Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ADL210W2.291ON72723715e-48
NCAS0G037602.291ON72723171e-39
Kpol_1003.412.291ON72723161e-39
Cgla_YGOB_Anc_2.2912.291ON72723152e-39
TBLA0B069702.291ON72713101e-38
NDAI0G006902.291ON72723101e-38
TPHA0C034302.291ON72723073e-38
KNAG0H019702.291ON72723064e-38
KLLA0E08251g2.291ON72723041e-37
Smik_14.3062.291ON72723022e-37
YNL024C-A (KSH1)2.291ON72723022e-37
SAKL0E07568g2.291ON72723013e-37
Suva_14.3222.291ON72722994e-37
Ecym_33302.291ON72722832e-34
KAFR0H032802.291ON72722771e-33
TDEL0G022102.291ON72722735e-33
KLTH0G10472g2.291ON72722726e-33
Kwal_YGOB_Anc_2.2912.291ON72722683e-32
Skud_14.3042.291ON72722632e-31
ZYRO0A01980g2.291ON72722571e-30
ABL198C2.12ON34118640.62
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADL210W
         (72 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADL210W Chr4 (334320..334538) [219 bp, 72 aa] {ON} Syntenic homo...   147   5e-48
NCAS0G03760 Chr7 complement(693645..693863) [219 bp, 72 aa] {ON}...   126   1e-39
Kpol_1003.41 s1003 (99502..99720) [219 bp, 72 aa] {ON} (99502..9...   126   1e-39
Cgla_YGOB_Anc_2.291 Chr13 complement(701547..701765) [219 bp, 72...   125   2e-39
TBLA0B06970 Chr2 (1648736..1648954) [219 bp, 72 aa] {ON} Anc_2.2...   124   1e-38
NDAI0G00690 Chr7 (151360..151578) [219 bp, 72 aa] {ON} Anc_2.291...   124   1e-38
TPHA0C03430 Chr3 (751723..751941) [219 bp, 72 aa] {ON} Anc_2.291...   122   3e-38
KNAG0H01970 Chr8 complement(347994..348212) [219 bp, 72 aa] {ON}...   122   4e-38
KLLA0E08251g Chr5 complement(744523..744741) [219 bp, 72 aa] {ON...   121   1e-37
Smik_14.306 Chr14 complement(548999..549214) [216 bp, 72 aa] {ON...   120   2e-37
YNL024C-A Chr14 complement(586602..586820) [219 bp, 72 aa] {ON} ...   120   2e-37
SAKL0E07568g Chr5 complement(613454..613672) [219 bp, 72 aa] {ON...   120   3e-37
Suva_14.322 Chr14 complement(569440..569655) [216 bp, 72 aa] {ON...   119   4e-37
Ecym_3330 Chr3 (631388..631606) [219 bp, 72 aa] {ON} similar to ...   113   2e-34
KAFR0H03280 Chr8 complement(626054..626272) [219 bp, 72 aa] {ON}...   111   1e-33
TDEL0G02210 Chr7 (434303..434521) [219 bp, 72 aa] {ON} Anc_2.291...   109   5e-33
KLTH0G10472g Chr7 (885262..885480) [219 bp, 72 aa] {ON} highly s...   109   6e-33
Kwal_YGOB_Anc_2.291 s27 complement(830525..830743) [219 bp, 72 a...   107   3e-32
Skud_14.304 Chr14 complement(557335..557550) [216 bp, 72 aa] {ON...   105   2e-31
ZYRO0A01980g Chr1 (164037..164255) [219 bp, 72 aa] {ON} highly s...   103   1e-30
ABL198C Chr2 complement(37526..38551) [1026 bp, 341 aa] {ON} Syn...    29   0.62 

>ADL210W Chr4 (334320..334538) [219 bp, 72 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YNL024CX; YNL024CX
          was overlooked in Saccharomyces cerevisiae
          Length = 72

 Score =  147 bits (371), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 72/72 (100%), Positives = 72/72 (100%)

Query: 1  MSALFKFSALLQVILLLICSSTYVHAQWPSLLERYKEHSVLGIFWKFARIGERASPYVSI 60
          MSALFKFSALLQVILLLICSSTYVHAQWPSLLERYKEHSVLGIFWKFARIGERASPYVSI
Sbjct: 1  MSALFKFSALLQVILLLICSSTYVHAQWPSLLERYKEHSVLGIFWKFARIGERASPYVSI 60

