FVHELS +
Sbjct: 680 EDLGLPYSEQMMCVFSKQATWCKNIQDSLIRLLEDKSRKSLHFKPMKAPQRQFVHELSKA 739

Query: 727 FGLYSESQDPEPKRSVYVKKTGISRVPAIGLSKAAPLYTSFKKLEREFK-ANSESAVTKK 785
           FGLYSESQD EPKRSV+VK    S++PAIGLS+A  LY   K  ++E +    +   TK 
Sbjct: 740 FGLYSESQDREPKRSVFVKILKTSKIPAIGLSEALLLYQRMKTFQKERRDLELQHNTTKI 799

Query: 786 LVSVHIDDSPESQH-DAAINAILLSGLTSFASESALRDCFADYFSQTLLNCPQYVVRGTE 844
           L+S+ IDD  +S+  +A+ NAIL++G+    +   ++ CF +   QTLL  PQ+ +  + 
Sbjct: 800 LISIPIDDGSDSKTLEASCNAILITGVPRTVTVENIKACFDECLKQTLLKDPQFRLINSN 859

Query: 845 GYIFPTDYLSLSANAEKDLTKLAGYFRLLFQEQNLWTDISTCKLDSNLNR 894
            YI+P+++L +SAN E D+ +L  YF  + + + +  ++S  KL ++ N+
Sbjct: 860 AYIYPSNFLEISANVETDIQRLVPYFSHVCERKQIGYNVSAHKLTADFNK 909

>NDAI0G00670 Chr7 (146574..149480) [2907 bp, 968 aa] {ON} Anc_2.288
           YNL023C
          Length = 968

 Score =  924 bits (2387), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/916 (50%), Positives = 581/916 (63%), Gaps = 22/916 (2%)

Query: 9   ATAKLEGIPYYEQTVLELRDGETYQCLICTVEMDASCPMYACHQCYRVYDYECIRRWALK 68
           ATA  E + YYE+T+ E+  G++Y C+ICTVEMD +C MYAC +CYRV+DY+CIR WA+K
Sbjct: 51  ATAADEDMKYYERTIQEIAKGDSYVCMICTVEMDYTCQMYACKECYRVFDYDCIREWAVK 110

Query: 69  ATSTTVDRTWKCPNCYHVNRKVPPKNRHTCWCGKQVNLDPNYINPNSCGQTCGAPICQHG 128
           +T  TVDR WKCPNCYHVN+KVPPKNR TCWCGK VN + N +NPNSCGQTC A IC HG
Sbjct: 111 STEKTVDRIWKCPNCYHVNKKVPPKNRSTCWCGKVVNPEANPLNPNSCGQTCNAKICVHG 170

Query: 129 CSKLCHLGPHEECMVRIDFKCRCGKLTEEIPCYEAKAAKRN--FSCDQPCGLPMPCGIHK 186
           C+ +CHLGPH EC   +   CRCGK T++I CY++K  K N  F C   CGLP+ CGIHK
Sbjct: 171 CTNICHLGPHPECTRMLSITCRCGKHTKDIFCYQSKTFKGNSKFQCKDECGLPLSCGIHK 230

Query: 187 CERVCHNGPCGPC------KEEIAGDIKCYCGLTTRNKMVCSEVSVVARSKVS---KYKS 237
           C+R CH+G CG C       EE A  +KCYCG  T+  M C ++ +   +K S   +   
Sbjct: 231 CKRKCHSGLCGVCPERLEVNEENAWILKCYCGSETQKSMKCKDIKIPESAKYSSDAEGNK 290

Query: 238 WIGAFACDRMREVPYSCGKHSFHEKCIAPPSLPKRTPCPYSPENCTTCPCGKTQLAELGS 297
           WIG FAC  +R V Y C KHSF E+CIAPP+L    PCPYSP+   TCPCGKT L +L  
Sbjct: 291 WIGVFACKEIRTVQYDCDKHSFIERCIAPPTLSMEKPCPYSPKLLKTCPCGKTPLQKLAK 350

Query: 298 TRTACTDHISSCGKVCGKQLSCGNHTCPMTCHDGNCMDPCLVITEQKCACEQRRFLVPCQ 357
            RT CTD I +C   C K L CG H CP  CH G CMDPCL I  +KC+CEQ+ FLVPCQ
Sbjct: 351 PRTLCTDPIPTCESHCNKPLKCGKHKCPFKCHTGACMDPCLQIETRKCSCEQQSFLVPCQ 410

Query: 358 FPHSPSCTAKCESLMSCRRHRCAERCCSGX-XXXXXXXXXXXXXXXXXXXXXXAQHVCLK 416
           F  SP C  KCESLMSCRRHRC ERCCSG                        A+H+CLK
Sbjct: 411 FTGSPHCNIKCESLMSCRRHRCLERCCSGRPAAEKRKKTLFRSQDLMDETLVEAEHICLK 470

Query: 417 DCNRVLLCGIHMCNYKCHAGKCPPCLESDSNDLICPCGKTIVPAPVRCGTKLPRCTHPCR 476
           +CN +L CGIH C  KCH GKCPPCLESDSNDL+CPCGKTIV APVRCGTKLP C   C 
Sbjct: 471 ECNLLLSCGIHRCQRKCHPGKCPPCLESDSNDLVCPCGKTIVEAPVRCGTKLPPCPFQCI 530

Query: 477 NSLLDTWPCGHSPPSHNCHPLDEPCPPCTITVKKTCRCGK-NEIRTFCYNDDVSCSRPCK 535
             + + +PCGH+P  H CHPLDEPCPPCT  V K C+CGK  E+RT C+ +DVSC + C 
Sbjct: 531 KVVRNEYPCGHTPMPHTCHPLDEPCPPCTAPVFKPCKCGKVKEVRTLCFQNDVSCGKICG 590

Query: 536 KPLSYCNHFCQVPCHSDGQCQQTCKQACGLPRKACEHVCKAKCHGHTACPESPCTEKKTI 595
            PL  C H C   CH  G CQ  CKQ CG  R  C+H C   CHG+T CP+ PCT    +
Sbjct: 591 LPLKDCPHKCMKRCHIPGDCQTKCKQICGKRRINCDHTCSRPCHGNTECPDVPCTVSAKV 650

Query: 596 TCSCGHKSSTKICSEYAGKDDGIGASQHLSCDEDCAKFQRHQQLMRAFGVVEKATSEEDE 655
           TC CG + +   C   +     +  +  L CDE+C   +RH+QL  AFG+ E  +S  D 
Sbjct: 651 TCECGRRETYVTCGAMSNIASAVTTTI-LECDEECEMLERHRQLKEAFGIKEIISSSTDL 709

Query: 656 ALL----LAQRSQSFDDLHLPFTEYVLSVFTKQSQWCTQIEQYLIKLMDDSSPKALHFKP 711
                  +   + +F++L LPFTE  LS+F++Q +WC QIE+ + K MDD S  +LHFKP
Sbjct: 710 EFERLKDIVPTAIAFEELQLPFTEATLSIFSRQERWCQQIEEIINKFMDDKSRPSLHFKP 769

Query: 712 MRAAQRRFVHELSSSFGLYSESQDPEPKRSVYVKKTGISRVPAIGLSKAAPLYTSFKKLE 771
           MR  QR F+HELS ++ LY ESQDPEPKRSV++KK   S  P+  LSK  PLY +FK+LE
Sbjct: 770 MRPPQRHFIHELSKAYNLYCESQDPEPKRSVFIKKNTTSSKPSFSLSKVLPLYQTFKELE 829

Query: 772 REFKANS-ESAVTKKLVSVHIDDSPESQHDAAINAILLSGLTSFASESALRDCFADYFSQ 830
           +E K    E+  +K+LV+V + + P   + A  N  L+  L+   +   L   F  Y   
Sbjct: 830 KERKLQEFEARTSKRLVNVEVPEGPTDNYIAEANGFLIKDLSPGTTVEDLERIFGQYLKS 889

Query: 831 TLLNCPQYVV--RGTEGYIFPTDYLSLSANAEKDLTKLAGYFRLLFQEQNLWTDISTCKL 888
           TL+  PQY+V   G  G I+P DY +++AN E+D   L G+F +L ++  +   +  CK+
Sbjct: 890 TLIKNPQYLVLQDGKSGVIYPEDYPTITANVERDFKSLVGHFDVLAKDTFISEGVELCKI 949

Query: 889 DSNLNRIGSCESPAAD 904
           D  L+      +PA D
Sbjct: 950 DDVLS-TERLATPAID 964

>SAKL0E07634g Chr5 complement(616444..619368) [2925 bp, 974 aa] {ON}
           similar to uniprot|P53971 Saccharomyces cerevisiae
           YNL023C
          Length = 974

 Score =  915 bits (2365), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/889 (50%), Positives = 582/889 (65%), Gaps = 6/889 (0%)

Query: 16  IPYYEQTVLELRDGETYQCLICTVEMDASCPMYACHQCYRVYDYECIRRWALKATSTTVD 75
           +PYYE+T+ E++ G++Y C+ICT+EMD +C MYAC +CYRVYD+ECIR WALK++  ++D
Sbjct: 48  LPYYEKTIHEIQKGDSYACMICTMEMDYTCHMYACPECYRVYDHECIREWALKSSQKSLD 107

Query: 76  RTWKCPNCYHVNRKVPPKNRHTCWCGKQVNLDPNYINPNSCGQTCGAPICQHGCSKLCHL 135
           +TWKCPNCY+VN ++P KNRHTCWCGK V+ + N I+PNSCGQTC APIC HGCSK CHL
Sbjct: 108 KTWKCPNCYYVNSEIPVKNRHTCWCGKVVHPESNPIDPNSCGQTCNAPICSHGCSKPCHL 167

Query: 136 GPHEECMVRIDFKCRCGKLTEEIPCYEAKAAKRNFSCDQPCGLPMPCGIHKCERVCHNGP 195
           GPH ECM     KC CGK T+++ CY+++  K ++ C +PC L +PCG+HKC+R CH+GP
Sbjct: 168 GPHPECMRTTKVKCLCGKHTKDMFCYQSEEEKASYQCGEPCNLLLPCGVHKCQRKCHSGP 227

Query: 196 CGPCKEEIAGDIKCYCGLTTRNKMVCSEVSVVARSKVSKYKSWIGAFACDRMREVPYSCG 255
           CG C+E I+G I CYCG+ TR +++C +V  VA+SK    + WIG F+C  +R V YSCG
Sbjct: 228 CGNCEETISGKIMCYCGMETREQIICKDVKSVAKSKNKSGEIWIGVFSCAHLRSVEYSCG 287

Query: 256 KHSFHEKCIAPPSLPKRTPCPYSPENCTTCPCGKTQLAELGSTRTACTDHISSCGKVCGK 315
            HSF E C APP+      CP+SP    TCPCG T L  L + R  CTD I +C   C K
Sbjct: 288 HHSFQESCTAPPTNSGELACPFSPRLLKTCPCGSTPLKLLEAPRKKCTDPIPTCENRCNK 347

Query: 316 QLSCGNHTCPMTCHDGNCMDPCLVITEQKCACEQRRFLVPCQFPHSPSCTAKCESLMSCR 375
            L CG H+CP  CHDG CMDPC+ + +  C+C  + FLVPCQF     C  KCESLMSCR
Sbjct: 348 PLKCGKHSCPFVCHDGPCMDPCVSVDKVSCSCHSKSFLVPCQFHDEAHCNTKCESLMSCR 407

Query: 376 RHRCAERCCSGXXXXXXXXXXX-XXXXXXXXXXXXAQHVCLKDCNRVLLCGIHMCNYKCH 434
           RHRC ERCCSG                        AQH+CLK CN  L CGIH C  KCH
Sbjct: 408 RHRCTERCCSGRSLAIKREKTIFLARDRLDESLVEAQHICLKPCNLKLSCGIHYCRRKCH 467

Query: 435 AGKCPPCLESDSNDLICPCGKTIVPAPVRCGTKLPRCTHPCRNSLLDTWPCGHSPPSHNC 494
            GKC PCLESDSNDL CPCGKT+VPAPVRCGTKLP C HPC  +L     CGH P  H C
Sbjct: 468 PGKCSPCLESDSNDLSCPCGKTVVPAPVRCGTKLPPCRHPCIKTLQADTVCGHPPMPHEC 527

Query: 495 HPLDEPCPPCTITVKKTCRCGKNE-IRTFCYNDDVSCSRPCKKPLSYCNHFCQVPCHSDG 553
           H L++PCP CT  + K C+C K E +RT C+ +DVSC + C  PL  C+H C+  CH  G
Sbjct: 528 HSLEQPCPQCTAPIYKKCKCNKVEKVRTLCFQNDVSCGKICGLPLKNCSHTCKRTCHEPG 587

Query: 554 QCQQTCKQACGLPRKACEHVCKAKCHGHTACPESPCTEKKTITCSCGHKSSTKICSEYAG 613
           QCQ  CKQ CGLPRK CEH C A+CH    CP+  C  K  +TCSCG K S   C  +A 
Sbjct: 588 QCQTICKQICGLPRKFCEHKCFARCHPGKDCPDEACQVKVKVTCSCGRKESILPCDAHAD 647

Query: 614 KDDGIGASQHLSCDEDCAKFQRHQQLMRAFGVVEKATSEEDEALLLAQRSQSFDDLHLPF 673
           +         L CD+ C + +RH+ LM AFG+ EK T+  +E   L + ++SFD+LHLPF
Sbjct: 648 QPSS-KLLITLPCDDKCEESKRHRMLMEAFGIKEKLTAPVEELRDLVESAKSFDELHLPF 706

Query: 674 TEYVLSVFTKQSQWCTQIEQYLIKLMDDSSPKALHFKPMRAAQRRFVHELSSSFGLYSES 733
           TE  LSV++KQ  WC QIE +L KLM D +  +LHFKPM+  QRRF+HEL++++ LYSES
Sbjct: 707 TESTLSVYSKQRAWCNQIESFLSKLMRDVTRTSLHFKPMKLPQRRFIHELANAYALYSES 766

Query: 734 QDPEPKRSVYVKKT-GISRVPAIGLSKAAPLYTSFKKLEREFKANS-ESAVTKKLVSVHI 791
           QD EPKRSV+VKK    S +P + L +A PLY SFK+L++E K    E + T++L +  +
Sbjct: 767 QDREPKRSVFVKKVENKSHIPLLCLGEALPLYHSFKQLQKERKVKELEKSTTRRLFNYTV 826

Query: 792 DDSPESQHDAAINAILLSGLTSFASESALRDCFADYFSQTLLNCPQY-VVRGTEGYIFPT 850
           DD+ +  H+A  N  L+ G+    ++  L DC A+Y   TL+  P Y  +   +  I+P 
Sbjct: 827 DDANDVPHNAEFNCFLVKGVAPGVTKDELSDCLAEYLQFTLIQNPSYQTLENGDFLIYPE 886

Query: 851 DYLSLSANAEKDLTKLAGYFRLLFQEQNLWTDISTCKLDSNLNRIGSCE 899
           D++S+S N E D+ +LA Y   + +E+ +   +   K+D NL    S E
Sbjct: 887 DHMSISENVENDIKRLAPYISSICKEKQISEGVKLYKIDENLKTFTSEE 935

>KNAG0H01990 Chr8 complement(349855..352776) [2922 bp, 973 aa] {ON}
           Anc_2.288 YNL023C
          Length = 973

 Score =  882 bits (2279), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/908 (49%), Positives = 569/908 (62%), Gaps = 26/908 (2%)

