Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ADL212W2.289ON25125111641e-163
Ecym_33282.289ON2542467471e-99
NDAI0G006802.289ON2552556654e-87
CAGL0M06897g2.289ON2482426421e-83
NCAS0G03850singletonON2512436315e-82
NCAS0G037702.289ON2512436315e-82
KLTH0G10428g2.289ON2512436246e-81
Skud_14.3052.289ON2492466132e-79
YNL024C2.289ON2462466124e-79
Smik_14.3072.289ON2462406115e-79
Suva_14.3232.289ON2532476109e-79
KNAG0H019802.289ON2492505907e-76
KLLA0E08295g2.289ON2662385901e-75
SAKL0E07612g2.289ON2522455803e-74
Kwal_27.115132.289ON2512515761e-73
KAFR0H032902.289ON2452515532e-70
KLLA0E21539g1.325ON4001401535e-11
KAFR0C042501.325ON3911331412e-09
SAKL0D06798g1.325ON4211771385e-09
Smik_2.4141.325ON4171271385e-09
NDAI0J028604.352ON3471821369e-09
Kpol_1066.171.325ON4351481351e-08
NCAS0B074101.325ON4141291332e-08
TDEL0D019401.325ON4051501314e-08
Skud_2.4031.325ON4171271305e-08
ZYRO0G20548g1.325ON3971271296e-08
YBR271W (EFM2)1.325ON419931298e-08
Smik_10.4224.352ON3401831271e-07
TPHA0L003404.352ON3411831271e-07
Suva_4.5321.325ON416881271e-07
KNAG0C018001.325ON4211271234e-07
NDAI0B047301.325ON4321271218e-07
AER240W1.325ON3901491201e-06
Kwal_14.25501.325ON4181411191e-06
KLTH0H10560g1.325ON4171481191e-06
CAGL0I09438g1.325ON4061421182e-06
Skud_10.3524.352ON3361621172e-06
NCAS0J021504.352ON322941136e-06
TPHA0I026501.325ON4211321121e-05
Suva_12.2204.352ON3371631101e-05
Kwal_47.166354.352ON3221881102e-05
KNAG0B067204.352ON2831311065e-05
Ecym_55131.325ON396901031e-04
KAFR0E042804.352ON3151571022e-04
YJR129C4.352ON3391801012e-04
Kpol_1028.814.352ON336145985e-04
KLLA0B04444g4.352ON308148976e-04
ZYRO0B14916g4.352ON298130930.002
KLTH0D17996g4.352ON317145920.003
Ecym_11274.352ON320130900.006
TBLA0D052001.325ON39990900.007
AER161C4.352ON31695830.042
TDEL0D006404.352ON327176820.049
TBLA0B061504.352ON316131820.060
KNAG0F030806.79ON258118800.085
SAKL0G18106g4.352ON33595790.15
ZYRO0D14542g6.79ON263144770.19
CAGL0M09801g6.79ON256204760.27
CAGL0M00572g4.352ON327124740.55
Skud_2.3806.167ON55235730.81
TBLA0C01350singletonON28984701.8
Suva_4.5096.167ON55235658.6
Smik_2.3916.167ON55235658.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADL212W
         (251 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADL212W Chr4 (332487..333242) [756 bp, 251 aa] {ON} Syntenic hom...   452   e-163
Ecym_3328 Chr3 (629428..630192) [765 bp, 254 aa] {ON} similar to...   292   1e-99
NDAI0G00680 Chr7 (150212..150979) [768 bp, 255 aa] {ON} Anc_2.28...   260   4e-87
CAGL0M06897g Chr13 complement(702211..702957) [747 bp, 248 aa] {...   251   1e-83
NCAS0G03850 Chr7 (713255..714010) [756 bp, 251 aa] {ON}               247   5e-82
NCAS0G03770 Chr7 complement(694471..695226) [756 bp, 251 aa] {ON...   247   5e-82
KLTH0G10428g Chr7 (883191..883946) [756 bp, 251 aa] {ON} similar...   244   6e-81
Skud_14.305 Chr14 complement(557846..558595) [750 bp, 249 aa] {O...   240   2e-79
YNL024C Chr14 complement(587107..587847) [741 bp, 246 aa] {ON} P...   240   4e-79
Smik_14.307 Chr14 complement(549501..550241) [741 bp, 246 aa] {O...   239   5e-79
Suva_14.323 Chr14 complement(569944..570705) [762 bp, 253 aa] {O...   239   9e-79
KNAG0H01980 Chr8 complement(348806..349555) [750 bp, 249 aa] {ON...   231   7e-76
KLLA0E08295g Chr5 complement(746166..746966) [801 bp, 266 aa] {O...   231   1e-75
SAKL0E07612g Chr5 complement(614835..615593) [759 bp, 252 aa] {O...   228   3e-74
Kwal_27.11513 s27 complement(832028..832783) [756 bp, 251 aa] {O...   226   1e-73
KAFR0H03290 Chr8 complement(626525..627262) [738 bp, 245 aa] {ON...   217   2e-70
KLLA0E21539g Chr5 complement(1923103..1924305) [1203 bp, 400 aa]...    64   5e-11
KAFR0C04250 Chr3 (844020..845195) [1176 bp, 391 aa] {ON} Anc_1.3...    59   2e-09
SAKL0D06798g Chr4 complement(564525..565790) [1266 bp, 421 aa] {...    58   5e-09
Smik_2.414 Chr2 (730531..731784) [1254 bp, 417 aa] {ON} YBR271W ...    58   5e-09
NDAI0J02860 Chr10 complement(713765..714808) [1044 bp, 347 aa] {...    57   9e-09
Kpol_1066.17 s1066 complement(28462..29769) [1308 bp, 435 aa] {O...    57   1e-08
NCAS0B07410 Chr2 complement(1401275..1402519) [1245 bp, 414 aa] ...    56   2e-08
TDEL0D01940 Chr4 (376261..377478) [1218 bp, 405 aa] {ON} Anc_1.3...    55   4e-08
Skud_2.403 Chr2 (713779..715032) [1254 bp, 417 aa] {ON} YBR271W ...    55   5e-08
ZYRO0G20548g Chr7 complement(1693797..1694990) [1194 bp, 397 aa]...    54   6e-08
YBR271W Chr2 (744852..746111) [1260 bp, 419 aa] {ON}  EFM2S-aden...    54   8e-08
Smik_10.422 Chr10 complement(653045..654067) [1023 bp, 340 aa] {...    54   1e-07
TPHA0L00340 Chr12 (45910..46935) [1026 bp, 341 aa] {ON} Anc_4.35...    54   1e-07
Suva_4.532 Chr4 (916493..917743) [1251 bp, 416 aa] {ON} YBR271W ...    54   1e-07
KNAG0C01800 Chr3 (352309..353574) [1266 bp, 421 aa] {ON} Anc_1.3...    52   4e-07
NDAI0B04730 Chr2 complement(1171595..1172893) [1299 bp, 432 aa] ...    51   8e-07
AER240W Chr5 (1080474..1081646) [1173 bp, 390 aa] {ON} Non-synte...    51   1e-06
Kwal_14.2550 s14 complement(809874..811130) [1257 bp, 418 aa] {O...    50   1e-06
KLTH0H10560g Chr8 complement(912880..914133) [1254 bp, 417 aa] {...    50   1e-06
CAGL0I09438g Chr9 (904886..906106) [1221 bp, 406 aa] {ON} simila...    50   2e-06
Skud_10.352 Chr10 complement(622581..623591) [1011 bp, 336 aa] {...    50   2e-06
NCAS0J02150 Chr10 complement(415802..416770) [969 bp, 322 aa] {O...    48   6e-06
TPHA0I02650 Chr9 complement(580125..581390) [1266 bp, 421 aa] {O...    48   1e-05
Suva_12.220 Chr12 complement(343489..344502) [1014 bp, 337 aa] {...    47   1e-05
Kwal_47.16635 s47 complement(37749..38717) [969 bp, 322 aa] {ON}...    47   2e-05
KNAG0B06720 Chr2 complement(1329424..1330275) [852 bp, 283 aa] {...    45   5e-05
Ecym_5513 Chr5 (1042019..1043209) [1191 bp, 396 aa] {ON} similar...    44   1e-04
KAFR0E04280 Chr5 complement(864926..865873) [948 bp, 315 aa] {ON...    44   2e-04
YJR129C Chr10 complement(664000..665019) [1020 bp, 339 aa] {ON} ...    44   2e-04
Kpol_1028.81 s1028 (182083..183093) [1011 bp, 336 aa] {ON} (1820...    42   5e-04
KLLA0B04444g Chr2 (395811..396737) [927 bp, 308 aa] {ON} similar...    42   6e-04
ZYRO0B14916g Chr2 complement(1217570..1218466) [897 bp, 298 aa] ...    40   0.002
KLTH0D17996g Chr4 (1490856..1491809) [954 bp, 317 aa] {ON} simil...    40   0.003
Ecym_1127 Chr1 (260356..261318) [963 bp, 320 aa] {ON} similar to...    39   0.006
TBLA0D05200 Chr4 complement(1278210..1279409) [1200 bp, 399 aa] ...    39   0.007
AER161C Chr5 complement(942007..942957) [951 bp, 316 aa] {ON} Sy...    37   0.042
TDEL0D00640 Chr4 (113100..114083) [984 bp, 327 aa] {ON} Anc_4.35...    36   0.049
TBLA0B06150 Chr2 (1451595..1452545) [951 bp, 316 aa] {ON} Anc_4....    36   0.060
KNAG0F03080 Chr6 (584425..585201) [777 bp, 258 aa] {ON} Anc_6.79...    35   0.085
SAKL0G18106g Chr7 complement(1569137..1570144) [1008 bp, 335 aa]...    35   0.15 
ZYRO0D14542g Chr4 (1231299..1232090) [792 bp, 263 aa] {ON} simil...    34   0.19 
CAGL0M09801g Chr13 complement(970260..971030) [771 bp, 256 aa] {...    34   0.27 
CAGL0M00572g Chr13 (68018..69001) [984 bp, 327 aa] {ON} similar ...    33   0.55 
Skud_2.380 Chr2 complement(683463..685121) [1659 bp, 552 aa] {ON...    33   0.81 
TBLA0C01350 Chr3 (308857..309726) [870 bp, 289 aa] {ON}                32   1.8  
Suva_4.509 Chr4 complement(885931..887589) [1659 bp, 552 aa] {ON...    30   8.6  
Smik_2.391 Chr2 complement(701009..702667) [1659 bp, 552 aa] {ON...    30   8.7  

>ADL212W Chr4 (332487..333242) [756 bp, 251 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL024C
          Length = 251

 Score =  452 bits (1164), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 224/251 (89%), Positives = 224/251 (89%)

Query: 1   MTETFTAVFEDLVEPRPIEHLGQSDLSYQGQLDPPLKIHEDGGESGCGGKVWIAGNLLCE 60
           MTETFTAVFEDLVEPRPIEHLGQSDLSYQGQLDPPLKIHEDGGESGCGGKVWIAGNLLCE
Sbjct: 1   MTETFTAVFEDLVEPRPIEHLGQSDLSYQGQLDPPLKIHEDGGESGCGGKVWIAGNLLCE 60

Query: 61  FILEKSKDGRVLSQFPGYERQFKNIIELGSGTGLVGLCVGLHGKYNGATDTNVYITDIEG 120
           FILEKSKDGRVLSQFPGYERQFKNIIELGSGTGLVGLCVGLHGKYNGATDTNVYITDIEG
Sbjct: 61  FILEKSKDGRVLSQFPGYERQFKNIIELGSGTGLVGLCVGLHGKYNGATDTNVYITDIEG 120

Query: 121 LCPLMQKNVELNGLDGMVHPRPLFWGEPLSDEFTRQPIDLVLAADCVYLEKAFPLLEKTL 180
           LCPLMQKNVELNGLDGMVHPRPLFWGEPLSDEFTRQPIDLVLAADCVYLEKAFPLLEKTL
Sbjct: 121 LCPLMQKNVELNGLDGMVHPRPLFWGEPLSDEFTRQPIDLVLAADCVYLEKAFPLLEKTL 180

Query: 181 LDLTAGESQPLVLMSYXXXXXXXXXXXXXXXXXXXXXXXXXXXSYEDYRRQRTYLFQLVR 240
           LDLTAGESQPLVLMSY                           SYEDYRRQRTYLFQLVR
Sbjct: 181 LDLTAGESQPLVLMSYKKRRKADKKFFIKIKKEFDIIEIKDFKSYEDYRRQRTYLFQLVR 240

Query: 241 KPARAPHALAP 251
           KPARAPHALAP
Sbjct: 241 KPARAPHALAP 251

>Ecym_3328 Chr3 (629428..630192) [765 bp, 254 aa] {ON} similar to
           Ashbya gossypii ADL212W
          Length = 254