Query: 61 ACIAMAINQINS 72
          ACIAMAINQINS
Sbjct: 61 ACIAMAINQINS 72

>NCAS0G03760 Chr7 complement(693645..693863) [219 bp, 72 aa] {ON}
          Anc_2.291 YNL024C-A
          Length = 72

 Score =  126 bits (317), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 59/72 (81%), Positives = 63/72 (87%)

Query: 1  MSALFKFSALLQVILLLICSSTYVHAQWPSLLERYKEHSVLGIFWKFARIGERASPYVSI 60
          MSALF FS+LLQVILLLICS TYVH QWPSLL+RYK+H  LG FWK ARIGERASPYVS+
Sbjct: 1  MSALFNFSSLLQVILLLICSCTYVHTQWPSLLDRYKDHEALGAFWKMARIGERASPYVSL 60

Query: 61 ACIAMAINQINS 72
          ACI MAINQ NS
Sbjct: 61 ACIIMAINQFNS 72

>Kpol_1003.41 s1003 (99502..99720) [219 bp, 72 aa] {ON}
          (99502..99720) [219 nt, 73 aa]
          Length = 72

 Score =  126 bits (316), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 57/72 (79%), Positives = 65/72 (90%)

Query: 1  MSALFKFSALLQVILLLICSSTYVHAQWPSLLERYKEHSVLGIFWKFARIGERASPYVSI 60
          MSALF F++LLQVILLLICSSTY+H+QWPS L+RYK+ SVLG FWK ARIGERASPYVS+
Sbjct: 1  MSALFNFTSLLQVILLLICSSTYIHSQWPSFLDRYKDQSVLGAFWKLARIGERASPYVSL 60

Query: 61 ACIAMAINQINS 72
          ACI MA+NQ NS
Sbjct: 61 ACIIMAVNQFNS 72

>Cgla_YGOB_Anc_2.291 Chr13 complement(701547..701765) [219 bp, 72
          aa] {ON} ANNOTATED BY YGOB -
          Length = 72

 Score =  125 bits (315), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 57/72 (79%), Positives = 63/72 (87%)

Query: 1  MSALFKFSALLQVILLLICSSTYVHAQWPSLLERYKEHSVLGIFWKFARIGERASPYVSI 60
          MSALF F++LLQVILLLICS TY+H QWPSLL+RYK H +LG FWK ARIGERASPYVS+
Sbjct: 1  MSALFNFASLLQVILLLICSCTYIHTQWPSLLDRYKNHDILGAFWKMARIGERASPYVSV 60

Query: 61 ACIAMAINQINS 72
          ACI MAINQ NS
Sbjct: 61 ACILMAINQFNS 72

>TBLA0B06970 Chr2 (1648736..1648954) [219 bp, 72 aa] {ON}
          Anc_2.291 YNL024C-A
          Length = 72

 Score =  124 bits (310), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 63/71 (88%)

Query: 1  MSALFKFSALLQVILLLICSSTYVHAQWPSLLERYKEHSVLGIFWKFARIGERASPYVSI 60
          MSALF F ++LQVILLLICSSTY+H QWPSLL+RYK HS LG FWK ARIGERASPYVS+
Sbjct: 1  MSALFSFRSMLQVILLLICSSTYIHCQWPSLLDRYKNHSTLGAFWKMARIGERASPYVSL 60

Query: 61 ACIAMAINQIN 71
          ACIAMAI+Q N
Sbjct: 61 ACIAMAISQFN 71

>NDAI0G00690 Chr7 (151360..151578) [219 bp, 72 aa] {ON} Anc_2.291
          YNL024C-A
          Length = 72

 Score =  124 bits (310), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 57/72 (79%), Positives = 63/72 (87%)

Query: 1  MSALFKFSALLQVILLLICSSTYVHAQWPSLLERYKEHSVLGIFWKFARIGERASPYVSI 60
          MSALF F +LLQVILLLICS TYVH+QWPS+L+RYK+H  LG FWK ARIGERASPYVS+
Sbjct: 1  MSALFNFRSLLQVILLLICSCTYVHSQWPSILDRYKDHGALGAFWKMARIGERASPYVSL 60

