Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ADL211C2.290ON22522512091e-171
Ecym_33292.290ON2581966608e-87
Skud_9.802.290ON2641926401e-83
TBLA0B059602.290ON2661906357e-83
Kwal_27.115092.290ON2611966322e-82
YIL093C (RSM25)2.290ON2641926252e-81
KLTH0G10450g2.290ON2611906243e-81
SAKL0E07590g2.290ON2601906182e-80
Smik_9.862.290ON2641926166e-80
Suva_9.1062.290ON2641926105e-79
KLLA0E08273g2.290ON2611916061e-78
ZYRO0A01958g2.290ON2631905722e-73
NDAI0B035402.290ON2612015722e-73
Kpol_1003.402.290ON2611835713e-73
KAFR0J013502.290ON2641915696e-73
CAGL0D04158g2.290ON2721825621e-71
KNAG0A054102.290ON2661905513e-70
TDEL0G022002.290ON2611795496e-70
NCAS0B062402.290ON2601835374e-68
TPHA0C034202.290ON2681865176e-65
KLLA0C04081g3.172ON28691682.2
KNAG0J017008.676ON82074682.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADL211C
         (225 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADL211C Chr4 complement(333418..334095) [678 bp, 225 aa] {ON} Sy...   470   e-171
Ecym_3329 Chr3 complement(630346..631122) [777 bp, 258 aa] {ON} ...   258   8e-87
Skud_9.80 Chr9 complement(164635..165429) [795 bp, 264 aa] {ON} ...   251   1e-83
TBLA0B05960 Chr2 complement(1408779..1409579) [801 bp, 266 aa] {...   249   7e-83
Kwal_27.11509 s27 (831150..831935) [786 bp, 261 aa] {ON} YIL093C...   248   2e-82
YIL093C Chr9 complement(187990..188784) [795 bp, 264 aa] {ON}  R...   245   2e-81
KLTH0G10450g Chr7 complement(884037..884822) [786 bp, 261 aa] {O...   244   3e-81
SAKL0E07590g Chr5 (613875..614657) [783 bp, 260 aa] {ON} similar...   242   2e-80
Smik_9.86 Chr9 complement(167101..167895) [795 bp, 264 aa] {ON} ...   241   6e-80
Suva_9.106 Chr9 complement(182086..182880) [795 bp, 264 aa] {ON}...   239   5e-79
KLLA0E08273g Chr5 (745145..745930) [786 bp, 261 aa] {ON} similar...   238   1e-78
ZYRO0A01958g Chr1 complement(162742..163533) [792 bp, 263 aa] {O...   224   2e-73
NDAI0B03540 Chr2 (890148..890933) [786 bp, 261 aa] {ON} Anc_2.29...   224   2e-73
Kpol_1003.40 s1003 complement(97903..98688) [786 bp, 261 aa] {ON...   224   3e-73
KAFR0J01350 Chr10 (247931..248725) [795 bp, 264 aa] {ON} Anc_2.2...   223   6e-73
CAGL0D04158g Chr4 complement(410309..411127) [819 bp, 272 aa] {O...   221   1e-71
KNAG0A05410 Chr1 (798238..799038) [801 bp, 266 aa] {ON} Anc_2.29...   216   3e-70
TDEL0G02200 Chr7 complement(433032..433817) [786 bp, 261 aa] {ON...   216   6e-70
NCAS0B06240 Chr2 (1178232..1179014) [783 bp, 260 aa] {ON} Anc_2....   211   4e-68
TPHA0C03420 Chr3 complement(750353..751159) [807 bp, 268 aa] {ON...   203   6e-65
KLLA0C04081g Chr3 (371620..372480) [861 bp, 286 aa] {ON} similar...    31   2.2  
KNAG0J01700 Chr10 (309962..312424) [2463 bp, 820 aa] {ON}              31   2.9  

>ADL211C Chr4 complement(333418..334095) [678 bp, 225 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL093C
           (RSM25)
          Length = 225

 Score =  470 bits (1209), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 225/225 (100%), Positives = 225/225 (100%)

Query: 1   MKIQTNAVNVLDRTSFYLQAGLLKKTPAWYNVVARIPPVTKFAREPKLHDPVSGKYKGEL 60
           MKIQTNAVNVLDRTSFYLQAGLLKKTPAWYNVVARIPPVTKFAREPKLHDPVSGKYKGEL
Sbjct: 1   MKIQTNAVNVLDRTSFYLQAGLLKKTPAWYNVVARIPPVTKFAREPKLHDPVSGKYKGEL 60

Query: 61  DIMTDRLNRNTETYKTRAGSSDRQTAAVHKPSKLRFIEDKLRSLFFQQHPWELSRPKVLV 120
           DIMTDRLNRNTETYKTRAGSSDRQTAAVHKPSKLRFIEDKLRSLFFQQHPWELSRPKVLV
Sbjct: 61  DIMTDRLNRNTETYKTRAGSSDRQTAAVHKPSKLRFIEDKLRSLFFQQHPWELSRPKVLV 120

Query: 121 ENMGNEQYDWSRMLQLGKPLDGESVVQRTLYLLKSGAHREMLAAYDQARFEFYRLRMQQE 180
           ENMGNEQYDWSRMLQLGKPLDGESVVQRTLYLLKSGAHREMLAAYDQARFEFYRLRMQQE
Sbjct: 121 ENMGNEQYDWSRMLQLGKPLDGESVVQRTLYLLKSGAHREMLAAYDQARFEFYRLRMQQE 180