 Score =  292 bits (747), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 143/246 (58%), Positives = 178/246 (72%), Gaps = 3/246 (1%)

Query: 1   MTETFTAVFEDLVEPRPIEHLGQSDLSYQGQLDPPLKIHEDGGESGCGGKVWIAGNLLCE 60
           MT+ F +VFE+LV   PIEHLG SDLS+QG+LDPPLKI+EDGGESGCGGKVWIAG LLC+
Sbjct: 1   MTDVFASVFEELVPTPPIEHLGASDLSFQGRLDPPLKIYEDGGESGCGGKVWIAGELLCD 60

Query: 61  FILEKSKDGRVLSQFPGYERQFKNIIELGSGTGLVGLCVGLHGKYNGATDTNVYITDIEG 120
           F+LEKSKDG++LS+F    +QF  ++ELGSGTGLVGLC+G+H   +   D +VYITDI+ 
Sbjct: 61  FLLEKSKDGQLLSKFVKNGKQFNKVLELGSGTGLVGLCIGMHNIMHEVNDMDVYITDIDT 120

Query: 121 LCPLMQKNVELNGLDGMVHPRPLFWGEPLSDEFTRQ--PIDLVLAADCVYLEKAFPLLEK 178
           LCPLM +NV +N L+G VHPR LFWG+ L  EF  +  P+DL+LAADCVYLEKAFPLLE 
Sbjct: 121 LCPLMARNVRMNNLEGRVHPRELFWGDELPAEFRNKDSPVDLILAADCVYLEKAFPLLEM 180

Query: 179 TLLDLTAG-ESQPLVLMSYXXXXXXXXXXXXXXXXXXXXXXXXXXXSYEDYRRQRTYLFQ 237
            LL+LTA  E QP+VLMSY                            Y++Y +QRT++FQ
Sbjct: 181 KLLELTANQEVQPVVLMSYRKRRKADKKFFLKIKKHFVITELTDFKRYDEYIKQRTHIFQ 240

Query: 238 LVRKPA 243
           LVR+ +
Sbjct: 241 LVRRSS 246

>NDAI0G00680 Chr7 (150212..150979) [768 bp, 255 aa] {ON} Anc_2.289
           YNL024C
          Length = 255

 Score =  260 bits (665), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 132/255 (51%), Positives = 165/255 (64%), Gaps = 14/255 (5%)

Query: 1   MTETFTAVFEDLVEPRPIEHLGQSDLSYQGQLDPPLKIHEDGGESGCGGKVWIAGNLLCE 60
           M + F + F+DLV  RP+EHLG SDLS+ G+L  PLKIHEDGGESGCGGKVWIAG LLCE
Sbjct: 1   MDDIFGSGFDDLVVARPLEHLGNSDLSFGGRLKNPLKIHEDGGESGCGGKVWIAGELLCE 60

Query: 61  FILEKSKDGRVLSQFPGYERQFKNIIELGSGTGLVGLCVGLHGKYNGATDTNVYITDIEG 120
           FILEKS    +L+ +    +QF+ I+ELGSGTGLVGLC+GL  K N   D + YITDI+ 
Sbjct: 61  FILEKSNSDDLLNGWASNSKQFRKIVELGSGTGLVGLCIGLLEKNNFHKDIDAYITDIDQ 120

Query: 121 LCPLMQKNVELNGLDGMVHPRPLFWGEPLSDEFT--------------RQPIDLVLAADC 166
           + PLM++N++LNG++  V    L+WGEPL   F                + +DL+LAADC
Sbjct: 121 IVPLMKQNIQLNGIENEVSAEELWWGEPLRKTFAPSEHSRDKEEDFREEKKVDLILAADC 180

Query: 167 VYLEKAFPLLEKTLLDLTAGESQPLVLMSYXXXXXXXXXXXXXXXXXXXXXXXXXXXSYE 226
           VYLEKAFPLLEKTLLDLT GE+ P +LM+Y                            YE
Sbjct: 181 VYLEKAFPLLEKTLLDLTEGETPPTILMAYRKRRKADKHFFQKIKKNFDIVEIKDFEKYE 240

Query: 227 DYRRQRTYLFQLVRK 241
            Y +QRT+LFQL+R+
Sbjct: 241 YYLKQRTHLFQLIRQ 255

>CAGL0M06897g Chr13 complement(702211..702957) [747 bp, 248 aa] {ON}
           similar to uniprot|P53970 Saccharomyces cerevisiae
           YNL024c
          Length = 248

 Score =  251 bits (642), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 133/242 (54%), Positives = 159/242 (65%), Gaps = 9/242 (3%)

Query: 9   FEDLVEPRPIEHLGQSDLSYQGQLDPPLKIHEDGGESGCGGKVWIAGNLLCEFILEKSKD 68
           F DL+E RP+EH+GQSDL++ G L P LKI+EDGGESGCGGKVWIAG LLCEFILEKS+D
Sbjct: 7   FGDLIESRPVEHMGQSDLTFNGMLVPGLKIYEDGGESGCGGKVWIAGELLCEFILEKSRD 66

Query: 69  GRVLSQFPGYER-QFKNIIELGSGTGLVGLCVGLHGKYNGATDTNVYITDIEGLCPLMQK 127
           G +L  +   +   F N++ELGSGTGLVGLCVGL  K         YITDI+ L PLM+K
Sbjct: 67  GELLKDWINDDSVSFGNVLELGSGTGLVGLCVGLVTKKQSQRMVKTYITDIDQLVPLMEK 126

Query: 128 NVELNGLDGMVHPRPLFWGEPLSDEF--------TRQPIDLVLAADCVYLEKAFPLLEKT 179
           NVELN +D  V  + L WGE L  EF        T   +DLVLAADCVYLEKAFPLLEKT
Sbjct: 127 NVELNLIDQQVFAKELLWGEALPIEFAPVKTGHATTSSLDLVLAADCVYLEKAFPLLEKT 186

Query: 180 LLDLTAGESQPLVLMSYXXXXXXXXXXXXXXXXXXXXXXXXXXXSYEDYRRQRTYLFQLV 239
           LLDLT  ++ P++LM+Y                           +Y+ Y +QRT+LFQLV
Sbjct: 187 LLDLTECDNPPVILMAYRKRRKADKHFFQKIRKNFNVIVINDFKNYDQYLKQRTHLFQLV 246

Query: 240 RK 241
           RK
Sbjct: 247 RK 248

>NCAS0G03850 Chr7 (713255..714010) [756 bp, 251 aa] {ON}
          Length = 251

 Score =  247 bits (631), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 131/243 (53%), Positives = 160/243 (65%), Gaps = 10/243 (4%)

Query: 9   FEDLVEPRPIEHLGQSDLSYQGQLDPPLKIHEDGGESGCGGKVWIAGNLLCEFILEKSKD 68
           FE LV PRP+EHLG SDLS+ G+L  PLKIHEDGGESGCGGKVWIAG LLC+FILEKS  
Sbjct: 8   FEGLVVPRPVEHLGNSDLSFGGKLRSPLKIHEDGGESGCGGKVWIAGELLCDFILEKSGT 67

Query: 69  GRVLSQFP-GYERQFKNIIELGSGTGLVGLCVGLHGKYNGATDTNVYITDIEGLCPLMQK 127
             +L+++P   ER+F+N++ELGSGTGLVGLCVGL  K     +  V+ITDI+ L PLMQ+
Sbjct: 68  EDLLNKWPHDGERRFRNVLELGSGTGLVGLCVGLLEKNRFHKNIGVHITDIDQLVPLMQR 127

Query: 128 NVELNGLDGMVHPRPLFWGEPLSDEFT---------RQPIDLVLAADCVYLEKAFPLLEK 178
           N+ELNG+   V    L+WGEPL + F             +DL+LAADCVYLE AFPLLE+
Sbjct: 128 NIELNGVSKEVVAEGLWWGEPLLESFAPSTVDNLPKTNVVDLILAADCVYLEDAFPLLER 187

Query: 179 TLLDLTAGESQPLVLMSYXXXXXXXXXXXXXXXXXXXXXXXXXXXSYEDYRRQRTYLFQL 238
           TLLDLT  E+ P++LMSY                            YE Y + RT+LFQL
Sbjct: 188 TLLDLTESETPPVILMSYRKRRKADKHFFNKIKKNFDVIEVKDFTKYEMYLKMRTHLFQL 247

Query: 239 VRK 241
            R+
Sbjct: 248 ARR 250

>NCAS0G03770 Chr7 complement(694471..695226) [756 bp, 251 aa] {ON}
           Anc_2.289 YNL024C
          Length = 251

 Score =  247 bits (631), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 131/243 (53%), Positives = 160/243 (65%), Gaps = 10/243 (4%)

Query: 9   FEDLVEPRPIEHLGQSDLSYQGQLDPPLKIHEDGGESGCGGKVWIAGNLLCEFILEKSKD 68
           FE LV PRP+EHLG SDLS+ G+L  PLKIHEDGGESGCGGKVWIAG LLC+FILEKS  
Sbjct: 8   FEGLVVPRPVEHLGNSDLSFGGKLRSPLKIHEDGGESGCGGKVWIAGELLCDFILEKSGT 67

Query: 69  GRVLSQFP-GYERQFKNIIELGSGTGLVGLCVGLHGKYNGATDTNVYITDIEGLCPLMQK 127
             +L+++P   ER+F+N++ELGSGTGLVGLCVGL  K     +  V+ITDI+ L PLMQ+
Sbjct: 68  EDLLNKWPHDGERRFRNVLELGSGTGLVGLCVGLLEKNRFHKNIGVHITDIDQLVPLMQR 127

Query: 128 NVELNGLDGMVHPRPLFWGEPLSDEFT---------RQPIDLVLAADCVYLEKAFPLLEK 178
           N+ELNG+   V    L+WGEPL + F             +DL+LAADCVYLE AFPLLE+
Sbjct: 128 NIELNGVSKEVVAEGLWWGEPLLESFAPSTVDNLPKTNVVDLILAADCVYLEDAFPLLER 187

Query: 179 TLLDLTAGESQPLVLMSYXXXXXXXXXXXXXXXXXXXXXXXXXXXSYEDYRRQRTYLFQL 238
           TLLDLT  E+ P++LMSY                            YE Y + RT+LFQL
Sbjct: 188 TLLDLTESETPPVILMSYRKRRKADKHFFNKIKKNFDVIEVKDFTKYEMYLKMRTHLFQL 247

Query: 239 VRK 241
            R+
Sbjct: 248 ARR 250

>KLTH0G10428g Chr7 (883191..883946) [756 bp, 251 aa] {ON} similar to
           uniprot|P53970 Saccharomyces cerevisiae YNL024C Putative
           S-adenosylmethionine-dependent methyltransferase of the
           seven beta-strand family
          Length = 251

 Score =  244 bits (624), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 132/243 (54%), Positives = 159/243 (65%), Gaps = 8/243 (3%)

Query: 5   FTAVFEDLVEPRPIEHLGQSDLSYQGQLDPPLKIHEDGGESGCGGKVWIAGNLLCEFILE 64
           FTA F DLV  RP+EH G SDL++ G++ P LKIHEDGGESGCGGK+WIAG LLCE++LE
Sbjct: 7   FTAQFTDLVPSRPLEHFGDSDLTFGGRIFPALKIHEDGGESGCGGKLWIAGELLCEYLLE 66

Query: 65  KSKDGRVLSQ---FPGYERQFKNIIELGSGTGLVGLCVGLHGKYNGATDTNVYITDIEGL 121
            S D  +LS+     G ++ F NI+ELGSGTGLVGLC G   + NG  +  V+ITDI+ L
Sbjct: 67  NSDDNGILSKQMNLLGRDKPFVNILELGSGTGLVGLCAGSLARANGG-NAKVHITDIDQL 125

Query: 122 CPLMQKNVELNGLDGMVHPRPLFWGEPLSDEFTRQPI----DLVLAADCVYLEKAFPLLE 177
             LM+ NVELNGL  +V    L+WGEPL  EF    I    DLVLAADCVYLE AFPLLE
Sbjct: 126 VRLMEGNVELNGLASVVSAEKLWWGEPLKYEFGPDAISNKTDLVLAADCVYLETAFPLLE 185

Query: 178 KTLLDLTAGESQPLVLMSYXXXXXXXXXXXXXXXXXXXXXXXXXXXSYEDYRRQRTYLFQ 237
           KTLLDLT GE+ P+VLMSY                             +D+ +QRT+LFQ
Sbjct: 186 KTLLDLTKGETPPVVLMSYRKRRKADRIFFKAIRKNFKVVPITSFDRCDDFLKQRTHLFQ 245