Query: 10  TAKLEGIPYYEQTVLELRDGETYQCLICTVEMDASCPMYACHQCYRVYDYECIRRWALKA 69
           T + + +PYYE+ V E+  G+ Y C+ICTVEMD +C M+AC +CYRV+DY+C+R WA+K+
Sbjct: 45  TEEDQDLPYYERAVREIAKGDLYTCMICTVEMDYTCKMFACRKCYRVFDYDCVREWAIKS 104

Query: 70  TSTTVDRTWKCPNCYHVNRKVPPKNRHTCWCGKQVNLDPNYINPNSCGQTCGAPICQHGC 129
           T  TVDR WKCPNCY VN+KVP KNR TCWCGK VN +PN ++PNSCGQTC A IC HGC
Sbjct: 105 TDKTVDRIWKCPNCYLVNKKVPTKNRPTCWCGKVVNPEPNPLDPNSCGQTCDAKICIHGC 164

Query: 130 SKLCHLGPHEECMVRIDFKCRCGKLTEEIPCYEAKAAK-RN-FSCDQPCGLPMPCGIHKC 187
           SK+CHLGPH EC+     KCRCGK T+EIPC+E K  + RN F C++PC   +PCGIH+C
Sbjct: 165 SKICHLGPHPECLRTTSVKCRCGKATKEIPCFETKGRRGRNLFQCNEPCNSLLPCGIHRC 224

Query: 188 ERVCHNGPCGPCKEEIA---GD---IKCYCGLTTRNKMVCSEVSVVAR-SKVSKYKSWIG 240
           +++CH+G CG C E +    GD   I CYCG  TRN + C +V+V  R SK +    WIG
Sbjct: 225 QKICHSGLCGSCPENLTVKEGDDVSISCYCGQHTRNSIKCKDVNVTGRKSKNANGDEWIG 284

Query: 241 AFACDRMREVPYSCGKHSFHEKCIAPPSLPKRTPCPYSPENCTTCPCGKTQLAELGSTRT 300
            +AC  +R V YSC +HSF E+CIAPP++     CP+SP+   TC CGKT L  LG  R 
Sbjct: 285 VYACKDIRSVEYSCRQHSFFEECIAPPTVTGTKRCPFSPKYLKTCSCGKTPLQALGKARR 344

Query: 301 ACTDHISSCGKVCGKQLSCGNHTCPMTCHDGNCMDPCLVITEQKCACEQRRFLVPCQFPH 360
            C D I  C   C K L CG HTCP  CHDG CMDPC+ I + KCACE+  FLVPC F  
Sbjct: 345 RCIDPIPHCESRCDKLLKCGKHTCPFQCHDGPCMDPCIQIDKVKCACERNTFLVPCGFQG 404

Query: 361 SPSCTAKCESLMSCRRHRCAERCCSGX-XXXXXXXXXXXXXXXXXXXXXXAQHVCLKDCN 419
           +P C  KCESL+SCRRH+CAERCCSG                        A+HVCLK CN
Sbjct: 405 APHCQLKCESLLSCRRHKCAERCCSGRPAAEERRKNSSRFQDVNDETLMEAEHVCLKACN 464

Query: 420 RVLLCGIHMCNYKCHAGKCPPCLESDSNDLICPCGKTIVPAPVRCGTKLPRCTHPCRNSL 479
             L CG H C  KCH GKCPPCLESDSNDL+CPCGKTIVPAPVRCGTKLP C HPC   +
Sbjct: 465 LTLSCGQHQCQRKCHPGKCPPCLESDSNDLVCPCGKTIVPAPVRCGTKLPSCRHPCIKVV 524

Query: 480 LDTWPCGHSPPSHNCHPLDEPCPPCTITVKKTCRCGKN-EIRTFCYNDDVSCSRPCKKPL 538
                CGH P  H CHPLD+PCPPCT TV K C+CGKN  +RT C+  DVSC + C KPL
Sbjct: 525 EGISECGHKPIPHACHPLDQPCPPCTATVFKPCKCGKNSRVRTICFQKDVSCGQTCGKPL 584

Query: 539 SYCNHFCQVPCHSDGQCQQTCKQACGLPRKACEHVCKAKCHGHTACPESPCTEKKTITCS 598
             C+HFCQ  CH  GQCQ TCKQ C  P   C H C+  CHG   CP+  C     I C 
Sbjct: 585 PNCHHFCQKTCHLPGQCQATCKQVCNKPPVNCAHKCRKSCHGRLTCPDILCIALVKIRCP 644

Query: 599 CGHKSSTKICSEYAGKDDGIGASQHLSCDEDCAKFQRHQQLMRAFGVVEK-----ATSEE 653
           CG K     C   +     +  ++ L CDE+C  + RH+QL  AFG+ +K     A  E+
Sbjct: 645 CGRKEVEVTCGATSTLSSSL-FTERLECDEECEAYTRHRQLKEAFGITDKVANGSAMKEK 703

Query: 654 DEALL--LAQRSQSFDDLHLPFTEYVLSVFTKQSQWCTQIEQYLIKLMDDSSPKALHFKP 711
           +   L  LA ++ +F++L  PFTE  +S + +Q++WC +IE+ L   MD+    +LHFKP
Sbjct: 704 EGTRLEGLASKATTFEELQFPFTESTISTYIRQNKWCGEIEETLNNFMDNEGKSSLHFKP 763

Query: 712 MRAAQRRFVHELSSSFGLYSESQDPEPKRSVYVKKT--GISRVPAIGLSKAAPLYTSFKK 769
           M+  QR F+ EL+ ++ LYSE+QDPEPKRSV+VKK   G S  P   LS+ APLY SFK 
Sbjct: 764 MKPPQRLFIRELAKAYNLYSEAQDPEPKRSVFVKKNDDGSSAKPIFSLSEIAPLYQSFKL 823

Query: 770 LEREFKANSESA-VTKKLVSVHIDD--SPESQHDAAINAILLSGLTSFASESALRDCFAD 826
           LE+E K     A  T  L++V ++D  +  +QH    NA L+  +++  +   L++ F  
Sbjct: 824 LEKERKMQDFLAKTTTHLINVKLNDDVATGAQHSGQNNAFLIKNISAGTTLQDLKNLFGK 883

Query: 827 YFSQTLLNCPQY--VVRGTEGYIFPTDYLSLSANAEKDLTKLAGYFRLLFQEQNLWTDIS 884
           Y  +TL+  PQY  +       ++P DY ++SANA  D+  L G+   +  +  L     
Sbjct: 884 YMEKTLIRNPQYQELPEENSAIVYPEDYRTISANAVNDMENLVGHINFIVNDAFLADSAE 943

Query: 885 TCKLDSNL 892
            C   S L
Sbjct: 944 LCDASSKL 951

>KLTH0G10406g Chr7 (880042..882933) [2892 bp, 963 aa] {ON} similar
           to uniprot|P53971 Saccharomyces cerevisiae YNL023C
          Length = 963

 Score =  881 bits (2276), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/883 (49%), Positives = 560/883 (63%), Gaps = 10/883 (1%)

Query: 17  PYYEQTVLELRDGETYQCLICTVEMDASCPMYACHQCYRVYDYECIRRWALKATSTTVDR 76
           PYYE+T+ E+  G+ Y C+ICTVEMD +C MYAC +CYRV+DYECIR WA+K+T  +V +
Sbjct: 62  PYYEKTIKEIAKGDRYPCMICTVEMDFTCHMYACPECYRVFDYECIREWAVKSTQKSVTK 121

Query: 77  TWKCPNCYHVNRKVPPKNRHTCWCGKQVNLDPNYINPNSCGQTCGAPICQHGCSKLCHLG 136
           TWKCPNCY   + VP KNR TCWCGK ++ +PN +NPNSCGQTC APIC HGCS  CHLG
Sbjct: 122 TWKCPNCYFEKKDVPLKNRPTCWCGKNIHPEPNPLNPNSCGQTCDAPICVHGCSSTCHLG 181

Query: 137 PHEECMVRIDFKCRCGKLTEEIPCYEAKAAKRNFSCDQPCGLPMPCGIHKCERVCHNGPC 196
           PH  CM  +  KCRCGK ++++ C EA+  +  F C  PCGL +PCG+HKC+R CHNG C
Sbjct: 182 PHPTCMRMVQTKCRCGKKSKDVFCSEARKHQELFRCGNPCGLTLPCGVHKCQRECHNGVC 241

Query: 197 GPCKEEIAGDIKCYCGLTTRNKMVCSEVSVVARSKVSKYKSWIGAFACDRMREVPYSCGK 256
           G C E IA +I CYCGL +   + C +V + ++S+    K WIGAFAC R+R V YSC +
Sbjct: 242 GECPETIAKEINCYCGLESLPSIKCQDVKIQSKSQDGSGKKWIGAFACSRIRTVEYSCRE 301

Query: 257 HSFHEKCIAPPSLPKRTPCPYSPENCTTCPCGKTQLAELGSTRTACTDHISSCGKVCGKQ 316
           HSF E C APPS+  R PCPYSP+   TCPCG+T L  + + RT CTD I +C   CGK 
Sbjct: 302 HSFAEPCKAPPSIAGRIPCPYSPKALKTCPCGETPLENMETPRTKCTDPIPTCDATCGKL 361

Query: 317 LSCGNHTCPMTCHDGNCMDPCLVITEQKCACEQRRFLVPCQFPHSPSCTAKCESLMSCRR 376
           LSCG H CP  CH G CM+ C    + KC+C  R F+VPC+F   P C  KCESLMSCRR
Sbjct: 362 LSCGRHRCPFKCHTGTCMEICTCSDKIKCSCNSRPFIVPCKFQGPPRCNTKCESLMSCRR 421

Query: 377 HRCAERCCSGXXXXXXXXXXX-XXXXXXXXXXXXAQHVCLKDCNRVLLCGIHMCNYKCHA 435
           HRCAERCC G                        AQH+CLK CN  L CG H C  KCH 
Sbjct: 422 HRCAERCCDGRSLAQVREKKVFLTRDKLDESLVEAQHICLKKCNLKLSCGRHFCQRKCHP 481

Query: 436 GKCPPCLESDSNDLICPCGKTIVPAPVRCGTKLPRCTHPCRNSLLDTWPCGHSPPSHNCH 495
           G CPPCLESDSNDL+CPCGKT+ PAPVRCGT LP C +PC  +L     CGH P  H CH
Sbjct: 482 GNCPPCLESDSNDLVCPCGKTVAPAPVRCGTVLPPCRNPCIKTLQGPLDCGHPPMPHACH 541

Query: 496 PLDEPCPPCTITVKKTCRCGKN-EIRTFCYNDDVSCSRPCKKPLSYCNHFCQVPCHSDGQ 554
            LDEPCP CT  V K C+CGKN ++RT C+ ++VSC R C K L  C+H C   CH +G+
Sbjct: 542 SLDEPCPSCTAPVFKQCKCGKNKKVRTLCFQNNVSCGRVCGKQLVSCHHSCTKTCHREGE 601

Query: 555 CQQTCKQACGLPRKACEHVCKAKCHGHTACPESPCTEKKTITCSCGHKSSTKICSEYAGK 614
           CQ  CKQ CG+ R  C H+C+ KCH  + CP+ PC     + C CGH+SS   C+ + G+
Sbjct: 602 CQSICKQVCGISRSNCSHICRFKCHTGSPCPDVPCNVTVEVKCGCGHRSSFATCAAHEGQ 661

Query: 615 DDGIGASQHLSCDEDCAKFQRHQQLMRAFGVVEKATSEEDEALL----LAQRSQSFDDLH 670
           D      + L C EDCA  +R  +LM AFG +   T +  E ++    LA++  +F +L 
Sbjct: 662 DP--ADQRPLECTEDCAAARRRLELMEAFG-MNTETVQPTEGIVDLAALAEKVTTFQELM 718

Query: 671 LPFTEYVLSVFTKQSQWCTQIEQYLIKLMDDSSPKALHFKPMRAAQRRFVHELSSSFGLY 730
           LPFTE  LS+F KQS WC+QIE++L +LM D S  +LHFKPM+  QR F+HEL+ ++ LY
Sbjct: 719 LPFTEASLSIFAKQSNWCSQIEEHLNRLMSDISKPSLHFKPMKPPQRHFIHELAQAYKLY 778

Query: 731 SESQDPEPKRSVYVKKTGISRVPAIGLSKAAPLYTSFKKLEREFKANSESAVTKKLVSVH 790
            ESQD EPKRSVYVKKT  SR P++ L +A PLY SFK  ++E K       T   +  +
Sbjct: 779 CESQDKEPKRSVYVKKTVDSRKPSLSLKEALPLYQSFKNAQKERKLKELERSTTTRILNY 838

Query: 791 IDDSPESQHDAAINAILLSGLTSFASESALRDCFADYFSQTLLNCPQYV-VRGTEGYIFP 849
                 S   A IN +L+  +     E  +  CFADY   TL+  P Y+ +   +  +F 
Sbjct: 839 TSTGESSPPVAQINGLLIQKVFEGTDEKTIEACFADYLKHTLIKDPNYLKLDSGDVMVFA 898

Query: 850 TDYLSLSANAEKDLTKLAGYFRLLFQEQNLWTDISTCKLDSNL 892
            +Y + S N E+D+ ++ G+  L+ ++  L   ++ C+++  +
Sbjct: 899 ENYATASINVERDINRVVGHLDLIAKDSFLAEGVTVCRVEQVM 941

>Kwal_27.11518 s27 complement(832986..835847) [2862 bp, 953 aa] {ON}
           YNL023C (FAP1) - Transcription factor homolog;
           similarity to Drosophila melanogaster shuttle craft
           protein; similarity to human NFX1 protein; similarity to
           human DNA-binding protein tenascin [contig 27] FULL
          Length = 953

 Score =  877 bits (2267), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/903 (48%), Positives = 578/903 (64%), Gaps = 9/903 (0%)

Query: 8   DATAKLEGIPYYEQTVLELRDGETYQCLICTVEMDASCPMYACHQCYRVYDYECIRRWAL 67
           D   +LE  PYYE+TV E+  G+ Y C+ICTVEMD +C MYAC  CYRV+D+ECIR WAL
Sbjct: 35  DEIDELEDQPYYEKTVKEIEKGDRYPCMICTVEMDFTCHMYACPDCYRVFDFECIREWAL 94

Query: 68  KATSTTVDRTWKCPNCYHVNRKVPPKNRHTCWCGKQVNLDPNYINPNSCGQTCGAPICQH 127
           K+T  +V +TWKCPNCY   ++VP KNR TCWCGK V  +PN +NPNSCGQTC A IC+H
Sbjct: 95  KSTQKSVSKTWKCPNCYFERKEVPMKNRPTCWCGKSVQPEPNPLNPNSCGQTCDAQICEH 154

Query: 128 GCSKLCHLGPHEECMVRIDFKCRCGKLTEEIPCYEAKAAKRNFSCDQPCGLPMPCGIHKC 187
           GCS +CHLGPH  CM  +  KC CGK  + + C+EA     +F CD PCGL +PCGIHKC
Sbjct: 155 GCSSICHLGPHPTCMRMVQVKCNCGKKNKSVFCHEAGKFVDSFICDSPCGLTLPCGIHKC 214

Query: 188 ERVCHNGPCGPCKEEIAGDIKCYCGLTTRNKMVCSEVSVVARSKVSKYKSWIGAFACDRM 247
           +R CH+G CG C E I G I CYC L ++  + C+EV +  RS+ S    W+GAF+C+ +
Sbjct: 215 QRKCHSGICGECPESIYGTINCYCKLESKPSLKCTEVRIEGRSRDSSGNKWVGAFSCENI 274