Query: 181 LEEQIAYERPRWLALCSRQPLWSTVCSKSRRSSTSGMRTWLRGCS 225
           LEEQIAYERPRWLALCSRQPLWSTVCSKSRRSSTSGMRTWLRGCS
Sbjct: 181 LEEQIAYERPRWLALCSRQPLWSTVCSKSRRSSTSGMRTWLRGCS 225

>Ecym_3329 Chr3 complement(630346..631122) [777 bp, 258 aa] {ON}
           similar to Ashbya gossypii ADL211C
          Length = 258

 Score =  258 bits (660), Expect = 8e-87,   Method: Compositional matrix adjust.
 Identities = 122/196 (62%), Positives = 154/196 (78%), Gaps = 2/196 (1%)

Query: 1   MKIQTNAVNVLDRTSFYLQAGLLKKTPAWYNVVARIPPVTKFAREPKLHDPVSGKYKGEL 60
           MKIQTNA N+L+RTS +L+ GLL +TP WY+V+ + PP TKFAR+PKL +P +G Y  +L
Sbjct: 1   MKIQTNATNILERTSSFLRVGLLARTPVWYDVIVKSPPSTKFARQPKLVNPSTGAYTAKL 60

Query: 61  DIMTDRLNRNTETYKTRAGSSDRQ--TAAVHKPSKLRFIEDKLRSLFFQQHPWELSRPKV 118
              +D  N ++ TYKTRA   +++  T+AV++  KL + EDKLRSLF++QHPWELSRPK+
Sbjct: 61  REFSDNRNSSSGTYKTRANKHEKRVSTSAVYRAPKLYYFEDKLRSLFYKQHPWELSRPKI 120

Query: 119 LVENMGNEQYDWSRMLQLGKPLDGESVVQRTLYLLKSGAHREMLAAYDQARFEFYRLRMQ 178
           LVEN G+E++DWSR+ QLGKPLDGESVVQRTLYLL SG H  ++ AYDQARFEFYRLRMQ
Sbjct: 121 LVENQGDEKHDWSRIQQLGKPLDGESVVQRTLYLLGSGEHTNLIDAYDQARFEFYRLRMQ 180

Query: 179 QELEEQIAYERPRWLA 194
           QELEEQ+A E    L 
Sbjct: 181 QELEEQVAQEEAGMLG 196

>Skud_9.80 Chr9 complement(164635..165429) [795 bp, 264 aa] {ON}
           YIL093C (REAL)
          Length = 264

 Score =  251 bits (640), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 119/192 (61%), Positives = 155/192 (80%), Gaps = 4/192 (2%)

Query: 1   MKIQTNAVNVLDRTSFYLQAGLLKKTPAWYNVVARIPPVTKFAREPKLHDPVSGKYKGEL 60
           MKIQTNAVNVL RTS YL++GLLK+TPAWYNVVA IPP TKF REP+ ++P +G   GEL
Sbjct: 1   MKIQTNAVNVLQRTSAYLKSGLLKETPAWYNVVASIPPSTKFTREPRFNNPSNGDTIGEL 60

Query: 61  DIMTDRLNRNTET-YKTRAGSSDRQTAA--VHKPSKLRFIEDKLRSLFFQQHPWELSRPK 117
           D +T R + N    YKTR  ++D++ +   ++KP KL ++ED+LR+LF++QHPWELSRPK
Sbjct: 61  DDVTQRQHANKNGLYKTRPNTNDKRVSVKKLYKPPKLTYVEDRLRALFYKQHPWELSRPK 120

Query: 118 VLVEN-MGNEQYDWSRMLQLGKPLDGESVVQRTLYLLKSGAHREMLAAYDQARFEFYRLR 176
           +LVEN +G+E YDW RMLQLGKPLDGESVVQRT++LLK+  + +M+ AYD AR+EFY LR
Sbjct: 121 ILVENEIGDEDYDWGRMLQLGKPLDGESVVQRTMHLLKTKQYEDMVEAYDSARYEFYALR 180

Query: 177 MQQELEEQIAYE 188
           MQ+E ++Q+A E
Sbjct: 181 MQEETQQQVALE 192

>TBLA0B05960 Chr2 complement(1408779..1409579) [801 bp, 266 aa] {ON}
           Anc_2.290 YIL093C
          Length = 266

 Score =  249 bits (635), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 118/190 (62%), Positives = 148/190 (77%), Gaps = 2/190 (1%)

Query: 1   MKIQTNAVNVLDRTSFYLQAGLLKKTPAWYNVVARIPPVTKFAREPKLHDPVSGKYKGEL 60
           MKIQ NAVNVL+RTS YLQAG++KK P WY+VVA  PP  KF REPK  +P + K   E 
Sbjct: 1   MKIQQNAVNVLERTSAYLQAGMIKKPPVWYDVVAATPPSKKFTREPKFINPSTNKRTVEF 60

Query: 61  DIMTDRLNRNTETYKTRAGSSDRQTA--AVHKPSKLRFIEDKLRSLFFQQHPWELSRPKV 118
             + D LNR T  YKTRA S D++ A  +++K  KL +IEDKLR LF++QHPWEL+RPK+
Sbjct: 61  KPLKDYLNRTTGLYKTRANSIDKKNAVSSLYKIPKLTYIEDKLRKLFYEQHPWELTRPKI 120