Query: 238 LVR 240
           L+R
Sbjct: 246 LIR 248

>Skud_14.305 Chr14 complement(557846..558595) [750 bp, 249 aa] {ON}
           YNL024C (REAL)
          Length = 249

 Score =  240 bits (613), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 131/246 (53%), Positives = 162/246 (65%), Gaps = 8/246 (3%)

Query: 3   ETFTAVFEDLVEPRPIEHLGQSDLSYQGQLDPPLKIHEDGGESGCGGKVWIAGNLLCEFI 62
           +T    FEDLV PR  EHLGQ+DLS+ G+L P LKI EDGGESGCGGKVWIAG LLCE+I
Sbjct: 2   DTIFGGFEDLVVPRATEHLGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEYI 61

Query: 63  LEKSKDGRVLSQFPGYERQFKNIIELGSGTGLVGLCVGLHGKYNGATDTNVYITDIEGLC 122
           LEKS    +LS+     RQFK ++ELGSGTGLVGLCVGL  K      + VY+TDI+ L 
Sbjct: 62  LEKSLH-HLLSEATHGRRQFKKVLELGSGTGLVGLCVGLLEKNTFHDGSKVYVTDIDKLV 120

Query: 123 PLMQKNVELNGLDGMVHPRPLFWGEPLSDEFTRQP-------IDLVLAADCVYLEKAFPL 175
           PL+++N+EL+ +   V  R L+WGEPLS +F+ Q        +DLVLAADCVYLEKAFPL
Sbjct: 121 PLLERNIELDKVQYEVLARELWWGEPLSVDFSPQEGDLQTNNVDLVLAADCVYLEKAFPL 180

Query: 176 LEKTLLDLTAGESQPLVLMSYXXXXXXXXXXXXXXXXXXXXXXXXXXXSYEDYRRQRTYL 235
           LE+TLLDLT   S P++LM+Y                            ++ Y +QRT+L
Sbjct: 181 LERTLLDLTNCISPPVILMAYKKRRKADKHFFSKIKRNFDVLEITDFSKFDHYLKQRTHL 240

Query: 236 FQLVRK 241
           FQL+RK
Sbjct: 241 FQLIRK 246

>YNL024C Chr14 complement(587107..587847) [741 bp, 246 aa] {ON}
           Putative methyltransferase; has seven beta-strand
           methyltransferase motif; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm; despite
           similarity to methyltransferases, null mutant does not
           display alterations in lysine methylation pattern
          Length = 246

 Score =  240 bits (612), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 131/246 (53%), Positives = 163/246 (66%), Gaps = 8/246 (3%)

Query: 3   ETFTAVFEDLVEPRPIEHLGQSDLSYQGQLDPPLKIHEDGGESGCGGKVWIAGNLLCEFI 62
           E+    F DLV PRP EHLGQ+DLS+ G+L P LKI EDGGESGCGGKVWIAG LLCE+I
Sbjct: 2   ESIFGGFGDLVVPRPKEHLGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEYI 61

Query: 63  LEKSKDGRVLSQFPGYERQFKNIIELGSGTGLVGLCVGLHGKYNGATDTNVYITDIEGLC 122
           LEKS D  +LS+     +QFK ++ELGSGTGLVGLCVGL  K      T VY+TDI+ L 
Sbjct: 62  LEKSVD-HLLSKTVNGTKQFKKVLELGSGTGLVGLCVGLLEKNTFHDGTKVYVTDIDKLI 120

Query: 123 PLMQKNVELNGLDGMVHPRPLFWGEPLSDEFTRQP-------IDLVLAADCVYLEKAFPL 175
           PL+++N+EL+ +   V  R L+WGEPLS +F+ Q        +DLVLAADCVYLE+AFPL
Sbjct: 121 PLLKRNIELDEVQYEVLARELWWGEPLSADFSPQEGAMQANNVDLVLAADCVYLEEAFPL 180

Query: 176 LEKTLLDLTAGESQPLVLMSYXXXXXXXXXXXXXXXXXXXXXXXXXXXSYEDYRRQRTYL 235
           LEKTLLDLT   + P++LM+Y                            +E Y ++RT+L
Sbjct: 181 LEKTLLDLTHCINPPVILMAYKKRRKADKHFFNKIKRNFDVLEITDFSKFEHYLKERTHL 240

Query: 236 FQLVRK 241
           FQL+RK
Sbjct: 241 FQLIRK 246

>Smik_14.307 Chr14 complement(549501..550241) [741 bp, 246 aa] {ON}
           YNL024C (REAL)
          Length = 246

 Score =  239 bits (611), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 131/240 (54%), Positives = 161/240 (67%), Gaps = 8/240 (3%)

Query: 9   FEDLVEPRPIEHLGQSDLSYQGQLDPPLKIHEDGGESGCGGKVWIAGNLLCEFILEKSKD 68
           F DLV PRP EHLGQ+DLS+ G+L P LKI EDGGESGCGGKVWIAG LLCE+ILEKS D
Sbjct: 8   FGDLVVPRPKEHLGQTDLSFSGKLLPALKICEDGGESGCGGKVWIAGELLCEYILEKSVD 67

Query: 69  GRVLSQFPGYERQFKNIIELGSGTGLVGLCVGLHGKYNGATDTNVYITDIEGLCPLMQKN 128
             +LS+    +++FK ++ELGSGTGLVGLCVGL  K      T VY+TDI+ L PL+++N
Sbjct: 68  -HLLSKTVDGKKRFKKVLELGSGTGLVGLCVGLLEKNVYHDGTKVYVTDIDKLVPLLKRN 126

Query: 129 VELNGLDGMVHPRPLFWGEPLSDEFTRQP-------IDLVLAADCVYLEKAFPLLEKTLL 181
           +EL+ +   V  R L WGEPLS +F+ Q        +DLVLAADCVYLEKAFPLLEKTLL
Sbjct: 127 IELDKVQYEVLARELCWGEPLSADFSPQEGDLQTNNVDLVLAADCVYLEKAFPLLEKTLL 186

Query: 182 DLTAGESQPLVLMSYXXXXXXXXXXXXXXXXXXXXXXXXXXXSYEDYRRQRTYLFQLVRK 241
           DLT   S P++LM+Y                            ++ Y +QRT+LFQL+RK
Sbjct: 187 DLTDCVSPPVILMAYKKRRKADKHFFNKIKRNFDVLEISNFSKFDYYLKQRTHLFQLIRK 246

>Suva_14.323 Chr14 complement(569944..570705) [762 bp, 253 aa] {ON}
           YNL024C (REAL)
          Length = 253

 Score =  239 bits (610), Expect = 9e-79,   Method: Compositional matrix adjust.
 Identities = 132/247 (53%), Positives = 162/247 (65%), Gaps = 8/247 (3%)

Query: 9   FEDLVEPRPIEHLGQSDLSYQGQLDPPLKIHEDGGESGCGGKVWIAGNLLCEFILEKSKD 68
           FEDLV PR  EH GQ+DLS+ G+L P LKI EDGGESGCGGKVWIAG LLCE+ILEKS D
Sbjct: 8   FEDLVVPRLKEHFGQTDLSFGGKLLPALKICEDGGESGCGGKVWIAGELLCEYILEKSDD 67

Query: 69  GRVLSQFPGYERQFKNIIELGSGTGLVGLCVGLHGKYNGATDTNVYITDIEGLCPLMQKN 128
             +LS+    +R F  ++ELGSGTGLVGLCVGL  K     +T VY+TDI+ L PLM++N
Sbjct: 68  -HLLSETVHEKRPFMKVLELGSGTGLVGLCVGLLEKNKFHDNTKVYVTDIDRLVPLMERN 126

Query: 129 VELNGLDGMVHPRPLFWGEPLSDEFTRQP-------IDLVLAADCVYLEKAFPLLEKTLL 181
           +EL+ +   V  R L+WGEPLS +F+ Q        +DLVLAADCVYLEKAFPLLEKTLL
Sbjct: 127 IELDKVQYEVLARELWWGEPLSGDFSPQEGDLQVNNVDLVLAADCVYLEKAFPLLEKTLL 186

Query: 182 DLTAGESQPLVLMSYXXXXXXXXXXXXXXXXXXXXXXXXXXXSYEDYRRQRTYLFQLVRK 241
           DLT   S P++LM+Y                            ++ Y +Q+T+LFQLVRK
Sbjct: 187 DLTNCISPPVILMAYKKRRKADKQFFNKIKRNFDVLEIKDFIKFDYYLKQKTHLFQLVRK 246

Query: 242 PARAPHA 248
            +    A
Sbjct: 247 CSSHSEA 253

>KNAG0H01980 Chr8 complement(348806..349555) [750 bp, 249 aa] {ON}
           Anc_2.289 YNL024C
          Length = 249

 Score =  231 bits (590), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 125/250 (50%), Positives = 158/250 (63%), Gaps = 10/250 (4%)

Query: 1   MTETFTAVFEDLVEPRPIEHLGQSDLSYQGQLDPPLKIHEDGGESGCGGKVWIAGNLLCE 60
           M E F + F DLV  RPIEH G  D+S+ G+L+P L+IHEDGGESGCGGKVW+AG LLC+
Sbjct: 1   MNEIFGS-FGDLVVARPIEHCGSHDMSFGGRLNPALQIHEDGGESGCGGKVWVAGELLCD 59

Query: 61  FILEKSKDGRVLSQFPGYERQ-FKNIIELGSGTGLVGLCVGLHGKYNGATDTNVYITDIE 119
           +I+EKS +  +L+ +   + Q F+NIIELGSGTGLVGLCV L  K        V ITDI+
Sbjct: 60  YIVEKSDEDDLLANWDTSKVQKFRNIIELGSGTGLVGLCVALLEKQFFHKGIKVTITDID 119

Query: 120 GLCPLMQKNVELNGLDGMVHPRPLFWGEPLSDEFTRQ--------PIDLVLAADCVYLEK 171
            L PLMQKN+ELN ++  +    L+WGEPLS  F            +DL+LAADCVYLEK
Sbjct: 120 QLVPLMQKNIELNCVNTEMIAEELWWGEPLSGAFAPHSEGLSKVTSVDLILAADCVYLEK 179

Query: 172 AFPLLEKTLLDLTAGESQPLVLMSYXXXXXXXXXXXXXXXXXXXXXXXXXXXSYEDYRRQ 231
           AFPLLEKTLLDLT     P++LM+Y                           +Y+ Y +Q
Sbjct: 180 AFPLLEKTLLDLTNCSKPPVILMAYRKRRNADKRFFRKIGKHFTVREITDFSTYDQYLKQ 239

Query: 232 RTYLFQLVRK 241
           RT+LF+L+R 
Sbjct: 240 RTHLFELIRN 249

>KLLA0E08295g Chr5 complement(746166..746966) [801 bp, 266 aa] {ON}
           similar to uniprot|P53970 Saccharomyces cerevisiae
           YNL024C Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 266

 Score =  231 bits (590), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 127/238 (53%), Positives = 165/238 (69%), Gaps = 3/238 (1%)

Query: 5   FTAVFEDLVEPRPIEHLGQSDLSYQGQLDPPLKIHEDGGESGCGGKVWIAGNLLCEFILE 64
           F++ FE+LV  RPIEHLG+ D+S+ G+L  PL I+EDGGESGCGGKVWIAG LLCE+ILE
Sbjct: 30  FSSCFEELVPARPIEHLGKIDMSFNGKLPSPLIINEDGGESGCGGKVWIAGELLCEYILE 89

Query: 65  KSKDGRVLSQ-FPGYERQFKNIIELGSGTGLVGLCVGLHGKYNGATDTNVYITDIEGLCP 123
           KS    +LS  FP  +    +++ELGSGTGLVGLCVGL  + N  +D  VYI+DI+ L  
Sbjct: 90  KSDKEHLLSHLFP--DGNCNSVLELGSGTGLVGLCVGLMDQANEYSDREVYISDIDQLLG 147

Query: 124 LMQKNVELNGLDGMVHPRPLFWGEPLSDEFTRQPIDLVLAADCVYLEKAFPLLEKTLLDL 183
           LM+ N+++NGLD  VH   L+WG PL D F ++P+DLVLAADCVYLE AFPLLEKTLL+L
Sbjct: 148 LMESNIQVNGLDDKVHAEVLWWGNPLPDVFVKKPVDLVLAADCVYLEAAFPLLEKTLLEL 207

Query: 184 TAGESQPLVLMSYXXXXXXXXXXXXXXXXXXXXXXXXXXXSYEDYRRQRTYLFQLVRK 241
           T GE+ P++LM+Y                           +++ Y +QRT+LFQL+R+
Sbjct: 208 TDGENVPIILMAYKKRRKADKHFFQKIKKNFKIVEIRDFINFDKYLKQRTHLFQLMRE 265