Query: 248 REVPYSCGKHSFHEKCIAPPSLPKRTPCPYSPENCTTCPCGKTQLAELGSTRTACTDHIS 307
           R V +SC KHSF E C APPS+  + PCP+SP    TCPCG++ L E+  +R+ CTD I 
Sbjct: 275 RTVEHSCKKHSFAEPCKAPPSISGQVPCPFSPRTLKTCPCGRSPLREMDVSRSQCTDPIP 334

Query: 308 SCGKVCGKQLSCGNHTCPMTCHDGNCMDPCLVITEQKCACEQRRFLVPCQFPHSPSCTAK 367
           +C  VCGK L CG H CP  CH G+CM+ CL   + KC+C  R+F+VPC+F     C  K
Sbjct: 335 TCDSVCGKMLRCGKHKCPFKCHTGSCMEECLCTDKVKCSCHARQFIVPCKFQEKARCNTK 394

Query: 368 CESLMSCRRHRCAERCCSGXXXXXXXXXXX-XXXXXXXXXXXXAQHVCLKDCNRVLLCGI 426
           CE+LMSCRRHRC ERCC G                        AQH+CLK CN  L CG 
Sbjct: 395 CEALMSCRRHRCIERCCDGRSLAQSREKKVFLTRDKLDESLVEAQHICLKQCNLKLSCGK 454

Query: 427 HMCNYKCHAGKCPPCLESDSNDLICPCGKTIVPAPVRCGTKLPRCTHPCRNSLLDTWPCG 486
           H C  KCH G C PCLESDSNDL+CPCGKT+VPAPVRCGT LPRC HPC  +L    PCG
Sbjct: 455 HFCKRKCHPGNCAPCLESDSNDLVCPCGKTVVPAPVRCGTVLPRCLHPCIKTLQGPAPCG 514

Query: 487 HSPPSHNCHPLDEPCPPCTITVKKTCRCGKNE-IRTFCYNDDVSCSRPCKKPLSYCNHFC 545
           H P  H CHPL+EPCP CT  V K+C+C KN+ +RT C+ +DVSC R C K L+ C H C
Sbjct: 515 HPPMPHPCHPLEEPCPSCTAPVFKSCKCRKNDKVRTLCFQNDVSCGRVCGKQLAGCQHIC 574

Query: 546 QVPCHSDGQCQQTCKQACGLPRKACEHVCKAKCHGHTACPESPCTEKKTITCSCGHKSST 605
           Q  CH +G+CQ +CKQ CG  R+ CEH C+A CH  T CP+ PC     I C+CGH+S+T
Sbjct: 575 QKACHKEGECQTSCKQPCGKTRENCEHRCRALCHSGTPCPDKPCLNLVDIKCNCGHRSTT 634

Query: 606 KICSEYAGKDDGIGASQHLSCDEDCAKFQRHQQLMRAFGV---VEKATSEEDEALLLAQR 662
             C   A ++        L C+ DC   +RH +LM AFG+     + +   ++   LA++
Sbjct: 635 VTCG--ANENRAPAEETALECNNDCDVARRHHELMEAFGIKNDANQGSKSLEDLEALAEK 692

Query: 663 SQSFDDLHLPFTEYVLSVFTKQSQWCTQIEQYLIKLMDDSSPKALHFKPMRAAQRRFVHE 722
             +F +L LPF+E  LS+F+KQ+ WCTQIE+ L +LM+D +  +LHFKPMR  QR F+HE
Sbjct: 693 VSTFQELLLPFSEATLSIFSKQTTWCTQIEECLERLMNDKNKPSLHFKPMRPPQRHFIHE 752

Query: 723 LSSSFGLYSESQDPEPKRSVYVKKTGISRVPAIGLSKAAPLYTSFKKLEREFK-ANSESA 781
           L  ++ LY ESQD EPKRSV+VKKT  S+ P+I L  A PLY SFK  +RE K   +E  
Sbjct: 753 LGQAYHLYCESQDQEPKRSVFVKKTADSQRPSISLKVALPLYYSFKSAQREKKLKETERH 812

Query: 782 VTKKLVSVHIDDSPESQHDAAINAILLSGLTSFASESALRDCFADYFSQTLLNCPQYVVR 841
            T ++++  + D  ++   A  N +L+  + +  +E A+++ F++Y   TLL  P Y++ 
Sbjct: 813 TTTRIINYAVTDQAQTPPAARFNGLLVQNVLNGINEKAIQESFSEYLKHTLLKDPHYLLL 872

Query: 842 GT-EGYIFPTDYLSLSANAEKDLTKLAGYFRLLFQEQNLWTDISTCKLDSNLNRIGSCES 900
            + +  ++  DY + S N E D+ ++ G+   + +EQ L   +   ++ S L+ + S  S
Sbjct: 873 ASGDVLVYCDDYSTASVNVENDIERIVGHLDHIVKEQLLAEGVYATRVQSFLDDLESSTS 932

Query: 901 PAA 903
            AA
Sbjct: 933 DAA 935

>KAFR0H03300 Chr8 complement(627520..630420) [2901 bp, 966 aa] {ON}
           Anc_2.288 YNL023C
          Length = 966

 Score =  871 bits (2250), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/907 (47%), Positives = 574/907 (63%), Gaps = 19/907 (2%)

Query: 4   DMPLDATAKLEGIPYYEQTVLELRDGETYQCLICTVEMDASCPMYACHQCYRVYDYECIR 63
           D  +D  +  + + YYE+ + E+  G++Y C+ICTVEMD +C MYAC +C R++DY+CIR
Sbjct: 41  DEEMDVLSDNDDMMYYERAIQEIAAGDSYICMICTVEMDYTCKMYACKKCCRIFDYDCIR 100

Query: 64  RWALKATSTTVDRTWKCPNCYHVNRKVPPKNRHTCWCGKQVNLDPNYINPNSCGQTCGAP 123
            WALK+T  T +R WKCPNCYHVN+KVP KNR TCWCGK VN + N +NPNSCGQTC AP
Sbjct: 101 EWALKSTEKTKERIWKCPNCYHVNKKVPTKNRATCWCGKVVNPEKNPLNPNSCGQTCNAP 160

Query: 124 ICQHGCSKLCHLGPHEECMVRIDFKCRCGKLTEEIPCYEAK--AAKRN-FSCDQPCGLPM 180
           +C HGCSK+CHLGPH EC+  I  KC CGK   +I C+++K  + +RN FSC++ CGLP+
Sbjct: 161 VCIHGCSKICHLGPHPECLRTITMKCDCGKHERQISCFQSKSQSGRRNRFSCEEECGLPL 220

Query: 181 PCGIHKCERVCHNGPCGPC------KEEIAGDIKCYCGLTTRNKMVCSEVSV-VARSKVS 233
            CGIH C++ CH+G CG C       EE    IKCYCGL T+    C +V      S+ +
Sbjct: 221 SCGIHTCKKKCHSGLCGSCPELLEVNEEKCATIKCYCGLETKKSFPCKDVKAPTTLSRDA 280

Query: 234 KYKSWIGAFACDRMREVPYSCGKHSFHEKCIAPPSLPKRTPCPYSPENCTTCPCGKTQLA 293
           +   W+G F+C+++R V YSC KHSF E C+APP++     CP+SP    TCPCG+T L 
Sbjct: 281 EGNKWVGVFSCNKIRNVEYSCQKHSFVESCVAPPTVSGTKQCPFSPNLLKTCPCGRTPLN 340

Query: 294 ELGSTRTACTDHISSCGKVCGKQLSCGNHTCPMTCHDGNCMDPCLVITEQKCACEQRRFL 353
            L   R  CTD + +C   C K L CG H CP TCH+G CMDPC+ I ++ C+C Q  FL
Sbjct: 341 ALSKPRLKCTDPVPTCEACCNKPLKCGKHRCPFTCHNGPCMDPCIQIDKKPCSCHQSFFL 400

Query: 354 VPCQFPHSPSCTAKCESLMSCRRHRCAERCCSGX-XXXXXXXXXXXXXXXXXXXXXXAQH 412
            PCQF   P C  KCESLMSCRRHRC ERCCSG                        AQH
Sbjct: 401 TPCQFEGEPHCNIKCESLMSCRRHRCTERCCSGRPLAEKRKKTLFRSSDINDETLVEAQH 460

Query: 413 VCLKDCNRVLLCGIHMCNYKCHAGKCPPCLESDSNDLICPCGKTIVPAPVRCGTKLPRCT 472
           VCLK+CN +L CG H C  KCH GKCPPCLESDSNDL+CPCGKT+V APVRCGTKL  C 
Sbjct: 461 VCLKECNLMLSCGKHRCQRKCHPGKCPPCLESDSNDLVCPCGKTVVEAPVRCGTKLSPCL 520

Query: 473 HPCRNSLLDTWPCGHSPPSHNCHPLDEPCPPCTITVKKTCRCGK-NEIRTFCYNDDVSCS 531
            PC   + +   CGH P  H+CHPLD+PCPPCT TV K C+CGK +++RT C+  DVSC 
Sbjct: 521 FPCIKVIRNESVCGHPPVPHSCHPLDQPCPPCTATVFKPCKCGKRDKVRTVCFQKDVSCG 580

Query: 532 RPCKKPLSYCNHFCQVPCHSDGQCQQTCKQACGLPRKACEHVCKAKCHGHTACPESPCTE 591
           + C  PL  C+H CQ  CH +G+CQ  CKQ C   R  C H C   CHG T C +SPC  
Sbjct: 581 KICGLPLLTCHHKCQKVCHPNGECQVKCKQVCRKKRVNCVHECLKSCHGSTECSDSPCPV 640

Query: 592 KKTITCSCGHKSSTKICSEYAGKDDGIGASQHLSCDEDCAKFQRHQQLMRAFGVVEKATS 651
              I+C CG + S   C+  +  D     ++ L C+E+C   +RH++L  AFG+VEK   
Sbjct: 641 STKISCPCGRRESYVTCNATSTIDSAALITR-LDCNEECEVVKRHRELREAFGIVEKEEP 699

Query: 652 EE---DEALLLAQRSQSFDDLHLPFTEYVLSVFTKQSQWCTQIEQYLIKLMDDSSPKALH 708
           E    +     AQ + ++DDL LP+TE  L  +TKQ  WC QIE+ LIK MDD+S  +LH
Sbjct: 700 ENLGTERLQSFAQSATNYDDLQLPYTEPALVAYTKQPNWCEQIEELLIKFMDDNSRPSLH 759

Query: 709 FKPMRAAQRRFVHELSSSFGLYSESQDPEPKRSVYVKKT--GISRVPAIGLSKAAPLYTS 766
           FKPMR  QR F+HE++ +F LY+ESQD EPKRSV++KK   G S  PA+ LS   P+Y +
Sbjct: 760 FKPMRPPQRYFIHEIAKAFNLYAESQDREPKRSVFLKKNDDGTSLKPALRLSDVLPVYQN 819

Query: 767 FKKLEREFKANS-ESAVTKKLVSVHIDDSPESQHDAAINAILLSGLTSFASESALRDCFA 825
           FKKLE+E KA   E+  T +L+++ +DD+ E +     N +++  L++  +   L + F 
Sbjct: 820 FKKLEKERKAKQFEARTTARLMNITLDDTLEERKKFENNGLIIKNLSNGITLEFLSEFFN 879

Query: 826 DYFSQTLLNCPQYVVRGTEGYIFPTDYLSLSANAEKDLTKLAGYFRLLFQEQNLWTDIST 885
            +F  TL+  PQY++    G I+P  +  ++     DL  L G+F ++ +E+ +   +  
Sbjct: 880 KFFKSTLIKNPQYLIIENNGLIYPESHNEITQGVYNDLDMLVGHFNVIVKEELIGDSVEM 939

Query: 886 CKLDSNL 892
           C +++ L
Sbjct: 940 CNIENEL 946

>Smik_14.308 Chr14 complement(550650..553547) [2898 bp, 965 aa] {ON}
           YNL023C (REAL)
          Length = 965

 Score =  868 bits (2243), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/901 (49%), Positives = 555/901 (61%), Gaps = 21/901 (2%)

Query: 14  EGIPYYEQTVLELRDGETYQCLICTVEMDASCPMYACHQCYRVYDYECIRRWALKATSTT 73
           + + YYE+++ E+  G++Y C+ICTVEMD +C M+AC +CYRV+DY CIR WA+K+T  T
Sbjct: 48  DDMQYYERSIQEISKGDSYICMICTVEMDYTCQMFACKRCYRVFDYGCIREWAIKSTEKT 107

Query: 74  VDRTWKCPNCYHVNRKVPPKNRHTCWCGKQVNLDPNYINPNSCGQTCGAPICQHGCSKLC 133
           VDR WKCPNCYHV +KVP  NR TCWCGK VN DPN ++PNSCGQTC APIC HGCSK C
Sbjct: 108 VDRIWKCPNCYHVGKKVPANNRPTCWCGKVVNPDPNPLDPNSCGQTCSAPICIHGCSKTC 167

Query: 134 HLGPHEECMVRIDFKCRCGKLTEEIPCYEAKAAKRNFSCDQPCGLPMPCGIHKCERVCHN 193
           HLGPH EC   ++  C CGK ++ I CY++KA K+NF C + CGLP+ C +H C+R CH 
Sbjct: 168 HLGPHPECTRMVEIMCHCGKHSQSIFCYQSKAMKKNFKCQEECGLPLSCSVHNCKRKCHT 227

Query: 194 GPCGPCKEEIAG------DIKCYCGLTTRNKMVCSEVSVVARSKVSK---YKSWIGAFAC 244
           G CGPC E I         IKCYCG  +R  + CSE       + SK      WIG FAC
Sbjct: 228 GLCGPCPELITSKDSTEEQIKCYCGNHSRASIKCSEARFPKSGRSSKDGNGNEWIGVFAC 287

Query: 245 DRMREVPYSCGKHSFHEKCIAPPSLPKRTPCPYSPENCTTCPCGKTQLAELGSTRTACTD 304
             +R V +SC KHSF E C++PPS+  R  CP+ P    TCPCG+T L EL   R  C D
Sbjct: 288 TDIRTVDFSCRKHSFIEPCLSPPSVNGRKVCPFLPSLLKTCPCGRTALDELTKPRKHCDD 347

Query: 305 HISSCGKVCGKQLSCGNHTCPMTCHDGNCMDPCLVITEQKCACEQRRFLVPCQFPHSPSC 364
            I +C   C K L CG H+CP  CHD  CMDPCL I   KCACEQ  F VPC F   P C
Sbjct: 348 PIPTCNSRCSKPLKCGKHSCPFICHDLACMDPCLQIDSAKCACEQSTFSVPCGFQGRPRC 407

Query: 365 TAKCESLMSCRRHRCAERCCSGX-XXXXXXXXXXXXXXXXXXXXXXAQHVCLKDCNRVLL 423
             KCESLMSCRRHRC +RCCSG                        A+H+CLK CN  L 
Sbjct: 408 NIKCESLMSCRRHRCTDRCCSGRPSAVKRRKNFFRSQDLLDESLVEAKHICLKPCNLTLS 467

Query: 424 CGIHMCNYKCHAGKCPPCLESDSNDLICPCGKTIVPAPVRCGTKLPRCTHPCRNSLLDTW 483
           CGIH C  KCH GKCPPCLESDSNDLICPCGKT+VPAPVRCGT+LP C HPC   +    
Sbjct: 468 CGIHKCQRKCHPGKCPPCLESDSNDLICPCGKTVVPAPVRCGTELPVCNHPCIKVVRGES 527

Query: 484 PCGHSPPSHNCHPLDEPCPPCTITVKKTCRCG-KNEIRTFCYNDDVSCSRPCKKPLSYCN 542
            CGH P  H CHPL  PCPPCT TV K C+CG K+++RT C+  DVSC   C   L +C 
Sbjct: 528 SCGHKPMPHTCHPLGVPCPPCTETVFKPCKCGKKDKVRTVCFQKDVSCGTKCGLLLHFCR 587