Query: 119 LVENMGNEQYDWSRMLQLGKPLDGESVVQRTLYLLKSGAHREMLAAYDQARFEFYRLRMQ 178
           ++EN G   YDWSR+LQLGKPLDGESVVQRTL+LLK+  HR+++ AY+QARFEFYRLRM 
Sbjct: 121 VMENHGEVTYDWSRLLQLGKPLDGESVVQRTLFLLKTKEHRKLIDAYNQARFEFYRLRMA 180

Query: 179 QELEEQIAYE 188
           +E++EQ+A E
Sbjct: 181 EEIQEQVAQE 190

>Kwal_27.11509 s27 (831150..831935) [786 bp, 261 aa] {ON} YIL093C
           (RSM25) - mitochondrial ribosome small subunit component
           [contig 27] FULL
          Length = 261

 Score =  248 bits (632), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 119/196 (60%), Positives = 148/196 (75%), Gaps = 2/196 (1%)

Query: 1   MKIQTNAVNVLDRTSFYLQAGLLKKTPAWYNVVARIPPVTKFAREPKLHDPVSGKYKGEL 60
           MK+Q NAVNVL+RTS YL+AG+LKKTPAWY VVA+IPP  +F REP+L +P +     +L
Sbjct: 1   MKVQQNAVNVLERTSSYLRAGILKKTPAWYEVVAQIPPSKRFVREPRLVNPSTNDEIAKL 60

Query: 61  DIMTDRLNRNTETYKTRAGSSDRQTAA--VHKPSKLRFIEDKLRSLFFQQHPWELSRPKV 118
               +  N    +YKTRA   D+Q +   ++K  KL++ EDKLR LFF+QHPWELSRPK+
Sbjct: 61  SEFRESYNFENRSYKTRASRGDKQVSGNKLYKAPKLKYAEDKLRELFFEQHPWELSRPKM 120

Query: 119 LVENMGNEQYDWSRMLQLGKPLDGESVVQRTLYLLKSGAHREMLAAYDQARFEFYRLRMQ 178
           LVEN G + YDWS + QLGKPLDGESVVQRTLYLLKS  H+E+LAAYDQARFEFYRLR+Q
Sbjct: 121 LVENSGIQDYDWSTLQQLGKPLDGESVVQRTLYLLKSKKHQELLAAYDQARFEFYRLRIQ 180

Query: 179 QELEEQIAYERPRWLA 194
           +E++ Q+A E    L 
Sbjct: 181 EEVQNQVAQEEAEMLG 196

>YIL093C Chr9 complement(187990..188784) [795 bp, 264 aa] {ON}
           RSM25Mitochondrial ribosomal protein of the small
           subunit
          Length = 264

 Score =  245 bits (625), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 116/192 (60%), Positives = 154/192 (80%), Gaps = 4/192 (2%)

Query: 1   MKIQTNAVNVLDRTSFYLQAGLLKKTPAWYNVVARIPPVTKFAREPKLHDPVSGKYKGEL 60
           MKIQTNAVNVL RTS YL++GLLK+TPAWYNVVA IPP TKF REP+  +P +G   G+L
Sbjct: 1   MKIQTNAVNVLQRTSAYLKSGLLKETPAWYNVVASIPPSTKFTREPRFKNPSNGHIIGKL 60

Query: 61  DIMTDRLNRNTET-YKTRAGSSDRQTAA--VHKPSKLRFIEDKLRSLFFQQHPWELSRPK 117
             +T++ + N +  YKTR  SSD++     +++P KL ++ED+LRSLF++QHPWELSRPK
Sbjct: 61  VDVTEQPHANNKGLYKTRPNSSDKRVGVKRLYRPPKLTYVEDRLRSLFYKQHPWELSRPK 120

Query: 118 VLVEN-MGNEQYDWSRMLQLGKPLDGESVVQRTLYLLKSGAHREMLAAYDQARFEFYRLR 176
           +LVEN +G+E YDWS MLQ+G+PLDGESV+QRT+YL+K+  + +M+ AYD AR+EFY LR
Sbjct: 121 ILVENEIGDENYDWSHMLQIGRPLDGESVIQRTMYLIKTKQYGDMVEAYDHARYEFYALR 180

Query: 177 MQQELEEQIAYE 188
           MQ+E E+Q+A E
Sbjct: 181 MQEETEQQVALE 192

>KLTH0G10450g Chr7 complement(884037..884822) [786 bp, 261 aa] {ON}
           similar to uniprot|P40496 Saccharomyces cerevisiae
           YIL093C RSM25 Mitochondrial ribosomal protein of the
           small subunit
          Length = 261

 Score =  244 bits (624), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 115/190 (60%), Positives = 148/190 (77%), Gaps = 2/190 (1%)

Query: 1   MKIQTNAVNVLDRTSFYLQAGLLKKTPAWYNVVARIPPVTKFAREPKLHDPVSGKYKGEL 60
           MK+Q NAVNVL+RTS YL+AGLLKKTPAWY+VVA +PP  +F REP+L +P + K   +L
Sbjct: 1   MKVQQNAVNVLERTSSYLKAGLLKKTPAWYDVVAFVPPSKRFVREPRLVNPSTNKETAKL 60