>SAKL0E07612g Chr5 complement(614835..615593) [759 bp, 252 aa] {ON}
           similar to uniprot|P53970 Saccharomyces cerevisiae
           YNL024C Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 252

 Score =  228 bits (580), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 131/245 (53%), Positives = 163/245 (66%), Gaps = 9/245 (3%)

Query: 5   FTAVFEDLVEPRPIEHLGQSDLSYQGQLDPPLKIHEDGGESGCGGKVWIAGNLLCEFILE 64
           FTA F DLV  RP EHLG SDLS+ G+L PPLKIHEDGGESGCGGKVWIAG LLCEF+LE
Sbjct: 7   FTACFNDLVPSRPTEHLGDSDLSFGGKLSPPLKIHEDGGESGCGGKVWIAGELLCEFLLE 66

Query: 65  KSKDGRVLSQFPG---YERQFKNIIELGSGTGLVGLCVGLHGKYNGATDTNVYITDIEGL 121
           KS    + SQ+     ++   K I+ELGSGTGLVGLC+GL  K N   D ++Y+TDI+ L
Sbjct: 67  KSDQQGLFSQWNSDTRFQSPIKKIVELGSGTGLVGLCLGLLNKQNKLKDVDIYVTDIDQL 126

Query: 122 CPLMQKNVELNGLDGMVHPRPLFWGEPLSDEF-----TRQPIDLVLAADCVYLEKAFPLL 176
             LM +N++LN L+  V P+ L+WGEPL  EF      ++ +DL+LAADCVYLEKAFPLL
Sbjct: 127 VTLMDRNIKLNELEH-VFPKELWWGEPLKPEFAPTRSNQRQVDLILAADCVYLEKAFPLL 185

Query: 177 EKTLLDLTAGESQPLVLMSYXXXXXXXXXXXXXXXXXXXXXXXXXXXSYEDYRRQRTYLF 236
           E TLLDLT+ +  P++LMSY                            ++ Y +Q+T+LF
Sbjct: 186 EVTLLDLTSCKDPPIILMSYKKRRKADKHFFKQIKKNFDVLEINEFTRFDHYLKQKTHLF 245

Query: 237 QLVRK 241
           QLVRK
Sbjct: 246 QLVRK 250

>Kwal_27.11513 s27 complement(832028..832783) [756 bp, 251 aa] {ON}
           YNL024C - Hypothetical ORF [contig 27] FULL
          Length = 251

 Score =  226 bits (576), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 129/251 (51%), Positives = 157/251 (62%), Gaps = 10/251 (3%)

Query: 1   MTE--TFTAVFEDLVEPRPIEHLGQSDLSYQGQLDPPLKIHEDGGESGCGGKVWIAGNLL 58
           MTE   FT  F DLV  RP+EHLG SDLS+ GQ++P LKIHEDGGE+GCGGK+W+AG LL
Sbjct: 1   MTELLDFTTQFIDLVPSRPVEHLGDSDLSFGGQVEPALKIHEDGGENGCGGKLWVAGELL 60

Query: 59  CEFILEKSKDGRVLSQF---PGYERQFKNIIELGSGTGLVGLCVGLHGKYNGATDTNVYI 115
           C+++LE S    +LS+       +  F NI+ELGSGTGLVGLC G   + +G   T VYI
Sbjct: 61  CDYLLENSDAKGILSKRMVEMDVKAPFLNILELGSGTGLVGLCAGSVAQLHGDR-TKVYI 119

Query: 116 TDIEGLCPLMQKNVELNGLDGMVHPRPLFWGEPLSDEF----TRQPIDLVLAADCVYLEK 171
           TDI+ L  LM+ NV LN L   V    L WGEPL ++F        +DLVLAADCVYLE 
Sbjct: 120 TDIDRLVGLMETNVNLNHLAETVSVEILSWGEPLKEKFGPDAKADKVDLVLAADCVYLET 179

Query: 172 AFPLLEKTLLDLTAGESQPLVLMSYXXXXXXXXXXXXXXXXXXXXXXXXXXXSYEDYRRQ 231
           AFPLLEKTLLDLT G++ P VLMSY                            Y+ Y ++
Sbjct: 180 AFPLLEKTLLDLTEGDTPPAVLMSYRKRRKADKNFFRLIRKNFKIVPITNFIRYDYYLKK 239

Query: 232 RTYLFQLVRKP 242
           +T+LFQLVR P
Sbjct: 240 QTHLFQLVRIP 250

>KAFR0H03290 Chr8 complement(626525..627262) [738 bp, 245 aa] {ON}
           Anc_2.289 YNL024C
          Length = 245

 Score =  217 bits (553), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 118/251 (47%), Positives = 150/251 (59%), Gaps = 16/251 (6%)

Query: 1   MTETFTAVFEDLVEPRPIEHLGQSDLSYQGQLDPPLKIHEDGGESGCGGKVWIAGNLLCE 60
           M E F   +  L++ RPIEHLG +DLS+ GQL P +KI+EDGG SGCGGKVWIAG LLCE
Sbjct: 1   MNEVFGE-YVGLIDTRPIEHLGSADLSFDGQLSPAMKIYEDGGASGCGGKVWIAGELLCE 59

Query: 61  FILEKSKDGRVLSQFPGYERQFKNIIELGSGTGLVGLCVGLHGKYNGATDTNVYITDIEG 120
           +++EKS    +L      +   KNI+ELGSGTGLVG+CVGL  K     D  V ITDI G
Sbjct: 60  YLIEKSDSENLLC-----DGSIKNILELGSGTGLVGICVGLMEKQRFHKDIKVSITDIGG 114

Query: 121 LCPLMQKNVELNGLDGMVHPRPLFWGEPLSDEFTRQP----------IDLVLAADCVYLE 170
           L PLM++N+ LN +      + L WG+ L  E+              +DLV+AADCVY E
Sbjct: 115 LVPLMERNILLNKIADATVAKELMWGQQLPSEYMTTSVDGNCDNVSNVDLVVAADCVYAE 174

Query: 171 KAFPLLEKTLLDLTAGESQPLVLMSYXXXXXXXXXXXXXXXXXXXXXXXXXXXSYEDYRR 230
           KAFPLLEK LLDLT  ++ P++LM+Y                           S+E Y +
Sbjct: 175 KAFPLLEKILLDLTNCDNPPIILMAYRKRRKADKRFFVRIRKNFDVIEIDDFSSHEKYMK 234

Query: 231 QRTYLFQLVRK 241
           QRT+LF+L RK
Sbjct: 235 QRTHLFELKRK 245

>KLLA0E21539g Chr5 complement(1923103..1924305) [1203 bp, 400 aa]
           {ON} similar to uniprot|P38347 YBR271W Saccharomyces
           cerevisiae Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 400

 Score = 63.5 bits (153), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 47/140 (33%), Positives = 71/140 (50%), Gaps = 20/140 (14%)

Query: 32  LDPPLKIHEDGGES-GCGGKVWIAGNLLCEFILEKSKDGRVLSQFPGYERQFKNIIELGS 90
           LD  +K++E    S   G K W +  +L + I+      RVL              ELGS
Sbjct: 200 LDTSIKLYEPALTSDNLGLKTWGSSLMLSQKIIGIPAGKRVL--------------ELGS 245

Query: 91  GTGLVGLCVGLHGKYNGATDTNVYITDIEGLCPLMQKNVELNGLDGMVHPRPLFWGEPLS 150
           GTGLVG+   L    NG  D+ +++TD+  + P +Q NV LN L+  V    L W +PLS
Sbjct: 246 GTGLVGISYALTHSING--DSVIFLTDLPEILPNLQYNVRLNNLND-VTADVLDWTDPLS 302

Query: 151 --DEFTRQPIDLVLAADCVY 168
             +++  +P D ++ AD +Y
Sbjct: 303 FTEKYGNEPFDTIVIADPIY 322

>KAFR0C04250 Chr3 (844020..845195) [1176 bp, 391 aa] {ON} Anc_1.325
           YBR271W
          Length = 391

 Score = 58.9 bits (141), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 62/133 (46%), Gaps = 17/133 (12%)

Query: 46  GCGGKVW----IAGNLLCEFILEKSKDGRVLSQFPGYERQFKNIIELGSGTGLVGLCVGL 101
             G K W    I  N+LC+ I     D   L  F G     K I+ELGSGTGLVG+ V  
Sbjct: 192 NLGWKTWGSSLILSNILCDRI-----DENFLKSFNG-----KRILELGSGTGLVGISVAS 241

Query: 102 HGKYNGATDT-NVYITDIEGLCPLMQKNVELNGLDGMVHPRPLFWGEPLS--DEFTRQPI 158
             +  G  D   +Y+TD+  +   ++KN+ +N L   V    L W  P S    +     
Sbjct: 242 KLEEIGVLDEYEIYLTDLPEIVTNLEKNISINQLANRVVSDVLDWTNPESFVSNYGDTRF 301

Query: 159 DLVLAADCVYLEK 171
           D++L +D +Y  K
Sbjct: 302 DVLLISDPIYSSK 314

>SAKL0D06798g Chr4 complement(564525..565790) [1266 bp, 421 aa] {ON}
           similar to uniprot|P38347 YBR271W Saccharomyces
           cerevisiae Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 421

 Score = 57.8 bits (138), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 51/177 (28%), Positives = 80/177 (45%), Gaps = 20/177 (11%)

Query: 14  EPRPIEHLGQSDLSYQGQLDPPLKIHEDGGESGCGGKVWIAGNLLCEFILEKSKDGRVLS 73
           +P    H    +LS++  L  P    ++      G K W A       IL +    R  S
Sbjct: 191 QPSMTRHFQMDNLSHRVSLYEPSLTSDN-----LGLKTWGAS-----LILSQKICNRFNS 240

Query: 74  QFPGYERQFKNIIELGSGTGLVGLCVGLHGKYNGAT--DTNVYITDIEGLCPLMQKNVEL 131
            F G     + ++ELGSGTGLVG+      K +        +Y+TD+  + P +QKNVE+
Sbjct: 241 IFAGTGNLLR-VLELGSGTGLVGITFSCKYKESKTALGSCEMYLTDLPEIVPNLQKNVEI 299

Query: 132 NGLDGM----VHPRPLFWGEPLS--DEFTRQPIDLVLAADCVYLEKAFPLLEKTLLD 182
           N L+      V    L W  P+S  +++     D++L AD +Y     P+   T++D
Sbjct: 300 NNLNSQSGLAVCADVLDWTNPVSFTEKYGDDKFDVILIADPIY-SPQHPVWVVTMID 355

>Smik_2.414 Chr2 (730531..731784) [1254 bp, 417 aa] {ON} YBR271W
           (REAL)
          Length = 417

 Score = 57.8 bits (138), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 39/127 (30%), Positives = 62/127 (48%), Gaps = 5/127 (3%)

Query: 46  GCGGKVWIAGNLLCEFILEKSKDGRVLSQFPGYERQFKNIIELGSGTGLVGLCVGLHGK- 104
             G K W +  +L + ++++     +        ++ K ++ELGSGTGLVGL      K 
Sbjct: 217 NLGWKTWGSSLILSQLVVDRLHTADMDFVANRGTKRIK-VLELGSGTGLVGLSWASKWKE 275

Query: 105 YNGATDTNVYITDIEGLCPLMQKNVELNGLDGMVHPRPLFWGEPLS--DEF-TRQPIDLV 161
             G  +T +++TD+  +   ++KNV LN L   V    L W  P S  D F      D++
Sbjct: 276 LYGIDNTEIFVTDLPDIVTNLKKNVSLNNLQDFVQAEILDWTNPQSFIDRFGYENEFDII 335

Query: 162 LAADCVY 168
           L AD +Y
Sbjct: 336 LIADPIY 342

>NDAI0J02860 Chr10 complement(713765..714808) [1044 bp, 347 aa] {ON}
           Anc_4.352 YJR129C
          Length = 347

 Score = 57.0 bits (136), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 83/182 (45%), Gaps = 25/182 (13%)

Query: 8   VFEDLVEPRPIEHLGQSDLSYQGQLDPPLKIHED-------GGESGCGGKVWIAGNLLCE 60
           ++E  +E  PI++  ++      +++  +KI           G+S  G + W     L +
Sbjct: 95  IYEKYMELIPIKYDAEASDIIMYRINENIKIKVXXEQPNIISGKSTTGFRTWEGAVYLSK 154