Query: 61 ACIAMAINQINS 72
          ACI MAINQ NS
Sbjct: 61 ACIIMAINQFNS 72

>TPHA0C03430 Chr3 (751723..751941) [219 bp, 72 aa] {ON} Anc_2.291
          YNL024C-A
          Length = 72

 Score =  122 bits (307), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 56/72 (77%), Positives = 63/72 (87%)

Query: 1  MSALFKFSALLQVILLLICSSTYVHAQWPSLLERYKEHSVLGIFWKFARIGERASPYVSI 60
          MSALF FS+LLQVILLLICSSTY+H+QWPSL +RYK+  VL  FWK +RIGERASPYVSI
Sbjct: 1  MSALFNFSSLLQVILLLICSSTYIHSQWPSLFDRYKDTGVLSTFWKLSRIGERASPYVSI 60

Query: 61 ACIAMAINQINS 72
          ACI MA+NQ NS
Sbjct: 61 ACIIMAVNQFNS 72

>KNAG0H01970 Chr8 complement(347994..348212) [219 bp, 72 aa] {ON}
          Anc_2.291 YNL024C-A
          Length = 72

 Score =  122 bits (306), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 57/72 (79%), Positives = 62/72 (86%)

Query: 1  MSALFKFSALLQVILLLICSSTYVHAQWPSLLERYKEHSVLGIFWKFARIGERASPYVSI 60
          MSALF FS+LLQVILLLICS TYVH QWPSLL+RYKEH  LG FWK AR+GERASPYVS+
Sbjct: 1  MSALFNFSSLLQVILLLICSCTYVHTQWPSLLDRYKEHEALGAFWKMARLGERASPYVSL 60

Query: 61 ACIAMAINQINS 72
          ACI MA+NQ  S
Sbjct: 61 ACILMALNQFMS 72

>KLLA0E08251g Chr5 complement(744523..744741) [219 bp, 72 aa] {ON}
          highly similar to uniprot|Q8TGJ3 Saccharomyces
          cerevisiae YNL024C-A Identified by gene-trapping
          microarray-based expression analysis and genome-wide
          homology searching
          Length = 72

 Score =  121 bits (304), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 64/72 (88%)

Query: 1  MSALFKFSALLQVILLLICSSTYVHAQWPSLLERYKEHSVLGIFWKFARIGERASPYVSI 60
          MSALF F +LLQVILL ICS TY+HAQ PSLL+RYK+  +LG+FWKFARIGERASPYVS+
Sbjct: 1  MSALFNFKSLLQVILLFICSCTYIHAQRPSLLDRYKDSGILGVFWKFARIGERASPYVSL 60

Query: 61 ACIAMAINQINS 72
          ACIAMA++Q NS
Sbjct: 61 ACIAMAVSQFNS 72

>Smik_14.306 Chr14 complement(548999..549214) [216 bp, 72 aa] {ON}
          YNL024C-A (REAL)
          Length = 72

 Score =  120 bits (302), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 56/72 (77%), Positives = 62/72 (86%)

Query: 1  MSALFKFSALLQVILLLICSSTYVHAQWPSLLERYKEHSVLGIFWKFARIGERASPYVSI 60
          MSALF F +LLQVILLLICS +YVH QWPSLL+RYK H VLG FWK AR+GERASPYVS+
Sbjct: 1  MSALFNFRSLLQVILLLICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARVGERASPYVSL 60

Query: 61 ACIAMAINQINS 72
          ACI MAI+Q NS
Sbjct: 61 ACILMAISQFNS 72

>YNL024C-A Chr14 complement(586602..586820) [219 bp, 72 aa] {ON}
          KSH1Essential protein suggested to function early in
          the secretory pathway; inviability is suppressed by
          overexpression of Golgi protein Tvp23p; ortholog of
          human Kish
          Length = 72

 Score =  120 bits (302), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 56/72 (77%), Positives = 62/72 (86%)

Query: 1  MSALFKFSALLQVILLLICSSTYVHAQWPSLLERYKEHSVLGIFWKFARIGERASPYVSI 60
          MSALF F +LLQVILLLICS +YVH QWPSLL+RYK H VLG FWK AR+GERASPYVS+
Sbjct: 1  MSALFNFRSLLQVILLLICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARVGERASPYVSL 60