Query: 61  DIMTDRLNRNTETYKTRAGSSDRQTAA--VHKPSKLRFIEDKLRSLFFQQHPWELSRPKV 118
               ++ +    +YKTRA  S+RQ +   +    KL++ EDKLR +F++QHPWELSRPK+
Sbjct: 61  SEFAEQYSVENRSYKTRASRSERQVSGSKLFAAPKLKYAEDKLREVFYEQHPWELSRPKM 120

Query: 119 LVENMGNEQYDWSRMLQLGKPLDGESVVQRTLYLLKSGAHREMLAAYDQARFEFYRLRMQ 178
           LVEN G   YDWS + QLGKPLDGESVVQRTLYLL++ AH+E+LAAYDQARFEFYRLR+Q
Sbjct: 121 LVENSGTHDYDWSTIQQLGKPLDGESVVQRTLYLLRTKAHQELLAAYDQARFEFYRLRIQ 180

Query: 179 QELEEQIAYE 188
           +E++ Q+A E
Sbjct: 181 EEVQNQVAQE 190

>SAKL0E07590g Chr5 (613875..614657) [783 bp, 260 aa] {ON} similar to
           uniprot|P40496 Saccharomyces cerevisiae YIL093C RSM25
           Mitochondrial ribosomal protein of the small subunit
          Length = 260

 Score =  242 bits (618), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 116/190 (61%), Positives = 141/190 (74%), Gaps = 2/190 (1%)

Query: 1   MKIQTNAVNVLDRTSFYLQAGLLKKTPAWYNVVARIPPVTKFAREPKLHDPVSGKYKGEL 60
           MK+QTNAVN+L+RTS YL+AGLL K PAWYNVVA +PP   FAREPK+ +P + K    L
Sbjct: 1   MKVQTNAVNLLERTSAYLRAGLLTKAPAWYNVVASVPPSKSFAREPKITNPSNNKNIASL 60

Query: 61  DIMTDRLNRNTETYKTRAGSSDRQTA--AVHKPSKLRFIEDKLRSLFFQQHPWELSRPKV 118
              ++ +     TYKTR   SDR+ +   ++K  KL + EDKLR LF+QQHPWELSRPKV
Sbjct: 61  SEYSETVGIKNGTYKTRQSGSDRKVSFNKLYKAPKLNYAEDKLRELFYQQHPWELSRPKV 120

Query: 119 LVENMGNEQYDWSRMLQLGKPLDGESVVQRTLYLLKSGAHREMLAAYDQARFEFYRLRMQ 178
           L+EN G E YDWS + QLGKPLDGESVVQRTLYLLK      ++ AYDQARFEFYR+R+Q
Sbjct: 121 LIENTGEESYDWSTIQQLGKPLDGESVVQRTLYLLKEKKQLTLVNAYDQARFEFYRVRVQ 180

Query: 179 QELEEQIAYE 188
           QE+ EQ+A E
Sbjct: 181 QEIHEQVAQE 190

>Smik_9.86 Chr9 complement(167101..167895) [795 bp, 264 aa] {ON}
           YIL093C (REAL)
          Length = 264

 Score =  241 bits (616), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 114/192 (59%), Positives = 148/192 (77%), Gaps = 4/192 (2%)

Query: 1   MKIQTNAVNVLDRTSFYLQAGLLKKTPAWYNVVARIPPVTKFAREPKLHDPVSGKYKGEL 60
           MKIQTNAVNVL RTS YL++GLLK TPAWYNVVA IPP TKF REP   +P +G   G L
Sbjct: 1   MKIQTNAVNVLQRTSAYLKSGLLKDTPAWYNVVASIPPSTKFTREPHFENPSNGHTIGRL 60

Query: 61  -DIMTDRLNRNTETYKTRAGSSDRQTAA--VHKPSKLRFIEDKLRSLFFQQHPWELSRPK 117
            D++ ++   +   YKTR  ++D++     ++KP KL ++ED+LR+LF++QHPWELSRPK
Sbjct: 61  VDVIENQHTNSNGLYKTRPNTNDKRIGVKKLYKPPKLTYVEDRLRTLFYKQHPWELSRPK 120

Query: 118 VLVEN-MGNEQYDWSRMLQLGKPLDGESVVQRTLYLLKSGAHREMLAAYDQARFEFYRLR 176
           +LVEN +G+E YDWS MLQLGKPLDGESV+QRT+YLLK+  +   + AYD AR+EFY LR
Sbjct: 121 ILVENEIGDEDYDWSHMLQLGKPLDGESVIQRTMYLLKTKQYENTVEAYDHARYEFYALR 180

Query: 177 MQQELEEQIAYE 188
           MQ+E ++Q+A E
Sbjct: 181 MQEETQQQVALE 192

>Suva_9.106 Chr9 complement(182086..182880) [795 bp, 264 aa] {ON}
           YIL093C (REAL)
          Length = 264

 Score =  239 bits (610), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 115/192 (59%), Positives = 150/192 (78%), Gaps = 4/192 (2%)

Query: 1   MKIQTNAVNVLDRTSFYLQAGLLKKTPAWYNVVARIPPVTKFAREPKLHDPVSGKYKGEL 60
           MKIQTNAVNVL RTS YL++GLLK TPAWYNVVA IPP TKF REP+  +P +G+  G+L
Sbjct: 1   MKIQTNAVNVLQRTSAYLKSGLLKDTPAWYNVVASIPPSTKFTREPRFKNPSNGRIIGKL 60