Query: 61  FILEKSKDGRVLSQFPGYERQFKNIIELGSGTGLVGLCVGLHGKYNGATDTNVYIT--DI 118
           F++   +          Y  +  ++IELG+GTGLV LC+  +    G     VY+T  D 
Sbjct: 155 FLINNCE---------KYLIEKTDVIELGAGTGLVSLCILENDLQKGIKRDKVYVTDGDS 205

Query: 119 EGLCPLMQKNVELNGL---DGMVHPRPLFWGEPLSDEFTRQ---PIDLVLAADCVYLEKA 172
           E +  ++ KN ELN +   D  V  R L+W +P +++   +    I LV+ AD  Y    
Sbjct: 206 ELVSSILNKNFELNNVNIEDENVILRKLWWNDP-NEKIAGEDNGKIGLVVGADITYDNSV 264

Query: 173 FP 174
            P
Sbjct: 265 IP 266

>Kpol_1066.17 s1066 complement(28462..29769) [1308 bp, 435 aa] {ON}
           complement(28462..29769) [1308 nt, 436 aa]
          Length = 435

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 70/148 (47%), Gaps = 14/148 (9%)

Query: 31  QLDPPLKIHEDG-GESGCGGKVWIAGNLLCEFILEKSKDGRVLSQFPGYERQFKNIIELG 89
            LD  +K++E        G K W +  +L + ++    + +  +Q     R    I+ELG
Sbjct: 215 NLDQTVKLYEPSLTADNLGWKTWGSSLILSQKMVNFLNNYKYSNQSDDKLR----ILELG 270

Query: 90  SGTGLVGLCVGLHGKY-------NGATDTNVYITDIEGLCPLMQKNVELNGLDGMVHPRP 142
           +GTGLVG+      K        N   +T + +TD+  +   +Q+N+ +N L+ +     
Sbjct: 271 AGTGLVGISWSCKWKEMMKLTNGNNLPNTEIILTDLPEIVGNLQRNISINNLNDIARASV 330

Query: 143 LFWGEPLS--DEFTRQPIDLVLAADCVY 168
           L W  P S   E++ +  D++L AD +Y
Sbjct: 331 LDWTNPKSFIQEYSNEKFDIILVADPIY 358

>NCAS0B07410 Chr2 complement(1401275..1402519) [1245 bp, 414 aa]
           {ON} Anc_1.325 YBR271W
          Length = 414

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 64/129 (49%), Gaps = 18/129 (13%)

Query: 48  GGKVWIAGNLLCEFI---LEKSKDGRVLSQFPGYERQFKNIIELGSGTGLVGLCVGLHGK 104
           G K W A  +L + +   LEK+KD + +            ++ELGSGTGLVG+      +
Sbjct: 221 GWKTWGASLILSQKVVNLLEKNKDQKHIHPL--------RVLELGSGTGLVGIAWASKWR 272

Query: 105 YN-GATDTNVYITDIEGLCPLMQKNVELNGLDGMVHPRPLFWGEPLSDEFTR----QPID 159
            + G  +  +++TD+  +   ++KNV+ N L   V    L W  P  D+F      +  D
Sbjct: 273 QSFGTENIEMFVTDLPDIVANLKKNVQTNDLTTFVEADILDWTNP--DDFIEKHGDEKFD 330

Query: 160 LVLAADCVY 168
           ++L AD +Y
Sbjct: 331 VILVADPIY 339

>TDEL0D01940 Chr4 (376261..377478) [1218 bp, 405 aa] {ON} Anc_1.325
           YBR271W
          Length = 405

 Score = 55.1 bits (131), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 43/150 (28%), Positives = 75/150 (50%), Gaps = 19/150 (12%)

Query: 26  LSYQGQLDPPLKIHEDG-GESGCGGKVWIAGNLLCEFILEKSKDGRVLSQFPGYERQFK- 83
            +++G L  P++I+E        G K W A      FIL +    ++++        FK 
Sbjct: 192 FTFEG-LPSPIEIYEPSLTADNLGWKTWGAS-----FILSQ----KLINVLAESTFNFKP 241

Query: 84  NIIELGSGTGLVG---LCVGLHGKYNGATDTNVYITDIEGLCPLMQKNVELNGLDGMVHP 140
            ++ELGSGTGL G   LC  +    NG T+  +++TD+  +   +QKNVE+N ++     
Sbjct: 242 RVLELGSGTGLAGISWLCKWVQKYGNGHTE--IFLTDLPVIVANLQKNVEVNKVESFATV 299

Query: 141 RPLFWGEPLS--DEFTRQPIDLVLAADCVY 168
             L W +P    + +T    D+++ +D +Y
Sbjct: 300 SALDWTDPTDFINSYTDDEFDILIVSDPIY 329

>Skud_2.403 Chr2 (713779..715032) [1254 bp, 417 aa] {ON} YBR271W
           (REAL)
          Length = 417

 Score = 54.7 bits (130), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 39/127 (30%), Positives = 61/127 (48%), Gaps = 5/127 (3%)

Query: 46  GCGGKVWIAGNLLCEFILEKSKDGRVLSQFPGYERQFKNIIELGSGTGLVGLCVGLHGKY 105
             G K W +  +L + +++      V       +++ K ++ELGSGTGLVGL      K 
Sbjct: 217 NLGWKTWGSSLILSQLLVDYLHTVGVHITASCNQKKIK-VLELGSGTGLVGLSWASKWKE 275

Query: 106 NGATDT-NVYITDIEGLCPLMQKNVELNGLDGMVHPRPLFWGEP--LSDEFTRQ-PIDLV 161
              TD   +++TD+  +   ++KNV LN L   V    L W  P    D F  +   D++
Sbjct: 276 LYGTDKMEIFVTDLPEIVTNLKKNVSLNNLQDFVQAEILDWTNPQDFIDRFGHENEFDII 335

Query: 162 LAADCVY 168
           L AD +Y
Sbjct: 336 LVADPIY 342

>ZYRO0G20548g Chr7 complement(1693797..1694990) [1194 bp, 397 aa]
           {ON} similar to uniprot|P38347 YBR271W Saccharomyces
           cerevisiae Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 397

 Score = 54.3 bits (129), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 66/127 (51%), Gaps = 13/127 (10%)

Query: 46  GCGGKVWIAGNLLCEFILEKSKDGRVLSQFPGYE-RQFKNIIELGSGTGLVGLCVGLHG- 103
             G K W +      FIL +    +++   P +   +   ++ELGSGTGL G+   +   
Sbjct: 203 NLGWKTWGSS-----FILSQ----KLIKIVPHFNPTKLHRVLELGSGTGLAGISWLMKWI 253

Query: 104 KYNGATDTNVYITDIEGLCPLMQKNVELNGLDGMVHPRPLFWG--EPLSDEFTRQPIDLV 161
           + +G ++  ++ TD++ + P ++KNVE+NG+        L W   E   D+++ +  D++
Sbjct: 254 EIHGNSNIEMFFTDLQEIVPNLRKNVEINGISDNSVVDTLDWTCPEDFVDKYSSEKFDII 313

Query: 162 LAADCVY 168
           + +D +Y
Sbjct: 314 IVSDPIY 320

>YBR271W Chr2 (744852..746111) [1260 bp, 419 aa] {ON}
           EFM2S-adenosylmethionine-dependent methyltransferase;
           methylates translation elongation factors EF2 (Eft1p and
           Eft2p) and EF3A (Yef3p); belongs to the seven
           beta-strand family; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm;
           predicted to be involved in ribosome biogenesis
          Length = 419

 Score = 54.3 bits (129), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 34/93 (36%), Positives = 51/93 (54%), Gaps = 5/93 (5%)

Query: 80  RQFKNIIELGSGTGLVGLCVGLHGK-YNGATDTNVYITDIEGLCPLMQKNVELNGLDGMV 138
           +Q K ++ELG+GTGLVGL   L  K   G  +  +++TD+  +   ++KNV LN L   V
Sbjct: 253 KQIK-VLELGAGTGLVGLSWALKWKELYGTENIEIFVTDLPEIVTNLKKNVSLNNLGDFV 311

Query: 139 HPRPLFWGEP--LSDEFTRQ-PIDLVLAADCVY 168
               L W  P    D+F  +   D++L AD +Y
Sbjct: 312 QAEILDWTNPHDFIDKFGHENEFDVILIADPIY 344

>Smik_10.422 Chr10 complement(653045..654067) [1023 bp, 340 aa] {ON}
           YJR129C (REAL)
          Length = 340

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 54/183 (29%), Positives = 85/183 (46%), Gaps = 22/183 (12%)

Query: 26  LSYQGQLDPPLKIHED----GGESGCGGKVWIAGNLLCEFILEKSKDGRVLSQFPGYERQ 81
           + Y+   +  +KI E        S  G + W A   + +F++ K      L+Q    E +
Sbjct: 107 IRYRFDRNVRIKIEETPNLISAASTTGFRTWEAALYMGDFLINKPLQELALTQEEQEEDK 166

Query: 82  FK-NIIELGSGTGLVGLCVGLHGKYNGATDTNVYITDIEG--LCPLMQKNVELNGLDGMV 138
            K N++E+G+GTG+V L   L   Y    +  +Y+TD +   +   ++KN ELN  D + 
Sbjct: 167 KKLNVLEIGAGTGIVSLV--LSQNYRNFVN-KMYVTDGDSDLVERQLKKNFELN--DALS 221

Query: 139 HPRP------LFWGEPLSDEFTRQPIDLVLAADCVYLEKAFPLLEKTLLDLTAGESQPLV 192
             +P      L+WG   SD+     IDLV+ AD  Y    FP L K L +  A     + 
Sbjct: 222 EHKPDIRFQRLWWG---SDKVP-DDIDLVVGADVTYDSTIFPELCKCLAECLAINRCKMC 277

Query: 193 LMS 195
           L+S
Sbjct: 278 LLS 280

>TPHA0L00340 Chr12 (45910..46935) [1026 bp, 341 aa] {ON} Anc_4.352
           YJR129C
          Length = 341

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 54/183 (29%), Positives = 81/183 (44%), Gaps = 33/183 (18%)

Query: 11  DLVEPRPIEHLGQSDLSYQGQLDPPLKIHED----GGESGCGGKVWIAGNLLCEFILEKS 66
           D+ +P P     +  + Y+      +KI E           G + W A   L +++++  
Sbjct: 104 DIQQPTPT---TKDVIQYRINNQIKIKIEESPYLISAAGTTGFRTWEAAVYLTKYLIDLG 160

Query: 67  KDGRVLSQFPGYERQFKNIIELGSGTGLVGLCVGLHGKYNGATDTNVYITD-----IEGL 121
                   FP  E   +N +ELGSGTG+V   +GL  KY     T +YITD     +EG 
Sbjct: 161 --------FPP-ETVMENTLELGSGTGMVS--IGLVKKYKDQI-TTLYITDGDSQLLEG- 207

Query: 122 CPLMQKNVELNGLDG--MVHPRPLFWGEPLSDEFTRQPIDLVLAADCVYLEKAFPLLEKT 179
              + +NV LNG+D    V  + L W E    +     +DL++AAD  Y     P L   
Sbjct: 208 --QLSRNVMLNGIDSSDSVKLQKLRWNE----DHIPDNLDLIVAADVTYDSSVIPSLCHC 261

Query: 180 LLD 182
           +LD
Sbjct: 262 ILD 264

>Suva_4.532 Chr4 (916493..917743) [1251 bp, 416 aa] {ON} YBR271W
           (REAL)
          Length = 416

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 49/88 (55%), Gaps = 4/88 (4%)

Query: 85  IIELGSGTGLVGLCVGLHGK-YNGATDTNVYITDIEGLCPLMQKNVELNGLDGMVHPRPL 143
           ++ELGSGTGLVGL      K   G  +  +Y+TD+  +   ++KNV LN L+  V    L
Sbjct: 254 VLELGSGTGLVGLSWAAKWKELYGIHNIEIYVTDLPEIVTNLKKNVLLNNLEDFVQAEVL 313

Query: 144 FWGEPLS--DEFTRQ-PIDLVLAADCVY 168
            W  P +  ++F  +   D++L AD +Y
Sbjct: 314 DWTNPQNFINQFGHEMDFDIILVADPIY 341

>KNAG0C01800 Chr3 (352309..353574) [1266 bp, 421 aa] {ON} Anc_1.325
           YBR271W
          Length = 421

 Score = 52.0 bits (123), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 39/127 (30%), Positives = 63/127 (49%), Gaps = 10/127 (7%)

Query: 48  GGKVWIAGNLLCEFILEKSKDGRVLSQFPGYERQFKNIIELGSGTGLVGLCVGLHGK-YN 106
           G K W +  +L   +++K        + P        ++ELGSGTGLVG+      +   
Sbjct: 223 GWKTWGSSLILSRILIDKLP----FPEPPKVGHPPFRVLELGSGTGLVGISWACKWRELY 278