Query: 543 HFCQVPCHSDGQCQQTCKQACGLPRKACEHVCKAKCHGHTACPESPCTEKKTITCSCGHK 602
           H CQ  CH  G CQ+ CKQ CG  R +C H C   CHG T CP+ PC     ITC CG  
Sbjct: 588 HTCQKTCHLPGNCQKVCKQICGHERLSCRHTCPKPCHGKTECPDLPCPTLVKITCKCGRN 647

Query: 603 SSTKICSEYAGKDDGIGASQHLSCDEDCAKFQRHQQLMRAFGVVEKA---TSEEDEAL-L 658
             +  CS  +G       S  L CDE+C   +R ++L  AFG+ E++   TS E +AL  
Sbjct: 648 EKSVTCSAKSGVVPA-NESSVLDCDEECEALKRLKELREAFGIKEESNNVTSNELDALKK 706

Query: 659 LAQRSQSFDDLHLPFTEYVLSVFTKQSQWCTQIEQYLIKLMDDSSPKALHFKPMRAAQRR 718
           L   + +F++LHLPFTE  LSV++KQ +WC+QIE  L KLMDD +  +LHFKPMR  QR 
Sbjct: 707 LVSVATTFEELHLPFTETTLSVYSKQERWCSQIEVILNKLMDDKTRSSLHFKPMRPPQRH 766

Query: 719 FVHELSSSFGLYSESQDPEPKRSVYVKK--TGISRVPAIGLSKAAPLYTSFKKLEREFKA 776
           F+ EL+ ++GLYSESQD EP RSV++KK   G S  P + L +A PLY SFK+L++E K 
Sbjct: 767 FIRELAKAYGLYSESQDREPMRSVFIKKEDNGTSNKPVLSLGEALPLYESFKQLQKERKV 826

Query: 777 NS-ESAVTKKLVSVHIDDSPESQHDAAINAILLSGLTSFASESALRDCFADYFSQTLLNC 835
              +S  T KL++  + D+      A  N  L+  L +  +   L+  F  +   TL+  
Sbjct: 827 QEFQSRTTAKLINFEVQDAQPKVEVAKNNGFLVRNLVTGNTVEDLKRFFEPHLKHTLVVN 886

Query: 836 PQYVV--RGTEGYIFPTDYLSLSANAEKDLTKLAGYFRLLFQEQNLWTDISTCKLDSNLN 893
           PQY++   G    ++P +Y + S N E+D+  L G+F  + +E  L   I  C  D  + 
Sbjct: 887 PQYLILDDGKTALVYPENYETASVNTERDMELLVGHFDFMAKEAFLADSILLCSTDEEVG 946

Query: 894 R 894
           +
Sbjct: 947 K 947

>CAGL0M06919g Chr13 complement(703702..706572) [2871 bp, 956 aa]
           {ON} similar to uniprot|P53971 Saccharomyces cerevisiae
           YNL023c FAP1
          Length = 956

 Score =  867 bits (2240), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/897 (49%), Positives = 567/897 (63%), Gaps = 21/897 (2%)

Query: 16  IPYYEQTVLELRDGETYQCLICTVEMDASCPMYACHQCYRVYDYECIRRWALKATSTTVD 75
           + YYE+ V E+  G++Y CLICTVE+D +C +YAC +CYRVYDYECIR WA K+TS   D
Sbjct: 59  MAYYEKAVQEIVKGDSYSCLICTVELDYTCKLYACEKCYRVYDYECIREWAEKSTSKRTD 118

Query: 76  RTWKCPNCYHVNRKVPPKNRHTCWCGKQVNLDPNYINPNSCGQTCGAPICQHGCSKLCHL 135
           + W CPNC++  + +P KNR TCWCG+QVN +PN +NPNSCGQTC A IC HGCS++CHL
Sbjct: 119 KLWACPNCFYTKKAIPKKNRPTCWCGEQVNPEPNPLNPNSCGQTCNAKICSHGCSQICHL 178

Query: 136 GPHEECMVRIDFKCRCGKLTEEIPCYEAKAAKRNFSCDQPCGLPMPCGIHKCERVCHNGP 195
           GPH+EC   +  KC CGK+T++I C++ +   + F+C+  C   +PCGIHKC R CH G 
Sbjct: 179 GPHQECTRMMSIKCSCGKVTKDIVCFQRRLYSKGFNCETVCDKLLPCGIHKCNRKCHTGL 238

Query: 196 CGPCKEEIAG-----DIKCYCGLTTRNKMVCSEVSV---VARSKVSKYKSWIGAFACDRM 247
           CG C E I        I+CYCG T+++K+ C +V      A SK  K + WIG F CD++
Sbjct: 239 CGSCPETIISKNTNMKIRCYCGQTSKDKIKCKDVRFPANAAYSKDDKGQRWIGVFMCDKI 298

Query: 248 REVPYSCGKHSFHEKCIAPPSLPKRTPCPYSPENCTTCPCGKTQLAELGSTRTACTDHIS 307
           R+VPY CG+HSF+EKC APPS+  R  C +SP+   TCPCGK +L +L   R+ CTD I 
Sbjct: 299 RKVPYECGEHSFYEKCKAPPSISGRLICEFSPKKLKTCPCGKNELTDLSKPRSKCTDAIP 358

Query: 308 SCGKVCGKQLSCGNHTCPMTCHDGNCMDPCLVITEQKCACEQRRFLVPCQFPHSPSCTAK 367
           +CG+VCGK L CG H CP  CH G+CMDPC  I + +CACEQ++F +PC F     C  K
Sbjct: 359 TCGQVCGKMLKCGKHKCPFACHLGDCMDPCTQIEKVRCACEQKQFTIPCGFNDHARCNLK 418

Query: 368 CESLMSCRRHRCAERCCSGXXXXXXXXXXXXXXXXXXXXXXXAQ--HVCLKDCNRVLLCG 425
           CESLMSCRRHRC ERCC+G                        +  H+CLKDCN  L CG
Sbjct: 419 CESLMSCRRHRCTERCCAGRPLAERRRKTMKINVRDLADESTIEPIHICLKDCNLTLSCG 478

Query: 426 IHMCNYKCHAGKCPPCLESDSNDLICPCGKTIVPAPVRCGTKLPRCTHPCRNSLLDTWPC 485
           IH CN KCHAGKCPPCLESDSNDL+CPCGKTIV APVRCGTKLP C +PC   +     C
Sbjct: 479 IHKCNRKCHAGKCPPCLESDSNDLVCPCGKTIVEAPVRCGTKLPNCPYPCIRVVRGETDC 538

Query: 486 GHSPPSHNCHPLDEPCPPCTITVKKTCRCGKNE-IRTFCYNDDVSCSRPCKKPLSYCNHF 544
           GHSP  H CHP D PCP CT TV K C+CGK + +RT C+  DVSC + C + L  C H 
Sbjct: 539 GHSPMPHECHPPDIPCPDCTATVFKPCKCGKEQRVRTVCFMKDVSCGKVCGERLQTCYHK 598

Query: 545 CQVPCHSDGQCQQTCKQACGLPRKACEHVCKAKCHGHTACPESPCTEKKTITCSCGHKSS 604
           CQ  CH  G CQ  CKQ C +PR  C H C   CH    CP+ PCT    ITC CG    
Sbjct: 599 CQKKCHEPGACQTVCKQTCNMPRLYCNHRCPKPCHKFEECPDIPCTALVKITCPCGRIEK 658

Query: 605 TKICSEYAGKDDGIGASQHLSCDEDCAKFQRHQQLMRAFGVVEKATSEEDEALLLAQR-- 662
              C  Y+ K+     S  + CDE+CA  QRH QL  AFG+V+K  +  +E +   ++  
Sbjct: 659 EVTCGVYS-KNKEAQDSTRIVCDEECAVLQRHMQLKEAFGIVDKPQNTHNEEMARLEQVI 717

Query: 663 --SQSFDDLHLPFTEYVLSVFTKQSQWCTQIEQYLIKLMDDSSPKALHFKPMRAAQRRFV 720
             + +F DL LPFTE V++ + +   WCT IE  L KL+DD++  +LHFKPMR  QR F+
Sbjct: 718 STASTFADLDLPFTEPVITTYIRHENWCTDIENTLNKLIDDNNRTSLHFKPMRPPQRYFI 777

Query: 721 HELSSSFGLYSESQDPEPKRSVYVKKT--GISRVPAIGLSKAAPLYTSFKKLEREFK-AN 777
            EL+ ++ LYSESQDPEP RSV+VKK   G S  P + +S+AAPLY S+KKLE+E K AN
Sbjct: 778 RELAKAYNLYSESQDPEPNRSVFVKKNLDGSSTKPILSISEAAPLYQSYKKLEKEKKQAN 837

Query: 778 SESAVTKKLVSVHIDDSPESQHDAAINAILLSGLTSFASESALRDCFADYFSQTLLNCPQ 837
            ES  T +L++   + SPE +  A  N  L++ +  F S   L++ FA Y   TL+  PQ
Sbjct: 838 FESMTTTRLINFTPEMSPELESAARFNGFLVTNVGEFTSTDDLQNLFAPYLKSTLVVEPQ 897

Query: 838 YVV--RGTEGYIFPTDYLSLSANAEKDLTKLAGYFRLLFQEQNLWTDISTCKLDSNL 892
           + +     +  I+P  Y  +S N E+D+  L  +F  L +E  L   +  C +++ L
Sbjct: 898 FQILPERKQAVIYPNKYKEISINVERDMETLVQHFDFLIKESLLAGGVELCNIENVL 954

>NCAS0G03780 Chr7 complement(696877..699750) [2874 bp, 957 aa] {ON} 
          Length = 957

 Score =  866 bits (2238), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/900 (50%), Positives = 580/900 (64%), Gaps = 23/900 (2%)

Query: 14  EGIPYYEQTVLELRDGETYQCLICTVEMDASCPMYACHQCYRVYDYECIRRWALKATSTT 73
           + + YYE+ + E+  G++Y C+ICTVEMD +C MYAC QCYRV+DYECIR WALK+T  T
Sbjct: 48  DAMHYYERAIQEIAKGDSYVCMICTVEMDYTCQMYACKQCYRVFDYECIREWALKSTEKT 107

Query: 74  VDRTWKCPNCYHVNRKVPPKNRHTCWCGKQVNLDPNYINPNSCGQTCGAPICQHGCSKLC 133
           VDR WKCPNCYHVN+KVPPKNR TCWCGK VN +PN +NPNSCGQTC A  C HGCSK+C
Sbjct: 108 VDRIWKCPNCYHVNKKVPPKNRPTCWCGKVVNPEPNPLNPNSCGQTCNAHTCVHGCSKIC 167

Query: 134 HLGPHEECMVRIDFKCRCGKLTEEIPCYEAKA--AKRNFSCDQPCGLPMPCGIHKCERVC 191
           HLGPH EC   I  KCRCGK T++I CY++     K  F CD+PCGLP+ CG+H+C++ C
Sbjct: 168 HLGPHPECTRIITIKCRCGKHTKDISCYQSSLLRGKDKFQCDEPCGLPLACGLHRCQKKC 227

Query: 192 HNGPCGPC------KEEIAGDIKCYCGLTTRNKMVCSEVSVVARSKVS---KYKSWIGAF 242
           H+G CG C      KE +   I+CYCG   R+ + C +V V   + +S   K + W+G F
Sbjct: 228 HSGLCGICPEILNTKEYLDAHIRCYCGSQDRDTIKCRDVHVPLSASLSQNLKGEKWVGVF 287

Query: 243 ACDRMREVPYSCGKHSFHEKCIAPPSLPKRTPCPYSPENCTTCPCGKTQLAELGSTRTAC 302
            CD +R V Y C +HSF E+CIAPP++    PCP+SP+   TCPCGKT L EL  +R  C
Sbjct: 288 KCDNIRNVDYKCHEHSFVEQCIAPPTIDGTKPCPFSPKLLKTCPCGKTPLKELVESRKKC 347

Query: 303 TDHISSCGKVCGKQLSCGNHTCPMTCHDGNCMDPCLVITEQKCACEQRRFLVPCQFPHSP 362
           TD I +C   CGK L CG HTCP  CH G CMDPCL I ++KC+C Q+ FLVPCQF   P
Sbjct: 348 TDPIPTCDSRCGKPLKCGRHTCPFICHVGPCMDPCLQIDKKKCSCNQQSFLVPCQFHQDP 407

Query: 363 SCTAKCESLMSCRRHRCAERCCSGX-XXXXXXXXXXXXXXXXXXXXXXAQHVCLKDCNRV 421
            CT KCESLMSCRRHRC ERCC+G                         QH+CLK+CN +
Sbjct: 408 QCTTKCESLMSCRRHRCTERCCAGRPRAEARKKRLFRSQDLMDESLVEPQHICLKECNLM 467

Query: 422 LLCGIHMCNYKCHAGKCPPCLESDSNDLICPCGKTIVPAPVRCGTKLPRCTHPCRNSLLD 481
           L CG H C  KCH GKCPPCLESDSNDL+CPCG+TI+ APVRCGTKLP C +PC   +  
Sbjct: 468 LSCGKHKCQRKCHPGKCPPCLESDSNDLVCPCGRTIIEAPVRCGTKLPPCPYPCIKVVRG 527

Query: 482 TWPCGHSPPSHNCHPLDEPCPPCTITVKKTCRCGK-NEIRTFCYNDDVSCSRPCKKPLSY 540
            +PCGH+P  H CHPL+EPCPPCT +V K C+CGK +++RT C+ +DVSC + C  PL  
Sbjct: 528 EYPCGHTPMPHTCHPLNEPCPPCTASVFKPCKCGKVDKVRTLCFQNDVSCGKICGLPLEN 587

Query: 541 CNHFCQVPCHSDGQCQQTCKQACGLPRKACEHVCKAKCHGHTACPESPCTEKKTITCSCG 600
           CNH CQ  CH  G+CQ+TCKQ C   R  CEH C   CHG T CP+ PC+    ITC CG
Sbjct: 588 CNHTCQKRCHLLGECQKTCKQICKKKRINCEHTCLKPCHGKTDCPDIPCSVSIKITCECG 647

Query: 601 HKSSTKICSEYAGKDDGIGASQHLSCDEDCAKFQRHQQLMRAFGVVE--KATSEEDEALL 658
            K +   C   +          H+ CDE+C   +RH+QL  AFG+V+  ++TS E E L 
Sbjct: 648 RKETYVTCGATSTIPSA-ATKTHIECDEECELLERHRQLKEAFGIVDSNRSTSLEVEKLK 706

Query: 659 -LAQRSQSFDDLHLPFTEYVLSVFTKQSQWCTQIEQYLIKLMDDSSPKALHFKPMRAAQR 717
            LA+ + +F++L LP+ E  LS++ KQ +WC QIE+ L KLMDD +  +LHFKPMR  QR
Sbjct: 707 DLAKVATTFEELQLPYNETTLSIYAKQEKWCDQIEEILNKLMDDKARPSLHFKPMRPPQR 766

Query: 718 RFVHELSSSFGLYSESQDPEPKRSVYVKK--TGISRVPAIGLSKAAPLYTSFKKLEREFK 775
            F+ E + SF LY+E+QD EPKRSV+VKK   G S  P I L  A PLY +FK+LE+E K
Sbjct: 767 HFIQEFAKSFNLYAEAQDREPKRSVFVKKEEDGSSSKPIISLHDALPLYQTFKELEKERK 826