Query: 61  DIMTDRLNRNTET-YKTRAGSSDRQTAA--VHKPSKLRFIEDKLRSLFFQQHPWELSRPK 117
             +T+R   N    YKTR   +DR+     ++KP KL ++ED+LR LF++QHPWELSRPK
Sbjct: 61  VDVTERQQANANGLYKTRPNPNDRRVGVKKLYKPPKLTYVEDRLRVLFYKQHPWELSRPK 120

Query: 118 VLVEN-MGNEQYDWSRMLQLGKPLDGESVVQRTLYLLKSGAHREMLAAYDQARFEFYRLR 176
           +LVEN +G+E YDWS MLQLGK LDGESV+QRT++LLK+  +++M+ AYD AR+EFY LR
Sbjct: 121 ILVENEVGDENYDWSHMLQLGKVLDGESVIQRTMHLLKTQQYKDMVEAYDHARYEFYALR 180

Query: 177 MQQELEEQIAYE 188
           M++E ++Q+A E
Sbjct: 181 MEEETQQQVALE 192

>KLLA0E08273g Chr5 (745145..745930) [786 bp, 261 aa] {ON} similar to
           uniprot|P40496 Saccharomyces cerevisiae YIL093C RSM25
           Mitochondrial ribosomal protein of the small subunit
          Length = 261

 Score =  238 bits (606), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 114/191 (59%), Positives = 151/191 (79%), Gaps = 3/191 (1%)

Query: 1   MKIQTNAVNVLDRTSFYLQAGLLKKTPAWYNVVARIPPVTKFAREPKLHDPVSGKYKGEL 60
           MK+Q  AVNVL+RTS YL++G+LKKTPAWYNV+A++PP  KFAR P+L  P++GK +  L
Sbjct: 1   MKVQQEAVNVLERTSAYLKSGILKKTPAWYNVIAKVPPTKKFARTPQLTHPMNGKSRTAL 60

Query: 61  DIMTDRLNRNTETYKTRAGSSDRQTAA--VHKPSKLRFIEDKLRSLFFQQHPWELSRPKV 118
              ++    ++  YKTR  S +++  A  +++  KL +IEDKLR LFFQQHPWELSRPK+
Sbjct: 61  PDYSNWKANSSGLYKTRPNSLEKKDGASKLYQSPKLVYIEDKLRKLFFQQHPWELSRPKI 120

Query: 119 LVEN-MGNEQYDWSRMLQLGKPLDGESVVQRTLYLLKSGAHREMLAAYDQARFEFYRLRM 177
           LVEN +  ++YDWS + QLGKPLDGESVVQRTL+LLKSG  +E++ AYDQARFEFYRLR+
Sbjct: 121 LVENTLETQEYDWSHIQQLGKPLDGESVVQRTLFLLKSGEKKELIDAYDQARFEFYRLRI 180

Query: 178 QQELEEQIAYE 188
           QQE+++Q+A E
Sbjct: 181 QQEIQDQVAQE 191

>ZYRO0A01958g Chr1 complement(162742..163533) [792 bp, 263 aa] {ON}
           similar to uniprot|P40496 Saccharomyces cerevisiae
           YIL093C RSM25 Mitochondrial ribosomal protein of the
           small subunit
          Length = 263

 Score =  224 bits (572), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 110/190 (57%), Positives = 143/190 (75%), Gaps = 3/190 (1%)

Query: 1   MKIQTNAVNVLDRTSFYLQAGLLKKTPAWYNVVARIPPVTKFAREPKLHDPVSGKYKGEL 60
           MK+QTNAVNVL+RTS YL++GLL++TPAWY VVA +PP TKF RE +  +P +GK   + 
Sbjct: 1   MKLQTNAVNVLERTSAYLRSGLLRETPAWYQVVASVPPTTKFTREARFINPSTGKKTVQW 60

Query: 61  DIMTDRLNRNTETYKTRAGSSDRQ--TAAVHKPSKLRFIEDKLRSLFFQQHPWELSRPKV 118
               + +NR    YKTR  S DR+   + ++K  KL+F+ED+LR +F+QQHPWE SRPK+
Sbjct: 61  KEFDEGINRKG-FYKTRNSSFDRKPMDSRLYKAPKLQFLEDQLREVFYQQHPWEFSRPKM 119

Query: 119 LVENMGNEQYDWSRMLQLGKPLDGESVVQRTLYLLKSGAHREMLAAYDQARFEFYRLRMQ 178
           LVEN  NE +DWS M QLGKPLDGESVVQRT+YLL+      ++ AYD+ RFEFYRLRMQ
Sbjct: 120 LVENEINENFDWSYMSQLGKPLDGESVVQRTIYLLQKDPELGIIDAYDRTRFEFYRLRMQ 179

Query: 179 QELEEQIAYE 188
           +E+E+Q+A E
Sbjct: 180 EEIEQQVAQE 189

>NDAI0B03540 Chr2 (890148..890933) [786 bp, 261 aa] {ON} Anc_2.290
           YIL093C
          Length = 261

 Score =  224 bits (572), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 113/201 (56%), Positives = 144/201 (71%), Gaps = 3/201 (1%)