Query: 107 GATDTN--VYITDIEGLCPLMQKNVELNGLDGMVHPRPLFWGEPLS--DEFT-RQPIDLV 161
           G  D+N  +Y+TD+  +   ++KNV+LN L+  V    L W  P +  + +   Q  DL+
Sbjct: 279 GIEDSNLQIYLTDLPEIVDNLKKNVQLNKLEHAVVADVLDWTNPYNFIERYNGEQSFDLI 338

Query: 162 LAADCVY 168
           L AD +Y
Sbjct: 339 LVADPIY 345

>NDAI0B04730 Chr2 complement(1171595..1172893) [1299 bp, 432 aa]
           {ON} Anc_1.325 YBR271W
          Length = 432

 Score = 51.2 bits (121), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 62/127 (48%), Gaps = 13/127 (10%)

Query: 48  GGKVWIAGNLLCEFI---LEKSKDGRVLSQFPGYERQFKNIIELGSGTGLVGLCVGLHGK 104
           G K W +  +L + +   LE +K+ +         +  + ++ELG+GTGLVG+      +
Sbjct: 233 GWKTWGSSLILSQELVNDLETNKNNK-------KSKSIRRVLELGAGTGLVGIAWACKWR 285

Query: 105 -YNGATDTNVYITDIEGLCPLMQKNVELNGLDGMVHPRPLFWGEP--LSDEFTRQPIDLV 161
              G     +++TD+  +   ++KNV+ N LD  V    L W  P     +++ +  D +
Sbjct: 286 QLYGNESIEMFVTDLPDIVTNLRKNVQNNDLDDFVVADVLDWTNPEDFIKKYSDEKFDTI 345

Query: 162 LAADCVY 168
           L AD +Y
Sbjct: 346 LIADPIY 352

>AER240W Chr5 (1080474..1081646) [1173 bp, 390 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YBR271W
          Length = 390

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 47/149 (31%), Positives = 69/149 (46%), Gaps = 22/149 (14%)

Query: 35  PLKIHEDGGES-GCGGKVWIAGNLLCEFILEKSKDGRVLSQFPGYERQFKNIIELGSGTG 93
           P+ +HE    S   G K W A  LL           R ++ F G +R    ++ELG+GTG
Sbjct: 195 PIVLHEPALTSDNLGLKTWGASLLL----------SRRVAGFTGKKR----VLELGAGTG 240

Query: 94  LVGLCVGLHGKYNGATDTNVYITDIEGLCPLMQKNVELNGLDGMVHPRPLFWGEPLS--D 151
           LVG+   L    N   D +V++TD+  + P ++ N+ LN L   V    L W +P S   
Sbjct: 241 LVGIAYAL---ANIDAD-DVFVTDLPEIVPNLRHNLALNNLTN-VRASVLDWSDPTSFLH 295

Query: 152 EFTRQPIDLVLAADCVYLEKAFPLLEKTL 180
           E      D +  AD +Y      LL +T+
Sbjct: 296 EHGELQFDAIFVADPIYSPNHPQLLVQTV 324

>Kwal_14.2550 s14 complement(809874..811130) [1257 bp, 418 aa] {ON}
           YBR271W - Hypothetical ORF [contig 224] FULL
          Length = 418

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 46/141 (32%), Positives = 70/141 (49%), Gaps = 16/141 (11%)

Query: 36  LKIHEDGGES-GCGGKVWIAGNLLCEFILEKSKDGRVLSQFPGYERQFKNIIELGSGTGL 94
           +++HE    S   G K W A  +L   I +K      LS F   E     I+ELG+GTGL
Sbjct: 208 IELHEPALTSDNLGLKTWGASLVLARKICQK------LSTFEPSENL--RILELGAGTGL 259

Query: 95  VGLCVGLHGKYNGATDT-NVYITDIEGLCPLMQKNVELNGLDG----MVHPRPLFWGEPL 149
           VG+         G+T    V++TD+  + P +QKNV+LN  +      V    L W +P 
Sbjct: 260 VGIAFIQKILEVGSTQKFRVHLTDLPDIVPNLQKNVDLNKCNREPNVEVAVDVLDWTDPS 319

Query: 150 S--DEFTRQPIDLVLAADCVY 168
           S  +++  +  D++L AD +Y
Sbjct: 320 SFQEKYGYKKFDVLLIADPIY 340

>KLTH0H10560g Chr8 complement(912880..914133) [1254 bp, 417 aa] {ON}
           similar to uniprot|P38347 YBR271W Saccharomyces
           cerevisiae Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 417

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 47/148 (31%), Positives = 72/148 (48%), Gaps = 18/148 (12%)

Query: 30  GQLDPPLKIHEDGGES-GCGGKVWIAGNLLCEFILEKSKDGRVLSQFPGYERQFK-NIIE 87
           G L   +K+HE    S   G K W A  +L   + E          F  +ERQ    I+E
Sbjct: 198 GGLRTGVKLHEPALTSDNLGLKTWGASLVLARKLCE---------NFSKFERQRDLRILE 248

Query: 88  LGSGTGLVGLCVGLHG-KYNGATDTNVYITDIEGLCPLMQKNVELNGL----DGMVHPRP 142
           LG+GTGLVG+ + L   + N   + ++++TD+  +   +++NV++N      D  V+   
Sbjct: 249 LGAGTGLVGISLVLKMLESNSGHNCSMHLTDLPEIVTNLKENVKINCCNSRSDLKVYADV 308

Query: 143 LFWGEPLSDEFT--RQPIDLVLAADCVY 168
           L W  P S E T      D++L AD VY
Sbjct: 309 LDWTNPDSFEKTYGAHKFDVLLIADPVY 336

>CAGL0I09438g Chr9 (904886..906106) [1221 bp, 406 aa] {ON} similar
           to uniprot|P38347 Saccharomyces cerevisiae YBR271w
          Length = 406

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 68/142 (47%), Gaps = 8/142 (5%)

Query: 31  QLDPPLKIHEDG-GESGCGGKVWIAGNLLCEFILEKSKDGRVLSQFPGYERQFKNIIELG 89
            LD  + +HE        G K W +  +L E ++   ++   LS      R+ + + ELG
Sbjct: 193 NLDKTIMLHEPSLTADNLGWKTWGSSLILGEIVVSYLEN---LSSTFESNRKVRTL-ELG 248

Query: 90  SGTGLVGLCVGLHGKYNGA-TDTNVYITDIEGLCPLMQKNVELNGLDGMVHPRPLFWGEP 148
           +GTGLVG+      +     + T +Y+TD+  +   ++ NV++N L  +     L W  P
Sbjct: 249 AGTGLVGIAWAAKWRDKFCNSKTEIYLTDLPEIVDNLKDNVKINNLQDIATADVLDWTNP 308

Query: 149 --LSDEFTRQPIDLVLAADCVY 168
              ++++  +  D ++ AD +Y
Sbjct: 309 DTFTEKYGNERFDYIVIADPIY 330

>Skud_10.352 Chr10 complement(622581..623591) [1011 bp, 336 aa] {ON}
           YJR129C (REAL)
          Length = 336

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 76/162 (46%), Gaps = 19/162 (11%)

Query: 42  GGESGCGGKVWIAGNLLCEFILEKSKDGRVLSQFPGYERQFKNIIELGSGTGLVGLCVGL 101
              S  G + W A   + +F++ K      L Q    +R+  N++E+G+GTG+V L   L
Sbjct: 127 SAASTTGFRTWEAALYMGDFLINKPLQQLALMQ--KEDRKKLNVLEIGAGTGIVSLV--L 182

Query: 102 HGKYNGATDTNVYITDIEG--LCPLMQKNVELNGLDGMVHPRP------LFWGEPLSDEF 153
             KY    +  +Y+TD +   +   +++N ELN  D +    P      L+WG   SD  
Sbjct: 183 LEKYREFVN-RMYVTDGDSNLVERQLKRNFELN--DALCENGPDVKLQRLWWG---SDRI 236

Query: 154 TRQPIDLVLAADCVYLEKAFPLLEKTLLDLTAGESQPLVLMS 195
               IDLV+AAD  Y    FP L + L +  A     + L+S
Sbjct: 237 P-DDIDLVVAADVTYDSTIFPELCQCLAECLAISRCKMCLLS 277

>NCAS0J02150 Chr10 complement(415802..416770) [969 bp, 322 aa] {ON}
           Anc_4.352
          Length = 322

 Score = 48.1 bits (113), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 48/94 (51%), Gaps = 6/94 (6%)

Query: 84  NIIELGSGTGLVGLCVGLHGKYNGATDTNVYIT--DIEGLCPLMQKNVELN--GLDGMVH 139
           NI+ELG+GTGLV L +    K        +Y+T  D E +   MQ N ++N   +D  + 
Sbjct: 150 NILELGAGTGLVSLTIASMDKMKDNKLRRMYVTDGDSELVSGQMQDNFQMNEVNVDNHIK 209

Query: 140 PRPLFWGEPLSDEFTRQPIDLVLAADCVYLEKAF 173
            + L+W  P  D+   + +++V+ AD  Y    F
Sbjct: 210 LQKLWWNSP--DQPIPERVNVVIGADVTYDSTCF 241

>TPHA0I02650 Chr9 complement(580125..581390) [1266 bp, 421 aa] {ON}
           Anc_1.325 YBR271W
          Length = 421

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 62/132 (46%), Gaps = 12/132 (9%)

Query: 46  GCGGKVWIAGNLLCEFILEKSKDGRVLSQFPGYERQFKNIIELGSGTGLVGLCVGLHGKY 105
             G K W +  +L ++++      + ++    + R+ + ++ELG+GTGLVG+  G   K 
Sbjct: 213 NLGWKTWGSSLVLSQYLINNF--NKYINVNNCHVRKVR-VLELGAGTGLVGISWGCKWKE 269

Query: 106 NGATDTN-------VYITDIEGLCPLMQKNVELNGLDGMVHPRPLFWGEPLS--DEFTRQ 156
              +  N       +++TD+  +   + KNV  N L        L W +P S  +  T +
Sbjct: 270 EVTSAGNENLQNMELFLTDLPEITNNLAKNVSTNELSDFCKVDVLNWTDPTSFTNTHTEE 329

Query: 157 PIDLVLAADCVY 168
           P   +L AD +Y
Sbjct: 330 PFQYILIADPIY 341

>Suva_12.220 Chr12 complement(343489..344502) [1014 bp, 337 aa] {ON}
           YJR129C (REAL)
          Length = 337

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 47/163 (28%), Positives = 80/163 (49%), Gaps = 23/163 (14%)

Query: 42  GGESGCGGKVWIAGNLLCEFILEKSKDGRVLSQFPGYERQFKNIIELGSGTGLVGLCVGL 101
              S  G + W A   + +F++ +     +L    G +++  N++E+G+GTG+V L V L
Sbjct: 129 SAASTTGFRTWEAALYMGDFLMHEP----LLELVHGDDKKKLNVLEIGAGTGIVSL-VLL 183

Query: 102 HGKYNGATDTNVYITDIEG--LCPLMQKNVELNGLDGMVHPRP------LFWG-EPLSDE 152
           H KY     + +Y+TD +   +   +++N ELN  D      P      L+WG + + DE
Sbjct: 184 H-KYREYV-SKMYVTDGDSDLVETQLRRNFELN--DAWREQSPDIRLQRLWWGSDRVPDE 239

Query: 153 FTRQPIDLVLAADCVYLEKAFPLLEKTLLDLTAGESQPLVLMS 195
                ++LV+AAD  Y    FP L + L +  A     + L+S
Sbjct: 240 -----VNLVVAADVTYDSTIFPELCQCLAECLAMSHCKVCLLS 277

>Kwal_47.16635 s47 complement(37749..38717) [969 bp, 322 aa] {ON}
           YJR129C - Hypothetical ORF [contig 376] FULL
          Length = 322

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 81/188 (43%), Gaps = 35/188 (18%)

Query: 18  IEHLGQSDLSYQGQLDPPLKIHEDGGESGCGGKVWIAGNLLCEFILEKSKDGRVLSQFPG 77
           I +   SD++   Q  P L           G + W A   L E++++         ++  
Sbjct: 108 IRYRFSSDVAVDVQEQPYLLC----ASGTTGFRTWEAALYLAEYLVQNQ-------EYYA 156

Query: 78  YERQFKNIIELGSGTGLVGLCVGLHGKYNGATDTNVYITDIEGLCPLMQK----NVELNG 133
            +R F  I+ELG+GTGLV L   +  +   AT   +Y+TD  G   L+++    N +LN 
Sbjct: 157 QDR-FSRILELGAGTGLVSL---VWSQLFQATMKELYVTD--GDSTLVEQAIRYNFQLNN 210