Query: 776 ANS-ESAVTKKLVSVHIDDSPESQHDAAINAILLSGLTSFASESALRDCFADYFSQTLLN 834
               E+  T +L++V         H A  +  L+  ++   +   L+  F  + + TL+ 
Sbjct: 827 LKEFEARTTTRLINVEAPQEDNVYH-AKYSGFLIKKISPGTTVEDLQRIFGQFLTSTLIV 885

Query: 835 CPQYVV--RGTEGYIFPTDYLSLSANAEKDLTKLAGYFRLLFQEQNLWTDISTCKLDSNL 892
            PQY++   G +  I+P +Y  +SA  E+DL  L G+F  + +E  +   +  C ++  +
Sbjct: 886 NPQYLIIQDGKDALIYPENYQEMSAGVERDLETLVGHFDFISKENFIADGVELCDVEVAM 945

>YNL023C Chr14 complement(588263..591160) [2898 bp, 965 aa] {ON}
           FAP1Protein that binds to Fpr1p, conferring rapamycin
           resistance by competing with rapamycin for Fpr1p
           binding; accumulates in the nucleus upon treatment of
           cells with rapamycin; has similarity to D. melanogaster
           shuttle craft and human NFX1
          Length = 965

 Score =  864 bits (2233), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/903 (49%), Positives = 557/903 (61%), Gaps = 25/903 (2%)

Query: 14  EGIPYYEQTVLELRDGETYQCLICTVEMDASCPMYACHQCYRVYDYECIRRWALKATSTT 73
           + + YYE+ + E+  G++Y C+ICTVEMD +C M+AC +CYRV+DY CIR WALK+T  T
Sbjct: 48  DDMQYYERAIQEISSGDSYVCMICTVEMDYTCQMFACKRCYRVFDYGCIREWALKSTEKT 107

Query: 74  VDRTWKCPNCYHVNRKVPPKNRHTCWCGKQVNLDPNYINPNSCGQTCGAPICQHGCSKLC 133
           VDR WKCPNCY+V+++VP KNR TCWCGK VN DPN ++PNSCGQTC A  C HGCSK+C
Sbjct: 108 VDRIWKCPNCYYVSKRVPVKNRPTCWCGKVVNPDPNPLDPNSCGQTCNASTCMHGCSKIC 167

Query: 134 HLGPHEECMVRIDFKCRCGKLTEEIPCYEAKAAKRNFSCDQPCGLPMPCGIHKCERVCHN 193
           HLGPH EC   ++  C CGK ++ I CY++K  K+NF+C + CGLP+ C IH C++ CH 
Sbjct: 168 HLGPHPECTRMVEIMCHCGKHSKSIFCYQSKVMKKNFNCQEVCGLPLSCSIHTCKKKCHP 227

Query: 194 GPCGPCKEEIAG------DIKCYCGLTTRNKMVCSEVSVVARSKVSKYKS---WIGAFAC 244
           G CGPC E I         IKCYCG  TR  + CSE       K SK ++   WIG FAC
Sbjct: 228 GLCGPCPEMIISKDSPKKQIKCYCGNHTRANIKCSETKFPKSGKSSKDENGNRWIGVFAC 287

Query: 245 DRMREVPYSCGKHSFHEKCIAPPSLPKRTPCPYSPENCTTCPCGKTQLAELGSTRTACTD 304
              R V YSC KHSF E CI+PP++     CP+ P +  TCPCG+T L EL   R  C D
Sbjct: 288 ADNRVVDYSCRKHSFIESCISPPTINGEKACPFLPSSLKTCPCGRTALEELTKPRKHCDD 347

Query: 305 HISSCGKVCGKQLSCGNHTCPMTCHDGNCMDPCLVITEQKCACEQRRFLVPCQFPHSPSC 364
            I +C   CGK L CG H+CP TCHD  CM+PCL I   KCACEQ  F VPC F   P C
Sbjct: 348 PIPTCDSRCGKPLKCGKHSCPFTCHDKACMEPCLQIDSVKCACEQSTFSVPCGFQGRPRC 407

Query: 365 TAKCESLMSCRRHRCAERCCSGX-XXXXXXXXXXXXXXXXXXXXXXAQHVCLKDCNRVLL 423
             KCESLMSCRRHRC +RCCSG                        A+H+CLK CN  L 
Sbjct: 408 NIKCESLMSCRRHRCTDRCCSGRPSAIRRKKNLFRTQDLLDESLVEAKHICLKPCNLTLS 467

Query: 424 CGIHMCNYKCHAGKCPPCLESDSNDLICPCGKTIVPAPVRCGTKLPRCTHPCRNSLLDTW 483
           CGIH C  KCH GKCPPCLESDSNDL+CPCG T+VPAPVRCGTKLP C HPC   +    
Sbjct: 468 CGIHKCQRKCHPGKCPPCLESDSNDLVCPCGNTVVPAPVRCGTKLPTCNHPCIKVVRGES 527

Query: 484 PCGHSPPSHNCHPLDEPCPPCTITVKKTCRCG-KNEIRTFCYNDDVSCSRPCKKPLSYCN 542
            CGH P  H CH LD  CPPCT TV K C+CG K ++RT C+  DVSC   C  PLSYC 
Sbjct: 528 TCGHKPMPHTCHSLDVSCPPCTETVFKPCKCGKKTKVRTVCFQTDVSCGIKCGIPLSYCY 587

Query: 543 HFCQVPCHSDGQCQQTCKQACGLPRKACEHVCKAKCHGHTACPESPCTEKKTITCSCGHK 602
           H CQ  CH  G CQ+ CKQ CG  R  C H C   CHG T CP+ PC     I C CG  
Sbjct: 588 HTCQKTCHLPGNCQKVCKQTCGQKRLNCNHECPKPCHGKTECPDLPCATLVKIYCKCGRI 647

Query: 603 SSTKICSEYAGKDDGIGASQH--LSCDEDCAKFQRHQQLMRAFGVVEKA---TSEEDEAL 657
             +  C     K D +  ++   L C+E+C   +R ++L  AFG+ E+    TS E +AL
Sbjct: 648 KKSVTC---GAKSDRVSVTESSVLDCNEECEALKRLKELKEAFGIKEETNNFTSNELDAL 704

Query: 658 -LLAQRSQSFDDLHLPFTEYVLSVFTKQSQWCTQIEQYLIKLMDDSSPKALHFKPMRAAQ 716
             L   + +F++L LPFTE  LSV++KQ +WC+QIE  L KLMDD +  +LHFKPMR  Q
Sbjct: 705 KKLVSVATTFEELQLPFTEAALSVYSKQERWCSQIEAILNKLMDDKTRSSLHFKPMRPPQ 764

Query: 717 RRFVHELSSSFGLYSESQDPEPKRSVYVKK--TGISRVPAIGLSKAAPLYTSFKKLEREF 774
           R F+ EL+ ++GLYSESQD EP RSV++KK   G S  P + L++A PLY SFK+L++E 
Sbjct: 765 RHFIRELAKAYGLYSESQDREPMRSVFIKKEDNGASNKPVLSLAEAYPLYESFKQLQKER 824

Query: 775 KANS-ESAVTKKLVSVHIDDSPESQHDAAINAILLSGLTSFASESALRDCFADYFSQTLL 833
           KA   ++  T KL++  + D+      A  N  L+  L +  +   LR  F  +   TL+
Sbjct: 825 KAQEFQARTTAKLINFEVQDTEPKVEVAKKNGFLVQNLVAGNTAEDLRRFFEPHLKHTLV 884

Query: 834 NCPQYVV--RGTEGYIFPTDYLSLSANAEKDLTKLAGYFRLLFQEQNLWTDISTCKLDSN 891
             PQY++   G    ++P +Y + S N E+D+  L G+F  + +E  L   IS C  +  
Sbjct: 885 VNPQYLILDDGKTALVYPENYETASVNTERDMELLVGHFDFMAKEAFLADSISLCSTEEE 944

Query: 892 LNR 894
           L R
Sbjct: 945 LER 947

>Suva_14.324 Chr14 complement(571146..574052) [2907 bp, 968 aa] {ON}
           YNL023C (REAL)
          Length = 968

 Score =  862 bits (2226), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/901 (48%), Positives = 559/901 (62%), Gaps = 21/901 (2%)

Query: 14  EGIPYYEQTVLELRDGETYQCLICTVEMDASCPMYACHQCYRVYDYECIRRWALKATSTT 73
           + + YYE+ + E+  G++Y C+ICTVEMD +C M+AC +CYRV+DY CIR WALK+T  T
Sbjct: 52  DDMQYYERAIQEIAKGDSYICMICTVEMDYTCQMFACKKCYRVFDYACIREWALKSTEKT 111

Query: 74  VDRTWKCPNCYHVNRKVPPKNRHTCWCGKQVNLDPNYINPNSCGQTCGAPICQHGCSKLC 133
           VD+ WKCPNCYH+ +KVP +NR TCWCGK VN D N ++PNSCGQTC AP C HGCSK+C
Sbjct: 112 VDKIWKCPNCYHIGKKVPTRNRPTCWCGKVVNPDHNPLDPNSCGQTCNAPTCVHGCSKIC 171

Query: 134 HLGPHEECMVRIDFKCRCGKLTEEIPCYEAKAAKRNFSCDQPCGLPMPCGIHKCERVCHN 193
           HLGPH EC   ++ KCRCGK ++ I CY++KA K++F C + CGLP+ CGIHKC++ CH+
Sbjct: 172 HLGPHPECTRTVEIKCRCGKHSKSIFCYQSKAMKKHFDCQEECGLPLSCGIHKCKKKCHS 231

Query: 194 GPCGPCKEEIAGD------IKCYCGLTTRNKMVCSEVSVVARSKVSKYKS---WIGAFAC 244
           G CGPC E I  +      IKCYCG+ +++ + C EV+     + SK +S   WIG FAC
Sbjct: 232 GLCGPCPELIMSEDKAMDWIKCYCGIHSKDSIKCCEVNFPKSGRSSKDESGNEWIGVFAC 291

Query: 245 DRMREVPYSCGKHSFHEKCIAPPSLPKRTPCPYSPENCTTCPCGKTQLAELGSTRTACTD 304
             +R V Y+C KHSF E CI+PP++  +  CP+ P    TCPCG+T L EL   R  CTD
Sbjct: 292 KDIRTVDYACHKHSFIEPCISPPTVNGKKTCPFLPSLLKTCPCGRTALEELTKPRKHCTD 351

Query: 305 HISSCGKVCGKQLSCGNHTCPMTCHDGNCMDPCLVITEQKCACEQRRFLVPCQFPHSPSC 364
            I +C   C K L CG H+CP  CHDG CMDPCL     KCACEQ  FLVPC F   P C
Sbjct: 352 PIPTCSSRCSKPLKCGKHSCPFICHDGACMDPCLQTDSVKCACEQSTFLVPCGFQEKPHC 411

Query: 365 TAKCESLMSCRRHRCAERCCSGX-XXXXXXXXXXXXXXXXXXXXXXAQHVCLKDCNRVLL 423
             KCESLMSCRRHRC +RCCSG                        AQH+CLK CN  L 
Sbjct: 412 NIKCESLMSCRRHRCIDRCCSGRPSALERKKRIFRSQDLMDESLVEAQHICLKPCNLTLS 471

Query: 424 CGIHMCNYKCHAGKCPPCLESDSNDLICPCGKTIVPAPVRCGTKLPRCTHPCRNSLLDTW 483
           CGIH C  KCH GKCPPCLESDSNDL+CPCGKT++PAPVRCGTKLP C + C   +    
Sbjct: 472 CGIHKCQRKCHPGKCPPCLESDSNDLVCPCGKTVIPAPVRCGTKLPLCNYACIKVVRGES 531

Query: 484 PCGHSPPSHNCHPLDEPCPPCTITVKKTCRCG-KNEIRTFCYNDDVSCSRPCKKPLSYCN 542
            CGH P  H CHPLD  CPPCT TV K C+CG K+++RT C+  DVSC   C KPLS C+
Sbjct: 532 ECGHKPMPHTCHPLDLACPPCTETVFKPCKCGKKDKVRTVCFQTDVSCGTTCGKPLSGCH 591

Query: 543 HFCQVPCHSDGQCQQTCKQACGLPRKACEHVCKAKCHGHTACPESPCTEKKTITCSCGHK 602
           H CQ  CH    CQ+ CKQ C   R  C+H C   CHG + CP+ PC     ITC CG  
Sbjct: 592 HTCQKTCHLPENCQKVCKQICRQKRPNCDHACPKPCHGRSECPDLPCASLVKITCKCGRI 651

Query: 603 SSTKICSEYAGKDDGIGASQHLSCDEDCAKFQRHQQLMRAFGVVEKA----TSEEDEALL 658
                C   +       A Q L C+E+C   +R ++L  AFG+ E++     +E D    
Sbjct: 652 EKKVACGAKSNVVSVTEAPQ-LDCNEECEALKRLKELREAFGISEESNESTNNELDTLKK 710

Query: 659 LAQRSQSFDDLHLPFTEYVLSVFTKQSQWCTQIEQYLIKLMDDSSPKALHFKPMRAAQRR 718
           L   + +F++L LPFTE VLSV+ KQ  WC QIE  + KLM D +  +LHFKPMR  QR 
Sbjct: 711 LVSVATTFEELQLPFTETVLSVYAKQEGWCLQIENIVNKLMSDKTRSSLHFKPMRPPQRH 770

Query: 719 FVHELSSSFGLYSESQDPEPKRSVYVKKTGISRV--PAIGLSKAAPLYTSFKKLEREFKA 776
           F+ EL+ ++ LYSESQD EP RSV++KK   S+   P + L++A PLY SFK+L++E K 
Sbjct: 771 FIRELAKAYNLYSESQDREPMRSVFIKKEDNSKSSRPILSLAEAFPLYESFKELQKERKI 830

Query: 777 NS-ESAVTKKLVSVHIDDSPESQHDAAINAILLSGLTSFASESALRDCFADYFSQTLLNC 835
              ++  T KL++  + D+      A  N  L+  L +      LR  F  +   TL+  
Sbjct: 831 QEFQARTTAKLINFEVRDAEPKVELAKNNGFLVQKLVNGNDVDDLRRFFEPHLKHTLVVK 890

Query: 836 PQYVV--RGTEGYIFPTDYLSLSANAEKDLTKLAGYFRLLFQEQNLWTDISTCKLDSNLN 893
           PQY++   G    ++P +Y  +S N E+D+  L G+F  + +E  L   IS C +D  L 
Sbjct: 891 PQYLIIDDGKTALVYPENYQEVSVNTERDMDILVGHFDFMAKEAFLADSISLCSIDEELG 950

Query: 894 R 894
           R
Sbjct: 951 R 951

>TBLA0B05950 Chr2 (1404509..1407496) [2988 bp, 995 aa] {ON}
           Anc_2.288 YNL023C
          Length = 995

 Score =  855 bits (2208), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/901 (48%), Positives = 559/901 (62%), Gaps = 26/901 (2%)

Query: 14  EGIPYYEQTVLELRDGETYQCLICTVEMDASCPMYACHQCYRVYDYECIRRWALKATSTT 73
           E + YYE+ V E+  G++YQC+ICTVEMD +C MYAC  CYRV+DY+CIR WALK+T  T
Sbjct: 67  EDLMYYERAVREIAKGDSYQCMICTVEMDHTCKMYACRHCYRVFDYDCIREWALKSTQKT 126

Query: 74  VDRTWKCPNCYHVNRKVPPKNRHTCWCGKQVNLDPNYINPNSCGQTCGAPICQHGCSKLC 133
           VD+TWKCPNCYH ++KVP K+R TCWCGK VN DPN ++PNSCGQTC A IC H C K C
Sbjct: 127 VDKTWKCPNCYHSSKKVPLKDRPTCWCGKVVNPDPNPLDPNSCGQTCNANICPHKCLKQC 186