Query: 1   MKIQTNAVNVLDRTSFYLQAGLLKKTPAWYNVVARIPPVTKFAREPKLHDPVSGKYKGEL 60
           MKIQTNAVN+++RTS YL +GLL+ TPAWY+VVA IPP  KF REPK+ +P +G+ K   
Sbjct: 1   MKIQTNAVNLVERTSAYLSSGLLQNTPAWYDVVASIPPTKKFTREPKITNPTTGRNKTFF 60

Query: 61  DIMTDRLNRNTETYKTRAGSSDRQTAA--VHKPSKLRFIEDKLRSLFFQQHPWELSRPKV 118
                R+N N   YKTR    DR+ +A  ++KP KL ++ED+LRSLFF+QHPWELSRPK+
Sbjct: 61  KDDRIRVN-NKGLYKTRMNQMDRKDSANNLYKPPKLIYLEDRLRSLFFEQHPWELSRPKI 119

Query: 119 LVENMGNEQYDWSRMLQLGKPLDGESVVQRTLYLLKSGAHREMLAAYDQARFEFYRLRMQ 178
           L+EN   E +DWS + Q  K LDGESVVQRTLYLLK+     ML AY++ARFEFYRLR+Q
Sbjct: 120 LIENSLEENFDWSHIQQWEKQLDGESVVQRTLYLLKNEPGINMLQAYNKARFEFYRLRIQ 179

Query: 179 QELEEQIAYERPRWLALCSRQ 199
           Q++ +Q+A E         RQ
Sbjct: 180 QDISQQVAQEEAEMFGSIFRQ 200

>Kpol_1003.40 s1003 complement(97903..98688) [786 bp, 261 aa] {ON}
           complement(97903..98688) [786 nt, 262 aa]
          Length = 261

 Score =  224 bits (571), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 108/183 (59%), Positives = 138/183 (75%), Gaps = 3/183 (1%)

Query: 1   MKIQTNAVNVLDRTSFYLQAGLLKKTPAWYNVVARIPPVTKFAREPKLHDPVSGKYKGEL 60
           MKIQ NAVNVL+RTS YL+AGLL K PAWYNVVA +PP+ KF R PKL +P + +  G+L
Sbjct: 1   MKIQKNAVNVLERTSAYLRAGLLTKQPAWYNVVASVPPLKKFERVPKLTNPSNDRINGQL 60

Query: 61  DIMTDRLNRNTETYKTRAGSSDRQTAA--VHKPSKLRFIEDKLRSLFFQQHPWELSRPKV 118
             + D    N   +KTR  + DR  A+  ++  SKL +IED+LR +F++QHPWELSRPK+
Sbjct: 61  HSL-DSSAGNNGMFKTRYTAKDRSNASKQLYSASKLTYIEDQLREIFYKQHPWELSRPKI 119

Query: 119 LVENMGNEQYDWSRMLQLGKPLDGESVVQRTLYLLKSGAHREMLAAYDQARFEFYRLRMQ 178
           L+EN G+E+YDWS M Q+GKPLDGESVVQRTLYL+K+     ++ AYD AR+EFYRLRMQ
Sbjct: 120 LIENNGDEKYDWSHMQQIGKPLDGESVVQRTLYLMKNKEAPSLVLAYDMARYEFYRLRMQ 179

Query: 179 QEL 181
           Q +
Sbjct: 180 QHI 182

>KAFR0J01350 Chr10 (247931..248725) [795 bp, 264 aa] {ON} Anc_2.290
           YIL093C
          Length = 264

 Score =  223 bits (569), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 107/191 (56%), Positives = 145/191 (75%), Gaps = 4/191 (2%)

Query: 1   MKIQTNAVNVLDRTSFYLQAGLLKKTPAWYNVVARIPPVTKFAREPKLHDPVSGKYKGEL 60
           MKIQTNA N+L+RTS YLQAGLL+  PA+Y+V+A++PP TKF REPKL +P +G+ +   
Sbjct: 1   MKIQTNATNILERTSAYLQAGLLRNAPAFYDVIAQVPPSTKFTREPKLVNPSTGQDRTRF 60

Query: 61  DIMTDRLNRNTETYKTRAGSSDRQTAA--VHKPSKLRFIEDKLRSLFFQQHPWELSRPKV 118
             +TD++N     YKTR  +SDR  +   ++K S+L+++ED LR LF+ QHPWELSRPK+
Sbjct: 61  RELTDKVNWRG-LYKTRYAASDRHASVSRLYKASRLKYLEDDLRQLFYDQHPWELSRPKI 119

Query: 119 LVEN-MGNEQYDWSRMLQLGKPLDGESVVQRTLYLLKSGAHREMLAAYDQARFEFYRLRM 177
           ++EN + N   DWS + QLGKP+DGESVVQRTL+L+K+  H  +   YDQARFEFY++RM
Sbjct: 120 VIENNIDNSSLDWSNIQQLGKPVDGESVVQRTLFLMKNKKHDNLADCYDQARFEFYQVRM 179

Query: 178 QQELEEQIAYE 188
           Q++ EEQIA E
Sbjct: 180 QRDSEEQIATE 190

>CAGL0D04158g Chr4 complement(410309..411127) [819 bp, 272 aa] {ON}
           similar to uniprot|P40496 Saccharomyces cerevisiae
           YIL093c RSM25
          Length = 272

 Score =  221 bits (562), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 110/182 (60%), Positives = 137/182 (75%), Gaps = 4/182 (2%)