Query: 134 --------LDGMVHPRPLFWGEPLSDEFTRQPIDLVLAADCVYLEKAFPLLEKTLL-DLT 184
                   LD     + L+WGE +  +     +D+VLAAD  Y     P L   ++  L 
Sbjct: 211 VTAAPANTLDCQYKFQRLWWGEDVVPD-----VDIVLAADVTYDASVVPSLVNCIVASLK 265

Query: 185 AGESQPLV 192
            G    L+
Sbjct: 266 QGAHHALI 273

>KNAG0B06720 Chr2 complement(1329424..1330275) [852 bp, 283 aa] {ON}
           Anc_4.352 YJR129C
          Length = 283

 Score = 45.4 bits (106), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 59/131 (45%), Gaps = 21/131 (16%)

Query: 48  GGKVWIAGNLLCEFILEKSKDGRVLSQFPGYERQFKNIIELGSGTGLVGLCVGLHGKYNG 107
           G + W A   L + ++E  +  R            K ++ELG GTGL  + VG+  +Y  
Sbjct: 107 GFRTWRAATSLSKLLVEHRELTR-----------GKTVLELGCGTGLSSITVGVLDEYK- 154

Query: 108 ATDTNVYITDIEG--LCPLMQKNVELNGLDGMVHPRPLFWGEPLSDEFTRQPIDLVLAAD 165
                +Y+TD +   L  +   N+ LN ++  V  + L W    S++     ID+V+ AD
Sbjct: 155 ----KLYVTDGDTGILSEVTTPNLSLNKVERDVQCQRLVWA---SEDRVPGDIDVVVGAD 207

Query: 166 CVYLEKAFPLL 176
             Y    FP L
Sbjct: 208 ITYDPTVFPEL 218

>Ecym_5513 Chr5 (1042019..1043209) [1191 bp, 396 aa] {ON} similar to
           Ashbya gossypii AER240W
          Length = 396

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 48/90 (53%), Gaps = 10/90 (11%)

Query: 83  KNIIELGSGTGLVGLCVGLHGKYNGATDTNVYITDIEGLCPLMQKNVELNGLDGMVHPRP 142
           + ++ELG+GTGLVG+   +  +   A+   + +TD+  + P ++ N++LN L   VH   
Sbjct: 238 EKVLELGAGTGLVGISYAIAHQ---ASTPQIILTDLPDIVPNLRSNIKLNNLKN-VHAAE 293

Query: 143 LFWGEPLSDEFTRQ----PIDLVLAADCVY 168
           L W +     F  Q      D++L +D +Y
Sbjct: 294 LDWTD--HSTFIAQHGGDKFDMILVSDPIY 321

>KAFR0E04280 Chr5 complement(864926..865873) [948 bp, 315 aa] {ON}
           Anc_4.352 YJR129C
          Length = 315

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 46/157 (29%), Positives = 70/157 (44%), Gaps = 21/157 (13%)

Query: 45  SGCGGKVWIAGNLLCEFILEKSKDGRVLSQFPGYERQFKNIIELGSGTGLVGLCVGLHGK 104
           S  G + W A + LC++I   + D   L+           ++ELG+GTGL  L + L GK
Sbjct: 113 STTGFRTWEAASYLCDYI--SNVDTESLNGCS-------TVLELGAGTGLCSLTL-LKGK 162

Query: 105 YNGATDTNVYIT--DIEGLCPLMQKNVELNGLD----GMVHPRPLFWGEPLSDEFTRQPI 158
           +       VY+T  D E +   +  N +LN ++      V  + L WGE    +     I
Sbjct: 163 FQDDL-KKVYVTDGDTELISGQLLSNFKLNEMEHEIGQKVKLQRLLWGE----DSIPNDI 217

Query: 159 DLVLAADCVYLEKAFPLLEKTLLDLTAGESQPLVLMS 195
           D V+ AD  Y +  F  L K L      ES  + L++
Sbjct: 218 DCVIGADVTYDDTLFDDLFKCLRQCFEIESCKMCLIA 254

>YJR129C Chr10 complement(664000..665019) [1020 bp, 339 aa] {ON}
           Putative protein of unknown function; predicted
           S-adenosylmethionine-dependent methyltransferase of the
           seven beta-strand family; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm
          Length = 339

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 82/180 (45%), Gaps = 17/180 (9%)

Query: 26  LSYQGQLDPPLKIHED----GGESGCGGKVWIAGNLLCEFILEKSKDGRVLSQFPGYERQ 81
           + Y+   D  +KI E        S  G + W A   + +F++ K        Q     ++
Sbjct: 107 VRYRFDEDVKIKIEETPNLISAASTTGFRTWEAALYMGDFLIHKPLQELAPVQGQDDGKK 166

Query: 82  FKNIIELGSGTGLVGLCVGLHGKYNGATDTNVYITDIEG--LCPLMQKNVELNGLDGMVH 139
             N++E+G+GTG+V L +    KY+   +  +Y+TD +   +   +++N ELN       
Sbjct: 167 KLNVLEVGAGTGIVSLVI--LQKYHEFVN-KMYVTDGDSNLVETQLKRNFELNNEVRENE 223

Query: 140 P----RPLFWGEPLSDEFTRQPIDLVLAADCVYLEKAFPLLEKTLLDLTAGESQPLVLMS 195
           P    + L+WG   SD    + IDLV+ AD  Y     P L + L +  A +   L L+S
Sbjct: 224 PDIKLQRLWWG---SDRVP-EDIDLVVGADVTYDPTILPDLCECLAECLALDRCKLCLLS 279

>Kpol_1028.81 s1028 (182083..183093) [1011 bp, 336 aa] {ON}
           (182083..183093) [1011 nt, 337 aa]
          Length = 336

 Score = 42.4 bits (98), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 45/145 (31%), Positives = 65/145 (44%), Gaps = 36/145 (24%)

Query: 48  GGKVWIAGNLLCEFILEKSKDGRVLSQFPGYERQF--KNIIELGSGTGLVGLCVGLHGKY 105
           G + W A   +  F +E            GY      KNI+ELG+GTGLV   +GL  +Y
Sbjct: 140 GFRTWEAALFMTSFFVE-----------TGYLDTMSKKNILELGAGTGLVS--IGLCKQY 186

Query: 106 NGATDTNVYITD-----IEGLCPLMQKNVELNGL--DGMVHPRPLFWG---EPLSDEFTR 155
             + D  +Y+TD     +EG    + KN   N L  +  V  + L+W     PL      
Sbjct: 187 EDSID-KIYVTDGDSQLVEG---QLLKNFNENELSHNDRVILQKLWWNVDDVPLD----- 237

Query: 156 QPIDLVLAADCVYLEKAFPLLEKTL 180
             +DL++AAD  Y     P L +T+
Sbjct: 238 --LDLIVAADVTYDSSVVPDLCETI 260

>KLLA0B04444g Chr2 (395811..396737) [927 bp, 308 aa] {ON} similar to
           uniprot|P47163 Saccharomyces cerevisiae YJR129C Putative
           S-adenosylmethionine-dependent methyltransferase of the
           seven beta-strand family
          Length = 308

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 63/148 (42%), Gaps = 24/148 (16%)

Query: 43  GESGCGGKVWIAGNLLCEFILEKSKDGRVLSQFPG-YERQFKNIIELGSGTGLVGLCVGL 101
            +   G + W A   LC +          ++Q PG +      ++ELG GTG++ +   +
Sbjct: 110 AQGTTGFRTWEAALFLCHY----------MTQHPGLFVTHDSLMLELGCGTGIISILYKM 159

Query: 102 HGKYNGATDTNVYITDIEGLCPLMQK---NVELNGL---DGMVHP--RPLFWGEPLSDEF 153
                G       I   +G   L+Q+   N +LNG    DG V+   + L W E   DE 
Sbjct: 160 IKDSQGDCKAGTIIV-TDGDSNLLQQVSTNFQLNGSLSNDGDVNIGFQRLRWNE---DEL 215

Query: 154 TR-QPIDLVLAADCVYLEKAFPLLEKTL 180
           +    IDL+LAAD  Y     P L K L
Sbjct: 216 SNYNEIDLILAADVTYDTSVIPDLVKCL 243

>ZYRO0B14916g Chr2 complement(1217570..1218466) [897 bp, 298 aa]
           {ON} weakly similar to uniprot|P47163 Saccharomyces
           cerevisiae YJR129C Putative
           S-adenosylmethionine-dependent methyltransferase of the
           seven beta-strand family
          Length = 298

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 56/130 (43%), Gaps = 26/130 (20%)

Query: 48  GGKVWIAGNLLCEFILEKSKDGRVLSQFPGYERQFKNIIELGSGTGLVGLCVGLHGKYNG 107
           G + W A   LC+++  +            +  Q   ++E+G+GTGLV   + L G    
Sbjct: 117 GHRTWEASLYLCQYLFRQD-----------WLPQVNEVLEIGAGTGLVSTALALAGHQVT 165

Query: 108 ATDTNVYITDIEGLCPLMQKNVELNGLDGMVHPRPLFWGEPLSDEFTRQP-IDLVLAADC 166
           +TD +  + +       ++K   LN ++  +  + L WG        + P  DLV+AAD 
Sbjct: 166 STDGDPMVVE------QLRKTFNLNEVN--IEAQVLEWG------LQKPPKSDLVVAADV 211

Query: 167 VYLEKAFPLL 176
            Y     P L
Sbjct: 212 TYDTAVIPSL 221

>KLTH0D17996g Chr4 (1490856..1491809) [954 bp, 317 aa] {ON} similar
           to uniprot|P47163 Saccharomyces cerevisiae YJR129C
           Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 317

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 61/145 (42%), Gaps = 31/145 (21%)

Query: 48  GGKVWIAGNLLCEFILEKSKDGRVLSQFPGYER-QFKNIIELGSGTGLVGLCVGLHGKYN 106
           G + W +   L E++ E          FP +   +F   +ELG+GTGLV +      K  
Sbjct: 124 GFRTWESALYLSEYLAE---------NFPEFSAGKFSRALELGAGTGLVSIA---WAKLF 171

Query: 107 GATDTNVYITDIEGLCPLMQK----NVELNGLDG-------MVHPRPLFWGEPLSDEFTR 155
                 + +TD  G   L+++    N +LNG+D            + L+WGE    E   
Sbjct: 172 KGYIKELIVTD--GDSSLVEQAARVNFKLNGIDTRECHGDCAYKFQRLWWGEDAVPE--- 226

Query: 156 QPIDLVLAADCVYLEKAFPLLEKTL 180
             +D+VLAAD  Y     P L   L
Sbjct: 227 --VDIVLAADVTYDSSVIPSLTHCL 249

>Ecym_1127 Chr1 (260356..261318) [963 bp, 320 aa] {ON} similar to
           Ashbya gossypii AER161C
          Length = 320

 Score = 39.3 bits (90), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 54/130 (41%), Gaps = 23/130 (17%)

Query: 48  GGKVWIAGNLLCEFILEKSKDGRVLSQFPGYERQFKNIIELGSGTGLVGLCVGLHGKYNG 107
           G + W A   LC ++ E                +F  ++ELG+GTG+V L    H   +G
Sbjct: 131 GFRTWEAALYLCHYLCESRP-------------RFGTMLELGAGTGIVSL--TWHKLQSG 175

Query: 108 ATDTNVYITDIEGLCPLMQKNVELNGLD---GMVHPRPLFWGEPLSDEFTRQPIDLVLAA 164
              T     D   +   +++    NG+D   G VH + L W     D   +   D++LAA
Sbjct: 176 QFMTYATDGDKNIIGKQLKETFISNGVDLDKGNVHLQRLLWN---VDSIPKN--DIILAA 230

Query: 165 DCVYLEKAFP 174
           D  Y   A P
Sbjct: 231 DVTYDHTAIP 240

>TBLA0D05200 Chr4 complement(1278210..1279409) [1200 bp, 399 aa]
           {ON} Anc_1.325 YBR271W
          Length = 399

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 45/90 (50%), Gaps = 11/90 (12%)

Query: 85  IIELGSGTGLVGLCVGLHGKYNGATDTNVYITDIEGLCPLMQKNVELNGLD--GMVHPRP 142
           ++ELGSGTGLVG+   +    +    + V++TD+  + P ++ N +LN L     V    
Sbjct: 237 VLELGSGTGLVGITYTIS---HSNEFSQVFLTDLPEIVPNLRTNAKLNDLSTHNSVIADV 293

Query: 143 LFWGEPLSDEFTRQ----PIDLVLAADCVY 168
           L W     D F  +      D++L AD +Y
Sbjct: 294 LDWTN--HDSFVEKYGDIQFDIILIADPIY 321