Query: 134 HLGPHEECMVRIDFKCRCGKLTEEIPCYEAKAAKRNFSCDQPCGLPMPCGIHKCERVCHN 193
           HLG H EC   +   CRCG+ T++I C+E++  K  F CDQ CGL +PCGIHKC R CH+
Sbjct: 187 HLGSHPECTQLLKITCRCGRETKDIYCHESRRQKSIFHCDQECGLTLPCGIHKCRRKCHS 246

Query: 194 GPCGPC-----KEEIAGDIKCYCGLTTRNKMVCSEVSVVARSKVSKY---KSWIGAFACD 245
           G CG C      E ++G IKCYCGL +  +M C +V+  +  K+S+    K W+G F C 
Sbjct: 247 GLCGSCPELLIDENVSGKIKCYCGLHSLKEMNCKDVAFPSSGKISRNQEDKEWVGIFDCK 306

Query: 246 RMREVPYSCGKHSFHEKCIAPPSLPKRTPCPYSPENCTTCPCGKTQLAELGSTRTACTDH 305
            MR V Y+C +H F E CIAPP+LP    CP+SP    TCPCGKT L ++   RT CTD 
Sbjct: 307 EMRSVSYTCNEHVFVEGCIAPPTLPSTVVCPFSPNLLKTCPCGKTALQDMDCERTKCTDP 366

Query: 306 ISSCGKVCGKQLSCGNHTCPMTCHDGNCMDPCLVITEQKCACEQRRFLVPCQFPHSPSCT 365
           I +C  VC K L CG H CP TCH G CMDPC+ I +  CACE+R FLVPCQF   P C 
Sbjct: 367 IPTCDNVCNKILKCGKHRCPFTCHTGKCMDPCIQIDKMDCACERRTFLVPCQFKGKPVCK 426

Query: 366 AKCESLMSCRRHRCAERCCSGX-XXXXXXXXXXXXXXXXXXXXXXAQHVCLKDCNRVLLC 424
            KCESLMSCRRHRC E CCSG                        A+HVCLKDCN  L C
Sbjct: 427 FKCESLMSCRRHRCMEYCCSGRPYAERRKKTILRSSDRNDETLVEAEHVCLKDCNLKLSC 486

Query: 425 GIHMCNYKCHAGKCPPCLESDSNDLICPCGKTIVPAPVRCGTKLPRCTHPCRNSLLDTWP 484
           GIH C  KCH G CPPCLESDSNDL+CPCGKT++PAPVRCGT LP C +PC   +     
Sbjct: 487 GIHTCQRKCHPGPCPPCLESDSNDLVCPCGKTVIPAPVRCGTTLPPCKYPCIKVIRGESD 546

Query: 485 CGHSPPSHNCHPLDEPCPPCTITVKKTCRCG-KNEIRTFCYNDDVSCSRPCKKPLSYCNH 543
           CGH P  H+CH LD+PCP CT  V K C+CG K+++RT C+ +DVSC  PC  PL  C H
Sbjct: 547 CGHKPMPHSCHSLDQPCPVCTAPVFKPCKCGKKDKVRTMCFQEDVSCGLPCGLPLKDCYH 606

Query: 544 FCQVPCHSDGQCQQTCKQACGLPRKACEHVCKAKCHGHTACPESPCTEKKTITCSCGHKS 603
            CQ  CH  G+CQ TC Q C   R  C H C  +CH +  CP+ PCT   T+ C CG + 
Sbjct: 607 KCQKRCHLPGECQNTCIQICNAKRSNCSHGCTQRCHKNAPCPDIPCTVPVTVVCDCGRRK 666

Query: 604 STKICSEYAGKDDGIGASQHLSCDEDCAKFQRHQQLMRAFGVVEKATSEEDEALLLAQRS 663
             K CS  +   D +  + HL CDE+C    R  +L  AFG+V      +D+  +  +R 
Sbjct: 667 LVKPCSSTSTI-DSVTITSHLECDEECMLLLRRMELKAAFGIVNGLG--DDKTSVAIERI 723

Query: 664 Q-------SFDDLHLPFTEYVLSVFTKQSQWCTQIEQYLIKLMDDSSPKALHFKPMRAAQ 716
           Q       ++++L LPF E VL+V+ KQ +WC+QIE  L K MD+    +LHFK M+A Q
Sbjct: 724 QNRISVAKAYEELELPFVEAVLTVYAKQPKWCSQIEGILNKFMDEKLKSSLHFKHMKAPQ 783

Query: 717 RRFVHELSSSFGLYSESQDPEPKRSVYVKK--TGISRVPAIGLSKAAPLYTSFKKLEREF 774
           R FVH L+ ++ +YSESQDPEP RSV+VKK   G S  P + L +A PLY SFK++++E 
Sbjct: 784 RSFVHNLADAYKIYSESQDPEPVRSVFVKKLTNGTSSKPILTLEEALPLYESFKEVQKEK 843

Query: 775 KANSESAVTKKLVSVHIDDSPESQHDAA-INAILLSGLTSFASESALRDCFADYFSQTLL 833
           K     A T K + ++++   ++Q  A   N  L+  L    +E  L   F +    TL+
Sbjct: 844 KKQEYEARTHKTL-INVEAETQTQQSATKYNGFLIKNLVKGTTEEDLERIFGESLKPTLV 902

Query: 834 NCPQYVV--RGTEGYIFPTDYLSLSANAEKDLTKLAGYFRLLFQEQNLWTDISTCKLDSN 891
             PQY+V      G+I P DY  +S N E+D+ +L G+F  L +E  +   +  C +D  
Sbjct: 903 KDPQYLVMDESHHGFICPADYAEISINVERDMEQLIGFFDSLCKEHFIGDIVELCNIDEA 962

Query: 892 L 892
           L
Sbjct: 963 L 963

>TDEL0G02190 Chr7 (430157..432967) [2811 bp, 936 aa] {ON} Anc_2.288
           YNL023C
          Length = 936

 Score =  848 bits (2190), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/893 (49%), Positives = 554/893 (62%), Gaps = 21/893 (2%)

Query: 16  IPYYEQTVLELRDGETYQCLICTVEMDASCPMYACHQCYRVYDYECIRRWALKATSTTVD 75
           + YYE+ V E+  G+ Y C+ICTVEMD +C MYAC  CYRV+DYECIR WALK+T  T+D
Sbjct: 38  MAYYERAVQEIALGDRYVCMICTVEMDYTCKMYACEGCYRVFDYECIREWALKSTEKTLD 97

Query: 76  RTWKCPNCYHVNRKVPPKNRHTCWCGKQVNLDPNYINPNSCGQTCGAPICQHGCSKLCHL 135
           R WKCPNCY VN++VP KNR TCWCGK VN DPN ++PNSCGQTC APIC HGCSK CHL
Sbjct: 98  RVWKCPNCYKVNKRVPAKNRPTCWCGKTVNPDPNPLDPNSCGQTCDAPICPHGCSKQCHL 157

Query: 136 GPHEECMVRIDFKCRCGKLTEEIPCYE--AKAAKRNFSCDQPCGLPMPCGIHKCERVCHN 193
           GPH +C+  I  KC+CGK T E  CY+  +   K  F C++ CGLP+ CGIHKCER+CH+
Sbjct: 158 GPHPDCVRTITTKCQCGKHTRETFCYQTISMKGKSQFQCNEVCGLPLACGIHKCERLCHS 217

Query: 194 GPCGPCKEEIAG-----DIKCYCGLTTRNKMVCSEVSVVAR-SKVSKYKSWIGAFACDRM 247
           G CGPC   +        I+CYCGL  R+   C +V V +  SK  K  SWIGAF C  +
Sbjct: 218 GICGPCPAVLNAKSNKLKIRCYCGLEHRDSFKCKDVRVASDLSKDGKGDSWIGAFGCSGI 277

Query: 248 REVPYSCGKHSFHEKCIAPPSLPKRTPCPYSPENCTTCPCGKTQLAELGSTRTACTDHIS 307
           R++ Y+C +HSF EKC   PS+  +  CP+SP+   TCPCG+T L  L   R +CT  I 
Sbjct: 278 RKIEYACREHSFVEKCQPSPSISGKIACPFSPKLLKTCPCGRTSLKVLAEPRKSCTSPIP 337

Query: 308 SCGKVCGKQLSCGNHTCPMTCHDGNCMDPCLVITEQKCACEQRRFLVPCQFPHSPSCTAK 367
           +C   CGK+L+CG HTCP TCHDG CMDPC+ I   +C+C +  + VPCQF   P C  K
Sbjct: 338 NCDSTCGKKLACGRHTCPFTCHDGPCMDPCIQIETVRCSCHKNLYSVPCQFKEQPRCDTK 397

Query: 368 CESLMSCRRHRCAERCCSGX-XXXXXXXXXXXXXXXXXXXXXXAQHVCLKDCNRVLLCGI 426
           CESLMSCRRHRC ERCC G                        ++H+CLKDCN  L CG 
Sbjct: 398 CESLMSCRRHRCTERCCCGRPFAERRRKTPLSSRELMDESSVESEHICLKDCNLTLSCGC 457

Query: 427 HMCNYKCHAGKCPPCLESDSNDLICPCGKTIVPAPVRCGTKLPRCTHPCRNSLLDTWPCG 486
           H C  KCH GKCPPCLESDSNDL+CPCGKT+V APVRCGT+LP C +PC   + + + CG
Sbjct: 458 HKCQRKCHPGKCPPCLESDSNDLVCPCGKTVVEAPVRCGTRLPPCHYPCIRVIQNAYKCG 517

Query: 487 HSPPSHNCHPLDEPCPPCTITVKKTCRCG-KNEIRTFCYNDDVSCSRPCKKPLSYCNHFC 545
           H P  H CHPL+EPCP CT  V K C+CG K+++RT C+ +DVSC   C KPL  C H C
Sbjct: 518 HKPMPHTCHPLNEPCPSCTAPVFKPCKCGKKDKVRTLCFQNDVSCGTTCGKPLDNCPHMC 577

Query: 546 QVPCHSDGQCQQTCKQACGLPRKACEHVCKAKCHGHTACPESPCTEKKTITCSCGHKSST 605
           Q  CH  G+CQ+ CKQ C   R  C+H C+  CHG+  CP+ PC     I C C  K S 
Sbjct: 578 QKSCHIPGECQKKCKQICNRKRIYCDHKCRLICHGNDKCPDIPCPLSVKIKCECEVKESF 637

Query: 606 KICSEYAGKDDGIGASQHLSCDEDCAKFQRHQQLMRAFGV--VEKATSEEDEALL--LAQ 661
             C   + +      +  L CDE+C + +RH QL  AFG+       S    A L  LA 
Sbjct: 638 ITCGANS-ETPSKATTTILPCDEECERHKRHLQLREAFGISNFSDNPSRSKTASLENLAA 696

Query: 662 RSQSFDDLHLPFTEYVLSVFTKQSQWCTQIEQYLIKLMDDSSPKALHFKPMRAAQRRFVH 721
            + SF++L LPF+E  L  F KQ  WCTQIE  L   MD+    +LHFKPMR AQR F+H
Sbjct: 697 VANSFEELELPFSEPALGTFAKQEAWCTQIENVLNSFMDNEEKTSLHFKPMRPAQRHFIH 756

Query: 722 ELSSSFGLYSESQDPEPKRSVYVKK--TGISRVPAIGLSKAAPLYTSFKKLEREFKANS- 778
           EL+ S+ LY ESQD EPKRSV+VKK   G S  P I L  + P+Y  FK+ E+E KA   
Sbjct: 757 ELAKSYNLYVESQDREPKRSVFVKKQDNGGSCKPVIQLKDSLPIYQFFKENEKEKKAQRF 816

Query: 779 ESAVTKKLVSVHIDDSPESQHDAAINAILLSGLTSFASESALRDCFADYFSQTLLNCPQY 838
           E+  T + V+    + P+ +  A  NA  L  +++  ++  L   FAD+   TL+  PQ+
Sbjct: 817 EAQTTTEFVNFIPKEEPQLER-AKNNAFKLKNVSTGTTKEDLERIFADHLKPTLVKNPQF 875

Query: 839 VVRGT--EGYIFPTDYLSLSANAEKDLTKLAGYFRLLFQEQNLWTDISTCKLD 889
            ++ +   G I+P DY  +S N E+DL  L G+F  L +E  +   I  C +D
Sbjct: 876 KIQDSTKNGLIYPEDYAEISVNVERDLEALVGHFDYLCKESFIGDGIELCHID 928

>KLLA0E08317g Chr5 complement(747272..750037) [2766 bp, 921 aa] {ON}
           similar to uniprot|P53971 Saccharomyces cerevisiae
           YNL023C
          Length = 921

 Score =  846 bits (2185), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/890 (46%), Positives = 559/890 (62%), Gaps = 9/890 (1%)

Query: 15  GIPYYEQTVLELRDGETYQCLICTVEMDASCPMYACHQCYRVYDYECIRRWALKATSTTV 74
            IPYYEQTV E++DG+ Y C+ICTVE+D++C MYAC  CYRV+DYEC+R WALK+T+ T+
Sbjct: 31  NIPYYEQTVKEIKDGDQYVCMICTVELDSTCRMYACDSCYRVFDYECVREWALKSTNKTL 90

Query: 75  DRTWKCPNCYHVNRKVPPKNRHTCWCGKQVNLDPNYINPNSCGQTCGAPICQHGCSKLCH 134
           D++WKCPNCY +N K+P + R TCWCGK VN D N ++PNSCGQTC A  C HGCSK+CH
Sbjct: 91  DKSWKCPNCYKINHKIPKQKRSTCWCGKVVNPDVNELDPNSCGQTCNAYSCVHGCSKVCH 150

Query: 135 LGPHEECMVRIDFKCRCGKLTEEIPCYEAKAAKRNFSCDQPCGLPMPCGIHKCERVCHNG 194
           LGPH EC++ +  KC+CGK  ++IPC  +K    +++C   CGL +PCG H C++ CH G
Sbjct: 151 LGPHPECLIPVQIKCKCGKHCKQIPCSRSKVLGNSYNCGDVCGLLLPCGKHTCQKTCHTG 210

Query: 195 PCGPCKEEIAGDIKCYCGLTTRNKMVCSEVSVVARSKVSKYKSWIGAFACDRMREVPYSC 254
            CGPC+  I  ++ CYCG   ++ + CS++ V+  SK    K WIG ++C  +R + YSC
Sbjct: 211 FCGPCESIIKTELPCYCGSDVKSGIQCSDLRVLDYSKDVSGKKWIGVYSCGEVRTLHYSC 270

Query: 255 GKHSFHEKCIAPPSLPKRTPCPYSPENCTTCPCGKTQLAELGSTRTACTDHISSCGKVCG 314
             H++ E+C+AP  + +  PCP+SP+   TCPCGKT L EL   R  CTD I +C  VCG
Sbjct: 271 DHHTYVEQCLAPAGIDRSRPCPFSPKTLKTCPCGKTMLKELDKPRRKCTDTIPTCSNVCG 330

Query: 315 KQLSCGNHTCPMTCHDGNCMDPCLVITEQKCACEQRRFLVPCQFPHSPSCTAKCESLMSC 374
           KQLSCG HTCP +CH G+CMDPCL+IT+  C C  + FL PCQ   +P C  KCES MSC
Sbjct: 331 KQLSCGKHTCPFSCHTGDCMDPCLIITKTPCTCHSKTFLTPCQLHDTPRCNIKCESNMSC 390