Query: 1   MKIQTNAVNVLDRTSFYLQAGLLKKTPAWYNVVARIPPVTKFAREPKLHDPVSGKYKGEL 60
           MKIQTNAVNVL+RTS YL+ G++K+TPAWYNVVA IPPVTKF REP   +P + K   EL
Sbjct: 1   MKIQTNAVNVLERTSAYLRTGVIKETPAWYNVVASIPPVTKFTREPHKINPSTDKKVSEL 60

Query: 61  -DIMTDRLNRNTETYKTRAGSSDRQTA--AVHKPSKLRFIEDKLRSLFFQQHPWELSRPK 117
            D   + +NRN   YKTR  + +R+ A   ++KP KL ++EDK+R+LF++QHPWEL+RPK
Sbjct: 61  KDPDLESVNRNG-LYKTRFNALERKVANKQIYKPPKLVYLEDKIRTLFYKQHPWELARPK 119

Query: 118 VLVENMGNEQYDWSRMLQLGKPLDGESVVQRTLYLLKSGAHREMLAAYDQARFEFYRLRM 177
           ++ EN  N   DW  MLQLG+PLDGE+VVQRTLYLLK+     +  AYDQAR EFYRLRM
Sbjct: 120 IVSENEINTNPDWKNMLQLGQPLDGENVVQRTLYLLKTKEQSNITDAYDQARLEFYRLRM 179

Query: 178 QQ 179
           QQ
Sbjct: 180 QQ 181

>KNAG0A05410 Chr1 (798238..799038) [801 bp, 266 aa] {ON} Anc_2.290
           YIL093C
          Length = 266

 Score =  216 bits (551), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 138/190 (72%), Gaps = 2/190 (1%)

Query: 1   MKIQTNAVNVLDRTSFYLQAGLLKKTPAWYNVVARIPPVTKFAREPKLHDPVSGKYKGEL 60
           MKIQTNAVN+L+RTS +L++G+++K PAWYNVVA  PP  KF R+P   +P +GK +  L
Sbjct: 1   MKIQTNAVNILERTSAFLESGVIQKVPAWYNVVAANPPKKKFERKPIFVNPSTGKARVNL 60

Query: 61  DIMTDRLNRNTETYKTRAGSSDRQTA--AVHKPSKLRFIEDKLRSLFFQQHPWELSRPKV 118
               D      E YKTR   +D+Q +  A+++P KL ++ED+LR LF+ QHPWE SRP +
Sbjct: 61  KSFLDSKRNAHEIYKTRYSMADKQVSHNALYRPPKLVYLEDQLRQLFYDQHPWERSRPMI 120

Query: 119 LVENMGNEQYDWSRMLQLGKPLDGESVVQRTLYLLKSGAHREMLAAYDQARFEFYRLRMQ 178
           L+EN    ++DWSR+ QLGK LDGESVVQR L+LL+ G    +  AYD+ARFEFYR+RMQ
Sbjct: 121 LIENNVTPKFDWSRIQQLGKRLDGESVVQRALFLLEGGHCDSLSTAYDKARFEFYRIRMQ 180

Query: 179 QELEEQIAYE 188
           QELEEQI+ E
Sbjct: 181 QELEEQISQE 190

>TDEL0G02200 Chr7 complement(433032..433817) [786 bp, 261 aa] {ON}
           Anc_2.290 YIL093C
          Length = 261

 Score =  216 bits (549), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 106/179 (59%), Positives = 135/179 (75%), Gaps = 3/179 (1%)

Query: 1   MKIQTNAVNVLDRTSFYLQAGLLKKTPAWYNVVARIPPVTKFAREPKLHDPVSGKYKGEL 60
           MKIQTNAVNVL+RTS YL++GLL+ TPAWY+VVA IPP TKF REP+L +P + K    L
Sbjct: 1   MKIQTNAVNVLERTSAYLRSGLLRNTPAWYDVVASIPPKTKFTREPRLINPSNMKKLAHL 60

Query: 61  DIMTDRLNRNTETYKTRAGSSDRQ--TAAVHKPSKLRFIEDKLRSLFFQQHPWELSRPKV 118
               D  N     +KTRA + D++   A +++  KL+F+ED+LR +F++QHPWELSRPKV
Sbjct: 61  KDHADEPNAKG-FFKTRASTLDKKINNAKLYRAPKLKFVEDQLREVFYKQHPWELSRPKV 119

Query: 119 LVENMGNEQYDWSRMLQLGKPLDGESVVQRTLYLLKSGAHREMLAAYDQARFEFYRLRM 177
           LVEN   E++DWS + QL KPLDGESV+QRTL+LLK+   + +  AYDQARFEFYRLRM
Sbjct: 120 LVENDAEEEFDWSHIQQLEKPLDGESVIQRTLFLLKNNEGKSLTEAYDQARFEFYRLRM 178

>NCAS0B06240 Chr2 (1178232..1179014) [783 bp, 260 aa] {ON} Anc_2.290
           YIL093C
          Length = 260

 Score =  211 bits (537), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 103/183 (56%), Positives = 136/183 (74%), Gaps = 12/183 (6%)