>AER161C Chr5 complement(942007..942957) [951 bp, 316 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR129C
          Length = 316

 Score = 36.6 bits (83), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 33/95 (34%), Positives = 45/95 (47%), Gaps = 18/95 (18%)

Query: 86  IELGSGTGLVGLCVGLHGKYNGATDTNVYITDIEGLCPLMQ----KNVELNGLDG--MVH 139
           +ELG+GTGLV L            +++ YITD  G   L++    +N+ LNGL       
Sbjct: 154 LELGAGTGLVSL-----AWLRSRPESSAYITD--GDSALLEGHLAENLALNGLRSSPRAS 206

Query: 140 PRPLFWGEPLSDEFTRQPIDLVLAADCVYLEKAFP 174
            R L+W     DE  +   D+VLAAD  Y     P
Sbjct: 207 LRRLWWN---VDEVPQN--DIVLAADVTYDSTVLP 236

>TDEL0D00640 Chr4 (113100..114083) [984 bp, 327 aa] {ON} Anc_4.352
           YJR129C
          Length = 327

 Score = 36.2 bits (82), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 71/176 (40%), Gaps = 21/176 (11%)

Query: 84  NIIELGSGTGLVGLCVGLHGKYNGATDTNVYITDIEG-LCPLMQKNVELNGLD-GMVHPR 141
            ++ELG+GTG+V   + L     G  D  +Y+TD +  L    +KN  LNG++    +  
Sbjct: 161 KVLELGAGTGMVSATLALTNP--GRLD-KLYVTDGDWHLTQQARKNFSLNGIETSNTYFE 217

Query: 142 PLFWGE-PLSDEFTRQPIDLVLAADCVYLEKAFPLLEKTLLDLTAGESQPLVLMSYXXXX 200
            L W E P+  +     +D V+AAD  Y     P L K +       +  LV  +     
Sbjct: 218 QLRWNEDPVPTK-----LDYVVAADVTYDSTVVPDLCKCIAQSLTPRTTCLVAATVRNEN 272

Query: 201 XXXXXXXXXXXXXXXXXXXXXXXSYEDYRRQ----RTYLFQLVRKPAR----APHA 248
                                  +  DYR Q    +T LF+ ++ P R    +PHA
Sbjct: 273 TTSTFESTAKEMGLDCQLQMTTET--DYRSQSLLEKTLLFRPLQAPVRIYRISPHA 326

>TBLA0B06150 Chr2 (1451595..1452545) [951 bp, 316 aa] {ON} Anc_4.352
           YJR129C
          Length = 316

 Score = 36.2 bits (82), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 55/131 (41%), Gaps = 21/131 (16%)

Query: 42  GGESGCGGKVWIAGNLLCEFILEKSKDGRVLSQFPGYERQFKNIIELGSGTGLVGLCVGL 101
            G    G + W A   +  ++LE    G              N++E+G+GTG+V + +  
Sbjct: 120 SGNGTTGLRTWEAALYMILYLLEHPVRG--------------NVVEIGAGTGMVSIGI-- 163

Query: 102 HGKYNGATDTNVYITDIEGLCPLMQ--KNVELNGL--DGMVHPRPLFWGEPLSDEFTRQP 157
             K  G   ++V +TD +      Q  KN +LNG+  D  V  + + W E          
Sbjct: 164 -MKMQGQNISSVLVTDGDEYVANKQLPKNFQLNGIVDDTRVKFQKIRWNEDHLVNGDGPN 222

Query: 158 IDLVLAADCVY 168
           +D ++ AD  Y
Sbjct: 223 VDYLVGADVTY 233

>KNAG0F03080 Chr6 (584425..585201) [777 bp, 258 aa] {ON} Anc_6.79
           YLR285W
          Length = 258

 Score = 35.4 bits (80), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 51/118 (43%), Gaps = 12/118 (10%)

Query: 83  KNIIELGSGTGLVGLCVGLHGKYNGATDTNVYITDIEGLCPLMQKNVELNGLDGMVHPRP 142
           KN++ELG+   L  +  GL G       T+    D+  +     K++E   ++G +    
Sbjct: 83  KNVLELGAAGALPSVVAGLIGA-KRVVSTDYPDADLMSVIRENAKSLENVSVEGYI---- 137

Query: 143 LFWGEPLSDEFTR-----QPIDLVLAADCVYLEKAFPLLEKTLLDLTAGESQPLVLMS 195
             WG   SD  +      +   LV+ +D V+       L KT  DL + + + LV+ S
Sbjct: 138 --WGNDYSDVLSHLENPAEKFQLVILSDLVFNHTEHHKLLKTTRDLLSADGKALVVFS 193

>SAKL0G18106g Chr7 complement(1569137..1570144) [1008 bp, 335 aa]
           {ON} similar to uniprot|P47163 Saccharomyces cerevisiae
           YJR129C Putative S-adenosylmethionine-dependent
           methyltransferase of the seven beta-strand family
          Length = 335

 Score = 35.0 bits (79), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 46/95 (48%), Gaps = 11/95 (11%)

Query: 85  IIELGSGTGLVGLCVGLHGKYNGATDTNVYITDIEG--LCPLMQKNVELNGLDGMVHP-R 141
           ++ELG+GTG+V +      K        +Y+TD +   +   M +N +LN + G  +  +
Sbjct: 174 VVELGAGTGIVSMT---WAKLQHNRLEKLYVTDGDSSLVENQMHRNAQLNNVGGPKYCFQ 230

Query: 142 PLFWGEPLSDEFTRQPIDLVLAADCVYLEKAFPLL 176
            L+W    SD+      DL+LAAD  Y     P L
Sbjct: 231 KLWWN---SDDVPDN--DLILAADVTYDSSVIPDL 260

>ZYRO0D14542g Chr4 (1231299..1232090) [792 bp, 263 aa] {ON} similar
           to uniprot|Q05874 Saccharomyces cerevisiae YLR285W NNT1
           Putative nicotinamide N-methyltransferase has a role in
           rDNA silencing and in lifespan determination
          Length = 263

 Score = 34.3 bits (77), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 35/144 (24%), Positives = 58/144 (40%), Gaps = 26/144 (18%)

Query: 69  GRVLSQFPGYERQFKNIIELGSGTGLVGLCVGLHGKYNGATDTNVYITDIEGLCPLMQKN 128
            + L + PG  +  KN++ELG+   L  +  GL G         V  TD     P + +N
Sbjct: 70  AKHLDKHPGLVKG-KNVLELGAAAALPTVVCGLIGA------NKVVSTDYPE--PELIQN 120

Query: 129 VELNGLDGMVHPRPL--------------FWG---EPLSDEFTRQPIDLVLAADCVYLEK 171
           ++ N    +   +P                WG   EP+         DL++ +DCV+   
Sbjct: 121 IQYNVDHELYGGKPFSQDSNDRKVVVEGYIWGNEYEPILSHTGGSKFDLIILSDCVFNHT 180

Query: 172 AFPLLEKTLLDLTAGESQPLVLMS 195
               L + + DL A + + LV+ S
Sbjct: 181 EHRKLLRCIKDLLANDGKALVVFS 204

>CAGL0M09801g Chr13 complement(970260..971030) [771 bp, 256 aa] {ON}
           similar to uniprot|Q05874 Saccharomyces cerevisiae
           YLR285w
          Length = 256

 Score = 33.9 bits (76), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 51/204 (25%), Positives = 76/204 (37%), Gaps = 40/204 (19%)

Query: 10  EDLVEPRPIEHLGQSDLSYQGQLDPP---------LKIHEDGGESGCGGKVWIAGNLLCE 60
           ED    +P EH    +     ++D P         LK+   G     G  +W AG     
Sbjct: 18  EDFRPEKPKEHYANYE-----RIDVPDISKSKITNLKLQLVGSSPLWGHLLWNAGIYTA- 71

Query: 61  FILEKSKDGRVLSQFPGYERQFKNIIELGSGTGLVGLCVGLHGKYNGATDTNVYITDI-- 118
                    R L ++P      KN++ELG+ + L  L  GL G           +TD   
Sbjct: 72  ---------RHLDKYPELVSN-KNVLELGAASALPSLVAGLIGAKRAV------VTDYPD 115

Query: 119 EGLCPLMQKNVEL---NGLDGMVHPRPLFWG---EPLSDEFT-RQPIDLVLAADCVYLEK 171
             L   +Q NV     + L   V      WG   +PL+      +  DL++ +D V+   
Sbjct: 116 ADLMANIQYNVNTIIPDELKENVRVEGYIWGNEYDPLTIHLDGDKKFDLIILSDLVFNHN 175

Query: 172 AFPLLEKTLLDLTAGESQPLVLMS 195
               L +T  DL A   + LV+ S
Sbjct: 176 QHDKLLQTTKDLLATNGKALVVFS 199

>CAGL0M00572g Chr13 (68018..69001) [984 bp, 327 aa] {ON} similar to
           uniprot|P47163 Saccharomyces cerevisiae YJR129c
          Length = 327

 Score = 33.1 bits (74), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 53/124 (42%), Gaps = 12/124 (9%)

Query: 46  GCGGKVWIAGNLLCEFILEKSKDGRVLSQFPGYERQFKNIIELGSGTGLVGLCVGLHGKY 105
             G + W A   L  +++++     V +           I+ELGSGTGLV L       +
Sbjct: 129 STGNRTWEAAVYLGLYLIDQCASNVVAAP--------SRILELGSGTGLVSLLYQQLYPF 180

Query: 106 NGATDTNVYITDIEGLCPLMQKNVELNGLDGMVHPRPLFWGEPLSDEFTRQ-PIDLVLAA 164
           +  T T+    D + +   +  N+ LN L   +  + L WG   ++    Q   DL+L +
Sbjct: 181 DKLTMTD---GDWDVVRKRIPGNLSLNDLKPGLEVKQLVWGPRDANSGDNQWDYDLILGS 237

Query: 165 DCVY 168
           D  Y
Sbjct: 238 DLTY 241

>Skud_2.380 Chr2 complement(683463..685121) [1659 bp, 552 aa] {ON}
           YBR248C (REAL)
          Length = 552

 Score = 32.7 bits (73), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 23/35 (65%), Gaps = 2/35 (5%)

Query: 77  GYERQFKNIIELGSGTGLVGLCVGLHGKYNGATDT 111
           G+ER  KN IE  SG  ++G+CVGL   + G+ ++
Sbjct: 64  GFERPIKNYIE--SGKPIMGICVGLQAMFAGSVES 96

>TBLA0C01350 Chr3 (308857..309726) [870 bp, 289 aa] {ON} 
          Length = 289

 Score = 31.6 bits (70), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 20/84 (23%), Positives = 40/84 (47%), Gaps = 2/84 (2%)

Query: 85  IIELGSGTGLVGLCVGLHGKYNGATDTNVYITDIEGLCPLMQKNVELNGLDGMVHPRPLF 144
           +I+ G G G   L +     +     T++ +  IE     +Q++   N ++ +V     F
Sbjct: 40  VIDCGCGPGTATLQLSKELAFKKTIGTDLSMIMIEKANQKLQESKLANDIEFVVSEGDDF 99

Query: 145 WGEPLSDEFTRQPIDLVLAADCVY 168
             + L D F +  +D++ AA+CV+
Sbjct: 100 --KFLKDNFNKHNVDMITAAECVH 121

>Suva_4.509 Chr4 complement(885931..887589) [1659 bp, 552 aa] {ON}
           YBR248C (REAL)
          Length = 552

 Score = 29.6 bits (65), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 23/35 (65%), Gaps = 2/35 (5%)

Query: 77  GYERQFKNIIELGSGTGLVGLCVGLHGKYNGATDT 111
           G+E+  K+ IE  SG  ++G+CVGL   + G+ ++
Sbjct: 64  GFEKPIKDYIE--SGKPIMGICVGLQAMFAGSVES 96

>Smik_2.391 Chr2 complement(701009..702667) [1659 bp, 552 aa] {ON}
           YBR248C (REAL)
          Length = 552

 Score = 29.6 bits (65), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 23/35 (65%), Gaps = 2/35 (5%)

Query: 77  GYERQFKNIIELGSGTGLVGLCVGLHGKYNGATDT 111
           G+E+  K+ IE  SG  ++G+CVGL   + G+ ++
Sbjct: 64  GFEKPIKDYIE--SGKPIMGICVGLQALFTGSVES 96

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.141    0.431 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 24,641,728
Number of extensions: 1033055
Number of successful extensions: 1851
Number of sequences better than 10.0: 66
Number of HSP's gapped: 1805
Number of HSP's successfully gapped: 66
Length of query: 251
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 144
Effective length of database: 41,212,137
Effective search space: 5934547728
Effective search space used: 5934547728
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 64 (29.3 bits)