Query: 375 RRHRCAERCCSGX-XXXXXXXXXXXXXXXXXXXXXXAQHVCLKDCNRVLLCGIHMCNYKC 433
           RRH+C E CCSG                         +HVCLK CN  L CGIH C +KC
Sbjct: 391 RRHKCMEICCSGKPAAKKREKTLFLKRDLNNETLVEPEHVCLKQCNLKLSCGIHDCTWKC 450

Query: 434 HAGKCPPCLESDSNDLICPCGKTIVPAPVRCGTKLPRCTHPCRNSLLDTWPCGHSPPSHN 493
           H GKCPPCLESD NDL+CPCGKT+VPAPVRCGTKLP C +PC        PCGH    H 
Sbjct: 451 HPGKCPPCLESDPNDLVCPCGKTVVPAPVRCGTKLPPCPNPCIKISEGPAPCGHRVGPHK 510

Query: 494 CHPLDEPCPPCTITVKKTCRC-GKNEIRTFCYNDD--VSCSRPCKKPLSYCNHFCQVPCH 550
           CHP    CPPCT  V K CRC  K+++RT C   D  V+C   C  PL+ C+H CQ  CH
Sbjct: 511 CHPAGTDCPPCTANVIKKCRCYKKHDMRTLCLVPDSQVACGTECGLPLATCHHKCQKKCH 570

Query: 551 SDGQCQQTCKQACGLPRKACEHVCKAKCHGHTACPESPCTEKKTITCSCGHKSSTKICSE 610
            +G+C+  C + CGL R  C H+CK KCHG++ CPE  C EK  ITC C  ++    C  
Sbjct: 571 VEGECEIKCAKPCGLKRSLCGHLCKEKCHGNSPCPEKVCHEKVVITCDCNRRTKQVECGA 630

Query: 611 YAGKDDGIGASQHLSCDEDCAKFQRHQQLMRAFGVVEKATSEEDEALLLAQRSQSFDDLH 670
                     ++ L CDE+CAK QRH +LM AFG+ EK  + +++   +   ++ FDDL+
Sbjct: 631 -THDTQSRSETEKLPCDEECAKLQRHMELMEAFGMNEKPKNTKEQLESIVLVAKKFDDLN 689

Query: 671 LPFTEYVLSVFTKQSQWCTQIEQYLIKLMDDSSPKALHFKPMRAAQRRFVHELSSSFGLY 730
           +P++E VL+V+ KQ  WC QI     K ++D+   +LH KPMR  QR+F+ EL+S++ LY
Sbjct: 690 MPYSELVLNVYKKQVNWCDQICAVFDKFIEDTQKLSLHLKPMRVPQRQFIKELASAYALY 749

Query: 731 SESQDPEPKRSVYVKKT-GISRVPAIGLSKAAPLYTSFKKLERE-FKANSESAVTKKLVS 788
           SESQD EP RSVY+KK    S+ P + L  A+ LY  FK LE+E  + +  + VTK L++
Sbjct: 750 SESQDREPNRSVYLKKIQSQSKKPELTLKDASELYQLFKTLEKERMQEHYSTKVTKTLIN 809

Query: 789 VHIDDSPESQHDAAINAILLSGLTSFASESALRDCFADYFSQTLLNCPQY--VVRGTEGY 846
           +   ++P        NAI++SG+   +    +     D+   TL+  PQY  +       
Sbjct: 810 IPASETPLPAPYEGPNAIVISGVFDSSQIDNIEPLVHDFLKYTLVKTPQYRFLKDLNSVL 869

Query: 847 IFPTDYLSLSANAEKDLTKLAGYFRLLFQEQNLWTDISTCKLDSNLNRIG 896
           IFP +Y  ++ N   D+ K+  + +   Q+Q L T +  C++D NL+ + 
Sbjct: 870 IFPENYSGITKNTASDMEKVIPFIKTALQDQMLATGVEMCQVDENLSLVS 919

>Skud_14.306 Chr14 complement(558943..561855) [2913 bp, 970 aa] {ON}
           YNL023C (REAL)
          Length = 970

 Score =  843 bits (2177), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/910 (47%), Positives = 555/910 (60%), Gaps = 25/910 (2%)

Query: 14  EGIPYYEQTVLELRDGETYQCLICTVEMDASCPMYACHQCYRVYDYECIRRWALKATSTT 73
           + + YYE+ + E+  G++Y C+ICTVEMD +C M+AC +CYRV+DY CIR WALK+T  T
Sbjct: 53  DDLQYYERAIQEIAKGDSYICMICTVEMDYTCQMFACKKCYRVFDYACIREWALKSTEKT 112

Query: 74  VDRTWKCPNCYHVNRKVPPKNRHTCWCGKQVNLDPNYINPNSCGQTCGAPICQHGCSKLC 133
           VD+ WKCPNCYHV +KVP +NR TCWCG  VN DPN ++PNSCGQTC AP C HGC K+C
Sbjct: 113 VDKIWKCPNCYHVGKKVPTRNRPTCWCGNVVNPDPNQLDPNSCGQTCNAPTCVHGCFKIC 172

Query: 134 HLGPHEECMVRIDFKCRCGKLTEEIPCYEAKAAKRNFSCDQPCGLPMPCGIHKCERVCHN 193
           HLGPH EC   ++ KC CG+ ++ I CY++KA +R F+C + CGL + CG+HKC++ CH+
Sbjct: 173 HLGPHPECTRMVEIKCHCGRHSKTIFCYQSKAMRRRFNCQEECGLSLSCGVHKCKKKCHS 232

Query: 194 GPCGPCKEEIAGD------IKCYCGLTTRNKMVCSEVSVVARSKVSKYKS---WIGAFAC 244
           G CG C E I  D      IKCYCG   +N + CSE       + SK +S   W G FAC
Sbjct: 233 GLCGSCPEFIINDDSSKKQIKCYCGNHIQNSIKCSEARFPKSGRTSKDESGNEWAGVFAC 292

Query: 245 DRMREVPYSCGKHSFHEKCIAPPSLPKRTPCPYSPENCTTCPCGKTQLAELGSTRTACTD 304
             +R V Y+C KHSF E C++PP++  +  CP+ P    TCPCG+T L EL   R  C D
Sbjct: 293 ADIRTVDYACHKHSFIEPCLSPPTISGQKTCPFLPSLLKTCPCGRTALEELTKPRKHCHD 352

Query: 305 HISSCGKVCGKQLSCGNHTCPMTCHDGNCMDPCLVITEQKCACEQRRFLVPCQFPHSPSC 364
            I +C   C K L CG H CP TCHDG CMDPCL I    C+CEQ  F +PC F  SP C
Sbjct: 353 PIPTCNSRCSKPLKCGKHLCPFTCHDGACMDPCLQIDSANCSCEQSTFSIPCGFQESPRC 412

Query: 365 TAKCESLMSCRRHRCAERCCSGX-XXXXXXXXXXXXXXXXXXXXXXAQHVCLKDCNRVLL 423
             KCESLMSCRRHRC +RCCSG                        A+H+CLK CN  L 
Sbjct: 413 NIKCESLMSCRRHRCIDRCCSGRPSAIRRKKSFFRSQDLLDESLVEAKHICLKPCNLTLS 472

Query: 424 CGIHMCNYKCHAGKCPPCLESDSNDLICPCGKTIVPAPVRCGTKLPRCTHPCRNSLLDTW 483
           CG+H C  KCH GKCPPCLESDSNDLIC CGKT+VPAPVRCGTKLP C HPC   +    
Sbjct: 473 CGLHKCQRKCHPGKCPPCLESDSNDLICACGKTVVPAPVRCGTKLPTCNHPCIKVVRGES 532

Query: 484 PCGHSPPSHNCHPLDEPCPPCTITVKKTCRCG-KNEIRTFCYNDDVSCSRPCKKPLSYCN 542
            CGH P  H CHP +  CPPCT TV K CRCG K+++RT C+  DVSC   C  PLS C 
Sbjct: 533 WCGHKPMPHTCHPSNISCPPCTETVFKPCRCGKKDKVRTVCFQADVSCGTSCGIPLSGCY 592

Query: 543 HFCQVPCHSDGQCQQTCKQACGLPRKACEHVCKAKCHGHTACPESPCTEKKTITCSCGHK 602
           H CQ  CH  G+CQ+ CKQ CG  R  C H C   CHG T CP+ PC     ITC CG  
Sbjct: 593 HTCQKTCHLLGKCQKVCKQICGQKRLDCIHTCPKPCHGKTECPDLPCAALVKITCECGRI 652

Query: 603 SSTKICSEYAGKDD-GIGASQHLSCDEDCAKFQRHQQLMRAFGVVEKAT----SEEDEAL 657
             +  CS  A +D   +  S  L C+E+C   +R ++L  AFGV E       +E D   
Sbjct: 653 KKSITCS--AKRDTVSVITSSILDCNEECETLKRLKELREAFGVSEGPNNVIRNELDALS 710

Query: 658 LLAQRSQSFDDLHLPFTEYVLSVFTKQSQWCTQIEQYLIKLMDDSSPKALHFKPMRAAQR 717
            L   +++F++L LPFTE  LSV++KQ +WC QIE  L KLMD     +LHFKPMR  QR
Sbjct: 711 ELVSVAKTFEELQLPFTEATLSVYSKQERWCLQIEGILNKLMDSEIRSSLHFKPMRPPQR 770

Query: 718 RFVHELSSSFGLYSESQDPEPKRSVYVKKTG--ISRVPAIGLSKAAPLYTSFKKLEREFK 775
            F+HE++ ++ LY+ESQD EP RSV++KK     S+ P + L++A PLY SFK+ ++E K
Sbjct: 771 HFIHEMAKAYNLYAESQDREPMRSVFIKKEDNCTSKKPVLSLAEAYPLYESFKQSQKERK 830

Query: 776 ANS-ESAVTKKLVSVHIDDSPESQHDAAINAILLSGLTSFASESALRDCFADYFSQTLLN 834
               ++  T KL++  + D+      A  N  L+  L S  +   L+  F  +   TL+ 
Sbjct: 831 LQEFQARTTAKLINFEVQDAESKIEAAKNNGFLVQNLVSGNTVEDLKRFFEPHLKHTLVA 890

Query: 835 CPQYVV--RGTEGYIFPTDYLSLSANAEKDLTKLAGYFRLLFQEQNLWTDISTCKLDSNL 892
            PQY++        I+P +Y + S N E+D+  L G+F  + +E  L   I  C +D  +
Sbjct: 891 NPQYLILDDSRSALIYPENYETASVNTERDMELLVGHFDFMAKEAFLADSIHLCSVDEEI 950

Query: 893 NRIGSCESPA 902
            +    +SPA
Sbjct: 951 GK--RLDSPA 958

>ZYRO0A01936g Chr1 (159749..162610) [2862 bp, 953 aa] {ON} similar
           to uniprot|P53971 Saccharomyces cerevisiae YNL023C
          Length = 953

 Score =  832 bits (2149), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/898 (47%), Positives = 553/898 (61%), Gaps = 18/898 (2%)

Query: 18  YYEQTVLELRDGETYQCLICTVEMDASCPMYACHQCYRVYDYECIRRWALKATSTTVDRT 77
           YYE+ V E+  G+TY C+ICTVEMD +C M+AC +CYRV+DY+CIR WALK+T  T+D+T
Sbjct: 58  YYERAVKEIARGDTYVCMICTVEMDYTCKMFACSKCYRVFDYDCIREWALKSTGRTMDKT 117

Query: 78  WKCPNCYHVNRKVPPKNRHTCWCGKQVNLDPNYINPNSCGQTCGAPICQHGCSKLCHLGP 137
           WKCPNC   + KVP K+R TCWCGK VN DPN ++PNSCGQTC APIC+HGCSK+CHLGP
Sbjct: 118 WKCPNCLDESNKVPRKSRPTCWCGKVVNPDPNPLDPNSCGQTCDAPICEHGCSKVCHLGP 177

Query: 138 HEECMVRIDFKCRCGKLTEEIPCYEAKAAK-RNFSCDQPCGLPMPCGIHKCERVCHNGPC 196
           H EC   I  KC+CG+ T ++ C E  + + + F+C++ CGL +PCG+HKC + CH+G C
Sbjct: 178 HPECTRIISIKCKCGRHTRDVRCSEVGSGRNQQFTCEESCGLLLPCGVHKCSKKCHSGLC 237

Query: 197 GPCKEEI------AGDIKCYCGLTTRNKMVCSEVSVVARSKV-SKYKSWIGAFACDRMRE 249
           G C E +         IKCYCGL     + C +V V  R  V  +   WIG F C  +R 
Sbjct: 238 GGCNETLHSKPDKGAVIKCYCGLHESPSIRCGDVRVADRDSVDDQGNGWIGVFRCKDVRV 297

Query: 250 VPYSCGKHSFHEKCIAPPSLPKRTPCPYSPENCTTCPCGKTQLAELGSTRTACTDHISSC 309
           V Y+CG+HSF E C   PSLPK+  CP+SP    +CPCG+T L +LG  R  CTDHI +C
Sbjct: 298 VEYACGQHSFVESCKPAPSLPKQIGCPFSPNVLRSCPCGRTPLNKLGQARVKCTDHIPTC 357

Query: 310 GKVCGKQLSCGNHTCPMTCHDGNCMDPCLVITEQKCACEQRRFLVPCQFPHSPSCTAKCE 369
              CGK+L+CG HTCP  CH+G+CMDPC+   +  C CE R FLVPCQF   P C  KCE
Sbjct: 358 ESKCGKKLACGKHTCPYKCHEGDCMDPCVQFEKTNCLCEARSFLVPCQFREDPRCNTKCE 417

Query: 370 SLMSCRRHRCAERCCSGX-XXXXXXXXXXXXXXXXXXXXXXAQHVCLKDCNRVLLCGIHM 428
           SLMSCRRHRC E+CCSG                        A+HVCLK CN  L CG H 
Sbjct: 418 SLMSCRRHRCTEKCCSGKPGAERRKKTPFTSRELLDESLVEAEHVCLKSCNLTLTCGRHK 477

Query: 429 CNYKCHAGKCPPCLESDSNDLICPCGKTIVPAPVRCGTKLPRCTHPCRNSLLDTWPCGHS 488
           C  KCH G+CPPCLESD NDL+CPCGKT+V APVRCGTKLP C + C + + D +PCGH+
Sbjct: 478 CQRKCHPGRCPPCLESDPNDLVCPCGKTVVEAPVRCGTKLPPCPYSCISVVRDGYPCGHT 537

Query: 489 PPSHNCHPLDEPCPPCTITVKKTCRCG-KNEIRTFCYNDDVSCSRPCKKPLSYCNHFCQV 547
           P  H CHP +E CPPCT  VKK C+CG K+++RT C+  DVSC + C KPL  C H CQ 
Sbjct: 538 PMPHLCHPPEEKCPPCTANVKKPCKCGKKSDVRTLCFQQDVSCGQICNKPLGSCRHTCQK 597

Query: 548 PCHSDGQCQQTCKQACGLPRKACEHVCKAKCHGHTACPESPCTEKKTITCSCGHKSSTKI 607
            CH DG CQ  C+Q CG  R  C+H C   CHG   CP+ PC     I C+CG K ST+ 
Sbjct: 598 KCH-DGGCQVKCRQICGKKRVNCDHKCPKPCHGGEPCPDFPCPFSVVIKCACGRKESTEP 656

Query: 608 CSEYAGKDDGIGASQHLSCDEDCAKFQRHQQLMRAFGVVEKATSEEDEALLLAQRSQSFD 667
           C   + +      ++ LSCDE+C + +R  QL  A G+ E   S  +  +  A  + +F+
Sbjct: 657 CGTNS-QTLSASVTRELSCDEECERVKRCAQLKDALGLKENGDSSVENTVSNALVASNFE 715