Query: 1   MKIQTNAVNVLDRTSFYLQAGLLKKTPAWYNVVARIPPVTKFAREPKLHDPVSGKYKGEL 60
           M++QTNA+N+++RTS YL++GLLK TPAWY VVA+IPP  KF REP+L +P + +     
Sbjct: 1   MRVQTNAINIVERTSAYLKSGLLKNTPAWYEVVAKIPPTKKFTREPRLINPSTNE----- 55

Query: 61  DIMTDRLNRNTET----YKTRAGSSDRQTAA--VHKPSKLRFIEDKLRSLFFQQHPWELS 114
           D+   R NR        YKTR    DR+  +  ++KP KL+++ED+LR+LFF QHPWELS
Sbjct: 56  DLAVLRDNREAVNKKGFYKTRPNKLDRKVNSNKLYKPPKLQYVEDQLRTLFFDQHPWELS 115

Query: 115 RPKVLVENMGNEQYDWSRMLQLGKPLDGESVVQRTLYLLKSGAHREMLAAYDQARFEFYR 174
           RPK+LVEN   E++DWS + QLGKPLDGESVVQRT+YLLK+    +M+ AY+QARFEFYR
Sbjct: 116 RPKILVENSLEERFDWSHIQQLGKPLDGESVVQRTMYLLKTDKM-DMITAYNQARFEFYR 174

Query: 175 LRM 177
            R+
Sbjct: 175 FRI 177

>TPHA0C03420 Chr3 complement(750353..751159) [807 bp, 268 aa] {ON}
           Anc_2.290 YIL093C
          Length = 268

 Score =  203 bits (517), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 135/186 (72%), Gaps = 5/186 (2%)

Query: 1   MKIQTNAVNVLDRTSFYLQAGLLKKTPAWYNVVARIPPVTKFAREPKLHDPVSGKYKGEL 60
           MKIQ NAVNVL+RTS YL++GLL K PAWYNVVA IPP  KF R PK  +P + K   EL
Sbjct: 1   MKIQQNAVNVLERTSSYLRSGLLTKQPAWYNVVAEIPPSKKFERTPKFTNPSNNKKLNEL 60

Query: 61  DIMTDRL--NRN-TETYKTRAGSSDRQTAA--VHKPSKLRFIEDKLRSLFFQQHPWELSR 115
            I+ +RL  +RN T  +K+R    D+++++  V+KP+KL +IED+LR +F+ QHPWELSR
Sbjct: 61  RIIDERLVSDRNGTFLFKSRYNKLDKKSSSKNVYKPAKLSYIEDQLREVFYIQHPWELSR 120

Query: 116 PKVLVENMGNEQYDWSRMLQLGKPLDGESVVQRTLYLLKSGAHREMLAAYDQARFEFYRL 175
           PK++VEN G+E YDWS + QLGK LDGE+VVQR +YL+K            +AR+EFYR+
Sbjct: 121 PKIVVENNGDETYDWSHIQQLGKALDGENVVQRAMYLMKKKLIMIFQKHTIKARYEFYRV 180

Query: 176 RMQQEL 181
           RMQ E+
Sbjct: 181 RMQSEI 186

>KLLA0C04081g Chr3 (371620..372480) [861 bp, 286 aa] {ON} similar to
           uniprot|Q12326 Saccharomyces cerevisiae YOL056W GPM3 and
           to YDL021W uniprot|Q12008 Saccharomyces cerevisiae
           YDL021W GPM2, Homologs of Gpm1p phosphoglycerate mutase
           which converts 3-phosphoglycerate to 2-phosphoglycerate
           in glycolysis
          Length = 286

 Score = 30.8 bits (68), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 41/91 (45%), Gaps = 17/91 (18%)

Query: 111 WELSRPKVLVENMGNEQYDWSRMLQLGKPLDGESVVQRTLYLLKSGAHREMLAAYDQAR- 169
           W+      ++E  G EQY + R   LGKP              K+  +REM+  +DQ   
Sbjct: 116 WQGQSKHKMLEEYGEEQYMYIRRDYLGKP-------------PKADLNREMVQDFDQGDT 162

Query: 170 -FEFYRL-RMQQELEEQIAY-ERPRWLALCS 197
            +EF    R  + LEE+I + E P   +LC 
Sbjct: 163 GYEFKEPNRHVKYLEEEITHDELPNGESLCD 193

>KNAG0J01700 Chr10 (309962..312424) [2463 bp, 820 aa] {ON} 
          Length = 820

 Score = 30.8 bits (68), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 34/74 (45%), Gaps = 9/74 (12%)

Query: 127 QYDWSRMLQLGKPLDG---------ESVVQRTLYLLKSGAHREMLAAYDQARFEFYRLRM 177
           ++ W +M  LG P DG         ES +   + L++S  ++  L   D+ ++E  +   
Sbjct: 467 EHPWIQMAYLGSPFDGASPPMVMEPESSLPSQVSLMESTENQSQLQKLDEEKYEAVKAER 526

Query: 178 QQELEEQIAYERPR 191
             + E+ +A  R R
Sbjct: 527 DAQFEQLLAMSRSR 540

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.132    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 22,651,899
Number of extensions: 889140
Number of successful extensions: 2293
Number of sequences better than 10.0: 25
Number of HSP's gapped: 2294
Number of HSP's successfully gapped: 25
Length of query: 225
Length of database: 53,481,399
Length adjustment: 106
Effective length of query: 119
Effective length of database: 41,326,803
Effective search space: 4917889557
Effective search space used: 4917889557
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 63 (28.9 bits)