Query: 668 DLHLPFTEYVLSVFTKQSQWCTQIEQYLIKLMDDSSPKALHFKPMRAAQRRFVHELSSSF 727
           +L LPF E VL+++++Q ++C  IE  L   +DD    +LHFKPM+ AQR FVHEL+ ++
Sbjct: 716 ELGLPFRETVLAIYSRQQRYCDNIESVLNNFIDDEKKSSLHFKPMKPAQRHFVHELAKAY 775

Query: 728 GLYSESQDPEPKRSVYVKK--TGISRVPAIGLSKAAPLYTSFKKLEREFKANS-ESAVTK 784
            LYSESQDPEPKRSVYVKK   G S  P+I L +A P+Y +FK+ E+E K    E     
Sbjct: 776 KLYSESQDPEPKRSVYVKKELNGESNKPSITLQEALPIYQAFKQREKETKIRRYEMQNVT 835

Query: 785 KLVSVHIDDSPESQHDAAINAILLSGLTSFASESALRDCFADYFSQTLLNCPQYVVRGTE 844
            LV+      P  +  A  N  L+  LT   +   L+  + ++   TL+  P Y      
Sbjct: 836 NLVNFVPKFEPTVEL-AKYNGFLIRNLTDGTNGEDLQRIYGEHLKPTLVRNPVYKALPDR 894

Query: 845 --GYIFPTDYLSLSANAEKDLTKLAGYFRLLFQEQNLWTDISTCKLDSNLNRIGSCES 900
               IFP  Y  ++ N E D+ +L G+F  + +E  +   +  C++   L      ES
Sbjct: 895 NIALIFPESYSDVTVNTECDMERLVGHFDFICKEMFIGDGVELCQVGEYLQPEAPTES 952

>TPHA0D01530 Chr4 complement(313063..315951) [2889 bp, 962 aa] {ON}
           Anc_2.288 YNL023C
          Length = 962

 Score =  817 bits (2111), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/909 (44%), Positives = 560/909 (61%), Gaps = 28/909 (3%)

Query: 14  EGIPYYEQTVLELRDGETYQCLICTVEMDASCPMYACHQCYRVYDYECIRRWALKATSTT 73
           +G+ YYEQT+ ++  G+ Y C+ICT+EMD +C MYAC  CYRV+DYECI+ WA K+ S T
Sbjct: 43  DGLVYYEQTIRDISKGDRYTCMICTIEMDYTCKMYACQSCYRVFDYECIQEWAEKSASKT 102

Query: 74  VDRTWKCPNCYHVNRKVPPKNRHTCWCGKQVNLDPNYINPNSCGQTCGAPICQHGCSKLC 133
           +D+ WKCPNC H ++++P +NR TCWCGK +N DPN ++PNSCGQTC    C HGC   C
Sbjct: 103 IDKVWKCPNCSHSSKQIPLRNRPTCWCGKVINPDPNELSPNSCGQTCNKKTCVHGCKNFC 162

Query: 134 HLGPHEECMVRIDFKCRCGKLTEEIPCYEAKAAKRN--FSCDQPCGLPMPCGIHKCERVC 191
           HLGPH EC V    KC+CG+  ++I C++ K + +N  + C++ C LP+ CG+HKC+RVC
Sbjct: 163 HLGPHGECSVITTLKCKCGRNEKDIFCHQLKKSNKNNVYQCNEVCQLPLACGVHKCKRVC 222

Query: 192 HNGPCGPCKEEIAGD------------IKCYCGLTTRNKMVCSEVSVVAR-SKVSKYKSW 238
           H+G CG C E ++ +             KCYCG  ++N+++C ++++    SK S+   W
Sbjct: 223 HSGLCGACPEILSSEQIQSVESNENRKFKCYCGENSKNEIMCKKLAITGTFSKNSEGDKW 282

Query: 239 IGAFACDRMREVPYSCGKHSFHEKCIAPPSLPKRTPCPYSPENCTTCPCGKTQLAELGST 298
           IG FAC   R V Y+C +HSF E C A  S+  +  CPY+P+   +CPCGKT L +L   
Sbjct: 283 IGTFACKTRRIVFYACNEHSFIEPCQAQLSISGKKICPYTPKLLNSCPCGKTSLKQLAQK 342

Query: 299 RTACTDHISSCGKVCGKQLSCGNHTCPMTCHDGNCMDPCLVITEQKCACEQRRFLVPCQF 358
           R  CTD I +C   CGK L CG HTCP  CH+G+CMDPC+ +    C+C Q+ FLVPC F
Sbjct: 343 RKKCTDPIPTCENRCGKALKCGKHTCPYICHNGSCMDPCIQLEVTNCSCLQKHFLVPCNF 402

Query: 359 PHSPSCTAKCESLMSCRRHRCAERCCSGX-XXXXXXXXXXXXXXXXXXXXXXAQHVCLKD 417
             +P CT KCESLMSCRRHRC ++CC+G                        A H+CLK+
Sbjct: 403 EQTPKCTFKCESLMSCRRHRCPKKCCTGKPEADKRKKMLLTREELNDESLVEAVHICLKE 462

Query: 418 CNRVLLCGIHMCNYKCHAGKCPPCLESDSNDLICPCGKTIVPAPVRCGTKLPRCTHPCRN 477
           CN  L CGIH C  KCH G+CP CL SDSNDL+CPCGKT++ APVRCG+KLP C   C  
Sbjct: 463 CNLKLSCGIHDCTRKCHPGRCPSCLISDSNDLVCPCGKTVIEAPVRCGSKLPPCPFECIK 522

Query: 478 SLLDTWPCGHSPPSHNCHPLDEPCPPCTITVKKTCRCGKNE-IRTFCYNDDVSCSRPCKK 536
            +  ++PCGH PP H CHP  EPCPPCT  V++ C+CGK+  ++  C+ +  SC   C K
Sbjct: 523 VIERSYPCGHKPPPHQCHPSTEPCPPCTAVVERPCKCGKHHAVKAVCFQEFGSCGEICNK 582

Query: 537 PLSYCNHFCQVPCHSDGQCQQTCKQACGLPRKACEHVCKAKCHGHTACPESPCTEKKTIT 596
            L  C+H CQ  CH  GQCQ++CKQ C   R  C H CK+KCHG + CP+ PC E   ++
Sbjct: 583 ELENCHHKCQYKCHEIGQCQKSCKQVCNKDRANCNHQCKSKCHGSSPCPDVPCNEVTKVS 642

Query: 597 CSCGHKSSTKICSEYAGKDDGIGASQHLSCDEDCAKFQRHQQLMRAFGV---VEKATSEE 653
           C CG K   + C  YA  D+   + + L CDEDC    RH QL  AFG    ++ +    
Sbjct: 643 CKCGRKQEYRKC--YATLDNSSASIELLPCDEDCEAHARHLQLRDAFGYDSSLDTSNKNI 700

Query: 654 DEALLLAQRSQSFDDLHLPFTEYVLSVFTKQSQWCTQIEQYLIKLMDDSSPKALHFKPMR 713
            +   L ++  ++++L LP+ + V+S ++KQ +WC+QIE  L K + D +   LHFKPM+
Sbjct: 701 QDIQSLMEKVSTYEELRLPYPQSVISTYSKQIKWCSQIEDILRKFVLDKAKNNLHFKPMK 760

Query: 714 AAQRRFVHELSSSFGLYSESQDPEPKRSVYVKKTGISRVPAIGLSKAAPLYTSFKKLERE 773
            AQR FV ELS+SF LYSESQDPEPKRSV+VK+   +R+P I L +  PL+T FKKLE+E
Sbjct: 761 PAQRHFVRELSTSFNLYSESQDPEPKRSVFVKRKVDTRIPNISLEEVLPLWTGFKKLEKE 820

Query: 774 FKANS-ESAVTKKLVSVHIDDS-PESQHDAAINAILLSGLTSFASESALRDCFADYFSQT 831
            K    ES   +K ++    +   +S +D   N   +  ++   +E  L + F      T
Sbjct: 821 RKIQHFESTSQRKYINYEPKEVIVKSSNDT--NGFFIKKISPGITEEDLSEVFGKALKST 878

Query: 832 LLN--CPQYVVRGTEGYIFPTDYLSLSANAEKDLTKLAGYFRLLFQEQNLWTDISTCKLD 889
           L+   C + +   ++  I+P  Y S++ +  +DL  L G+F  + +E  ++  I  C ++
Sbjct: 879 LIKNVCYKILPESSDAIIYPEQYNSITESVHQDLEVLVGHFDFIGKEALIFDSIMLCNVE 938

Query: 890 SNLNRIGSC 898
             +N+I  C
Sbjct: 939 GYINQISDC 947

>Kpol_1039.45 s1039 (135833..138739) [2907 bp, 968 aa] {ON}
           (135833..138739) [2907 nt, 969 aa]
          Length = 968

 Score =  802 bits (2072), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/896 (45%), Positives = 551/896 (61%), Gaps = 22/896 (2%)

Query: 14  EGIPYYEQTVLELRDGETYQCLICTVEMDASCPMYACHQCYRVYDYECIRRWALKATSTT 73
           E + +YE+ + ++  G+ Y C+ICT+E+D++  MYAC  CYRV+DY+CIR WA+K++  +
Sbjct: 64  EDLMHYERAIKDIAKGDFYTCMICTIELDSTSKMYACSHCYRVFDYDCIREWAVKSSQKS 123

Query: 74  VDRTWKCPNCYHVNRKVPPKNRHTCWCGKQVNLDPNYINPNSCGQTCGAPICQHGCSKLC 133
           +D+ WKCPNC H + K+P +NR TCWCGK VN DPN   PNSCGQTC A  C H CS  C
Sbjct: 124 LDKVWKCPNCNHTSNKIPLQNRPTCWCGKTVNPDPNPFYPNSCGQTCNAKSCIHRCSHFC 183

Query: 134 HLGPHEECMVRIDFKCRCGKLTEEIPCY---EAKAAKRNFSCDQPCGLPMPCGIHKCERV 190
           HLGPH +C       C CGK T+++ CY     K   + F+C + C + + CGIHKC RV
Sbjct: 184 HLGPHPQCHRTTTIHCECGKHTKDVFCYLLDHGKNRNKKFNCGEKCNMTLSCGIHKCSRV 243

Query: 191 CHNGPCGPCKEEIAGDIKCYCGLTTRNKMVCSEVSVVARSKVSKYK---SWIGAFACDRM 247
           CH+G CGPC E I   + CYCG TT +K+ CS V +    K SK +   +WIG F C+++
Sbjct: 244 CHSGSCGPCPELITKKVNCYCGSTTMDKIRCSNVKIHDSGKKSKDQEGNTWIGVFKCNKI 303

Query: 248 REVPYSCGKHSFHEKCIAPPSLPKRTPCPYSPENCTTCPCGKTQLAELGSTRTACTDHIS 307
           R V Y+C  HSF E C +PP++     CPYSP+   TCPCGKT L +  + R  CTD IS
Sbjct: 304 RTVEYACKNHSFFETCTSPPTISGTKICPYSPKLLKTCPCGKTNLDDFENKRQKCTDPIS 363

Query: 308 SCGKVCGKQLSCGNHTCPMTCHDGNCMDPCLVITEQKCACEQRRFLVPCQFPHSPSCTAK 367
           +C   C K L CG H CP TCH+G CMDPC  I  +KC+C  + F VPCQF   P C  K
Sbjct: 364 TCENRCDKPLKCGKHKCPFTCHNGPCMDPCTQIELRKCSCNYKEFSVPCQFHEKPRCNMK 423

Query: 368 CESLMSCRRHRCAERCCSGX-XXXXXXXXXXXXXXXXXXXXXXAQHVCLKDCNRVLLCGI 426
           CESLMSCRRHRC  RCCSG                        A+H+CLKDCN  L CGI
Sbjct: 424 CESLMSCRRHRCTRRCCSGKPMADKRKKMLFSQADLLDESLVEAEHICLKDCNLKLSCGI 483

Query: 427 HMCNYKCHAGKCPPCLESDSNDLICPCGKTIVPAPVRCGTKLPRCTHPCRNSLLDTWPCG 486
           H C  KCHAGKCPPCLESDS+DL+CPCGKT+V APVRCGTKLP C  PC   +  ++PCG
Sbjct: 484 HNCTRKCHAGKCPPCLESDSSDLVCPCGKTVVEAPVRCGTKLPECIFPCIKYIEGSYPCG 543

Query: 487 HSPPSHNCHPLDEPCPPCTITVKKTCRCGKNE-IRTFCYNDDVSCSRPCKKPLSYCNHFC 545
           H P +H CHP D PCPPCT  V K C+CGK +  +  C+ +  SC + C+K L  C+H+C
Sbjct: 544 HKPGNHYCHPADIPCPPCTEVVFKPCKCGKEQKAKALCFQETASCGKLCEKKLDGCHHYC 603

Query: 546 QVPCHSDGQCQQTCKQACGLPRKACEHVCKAKCHGHTACPESPCTEKKTITCSCGHKSST 605
           Q+ CH  G+CQ+ C Q C   R  C H C  KCHG + CP+ PC  K  + C CG +   
Sbjct: 604 QLKCHLPGECQKKCTQICNKRRVNCSHTCDQKCHGDSNCPDIPCKVKCEVYCGCGRRKEL 663

Query: 606 KICSEYAGKDDGIGASQHLSCDEDCAKFQRHQQLMRAFGVVEKATSEEDEALL-----LA 660
            +C         +  ++ L CD+ C K+QR ++L  AFG+  K++SE+ E+ L     + 
Sbjct: 664 LLCGA-TSTTQSVELTKVLPCDDACLKYQRLEELRNAFGM--KSSSEDPESELERLKKIV 720

Query: 661 QRSQSFDDLHLPFTEYVLSVFTKQSQWCTQIEQYLIKLMDDSSPKALHFKPMRAAQRRFV 720
           ++  S+++L LPF+E VLSV++KQ+ WC QIE+ + K ++D +  +LHFKPM A QR F+
Sbjct: 721 EKVTSYEELELPFSETVLSVYSKQTNWCNQIEELINKFVNDKNKPSLHFKPMPAPQRNFI 780

Query: 721 HELSSSFGLYSESQDPEPKRSVYVKKTGISRVPAIGLSKAAPLYTSFKKLEREFKANSES 780
           H L  ++ +YSESQD EPKRSVY+KK   +R+P I L +A PLY S+KK+E+E K   +S
Sbjct: 781 HALVEAYEMYSESQDREPKRSVYLKKNKYTRIPNISLEEALPLYQSYKKIEKERKV--QS 838

Query: 781 AVTKKLVSVHIDDSPESQH--DAAINAILLSGLTSFASESALRDCFADYFSQTLLNCPQY 838
             +KK V+      PE     D   N  L+ G+T   +   L   F  +   TL+   QY
Sbjct: 839 FESKKNVTYLNYQPPERSLTPDVKYNGFLIKGITFGTTTDDLNTLFGVHLKPTLIKDAQY 898

Query: 839 VV--RGTEGYIFPTDYLSLSANAEKDLTKLAGYFRLLFQEQNLWTDISTCKLDSNL 892
            +   G    ++P DYL++S N E+D+  LAG+F  + +E  L   +  C +   L
Sbjct: 899 SILPDGKSAIVYPKDYLTISENVERDIESLAGHFDYMTKEAMLGESVEMCNITDIL 954

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.135    0.461 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 92,755,871
Number of extensions: 3821825
Number of successful extensions: 8861
Number of sequences better than 10.0: 41
Number of HSP's gapped: 7943
Number of HSP's successfully gapped: 49
Length of query: 908
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 789
Effective length of database: 39,836,145
Effective search space: 31430718405
Effective search space used: 31430718405
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 70 (31.6 bits)