Query: 61 ACIAMAINQINS 72
          ACI MAI+Q NS
Sbjct: 61 ACILMAISQFNS 72

>SAKL0E07568g Chr5 complement(613454..613672) [219 bp, 72 aa] {ON}
          similar to uniprot|Q8TGJ3 Saccharomyces cerevisiae
          YNL024C-A Identified by gene-trapping, microarray-based
          expression analysis, and genome-wide homology searching
          Length = 72

 Score =  120 bits (301), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 62/72 (86%)

Query: 1  MSALFKFSALLQVILLLICSSTYVHAQWPSLLERYKEHSVLGIFWKFARIGERASPYVSI 60
          MSALF F +LLQVILLLICS TY+H QWPSLL+RYK H +L +FWKFAR+GERASPYVS+
Sbjct: 1  MSALFNFRSLLQVILLLICSCTYIHTQWPSLLDRYKNHGMLNVFWKFARVGERASPYVSL 60

Query: 61 ACIAMAINQINS 72
          ACI MAI+Q  S
Sbjct: 61 ACICMAISQFKS 72

>Suva_14.322 Chr14 complement(569440..569655) [216 bp, 72 aa] {ON}
          YNL024C-A (REAL)
          Length = 72

 Score =  119 bits (299), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 56/72 (77%), Positives = 61/72 (84%)

Query: 1  MSALFKFSALLQVILLLICSSTYVHAQWPSLLERYKEHSVLGIFWKFARIGERASPYVSI 60
          MSALF F +LLQVILLLICS +YVH QWPSLL+RYK H V G FWK ARIGERASPYVS+
Sbjct: 1  MSALFNFRSLLQVILLLICSCSYVHGQWPSLLDRYKNHEVFGAFWKMARIGERASPYVSL 60

Query: 61 ACIAMAINQINS 72
          ACI MAI+Q NS
Sbjct: 61 ACILMAISQFNS 72

>Ecym_3330 Chr3 (631388..631606) [219 bp, 72 aa] {ON} similar to
          Ashbya gossypii ADL210W
          Length = 72

 Score =  113 bits (283), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 61/72 (84%), Positives = 65/72 (90%)

Query: 1  MSALFKFSALLQVILLLICSSTYVHAQWPSLLERYKEHSVLGIFWKFARIGERASPYVSI 60
          MSALFKFS+LLQ+ILLLICSSTYVH QWPSLLERYK+H VL IFWKFARIGERASPYVS+
Sbjct: 1  MSALFKFSSLLQIILLLICSSTYVHCQWPSLLERYKQHGVLSIFWKFARIGERASPYVSL 60

Query: 61 ACIAMAINQINS 72
          ACI M  NQ NS
Sbjct: 61 ACIVMVANQFNS 72

>KAFR0H03280 Chr8 complement(626054..626272) [219 bp, 72 aa] {ON}
          Anc_2.291 YNL024C-A
          Length = 72

 Score =  111 bits (277), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 56/72 (77%), Positives = 63/72 (87%)

Query: 1  MSALFKFSALLQVILLLICSSTYVHAQWPSLLERYKEHSVLGIFWKFARIGERASPYVSI 60
          MSALF FS+LLQV+LLLICS TY+H QWPSLLERYK+H  LGIFWK AR+GER SPYVS+
Sbjct: 1  MSALFNFSSLLQVLLLLICSCTYIHTQWPSLLERYKDHEALGIFWKMARVGERGSPYVSL 60

Query: 61 ACIAMAINQINS 72
          ACI MA+NQ NS
Sbjct: 61 ACILMAVNQFNS 72

>TDEL0G02210 Chr7 (434303..434521) [219 bp, 72 aa] {ON} Anc_2.291
          YNL024C-A
          Length = 72

 Score =  109 bits (273), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 57/72 (79%), Positives = 63/72 (87%)

Query: 1  MSALFKFSALLQVILLLICSSTYVHAQWPSLLERYKEHSVLGIFWKFARIGERASPYVSI 60
          MSALF F +LLQVILLL+CS TYVHAQWPSLL+RYK+H V G FWK AR+GERASPYVS+
Sbjct: 1  MSALFNFKSLLQVILLLLCSCTYVHAQWPSLLDRYKDHGVFGAFWKMARVGERASPYVSV 60

Query: 61 ACIAMAINQINS 72
          ACI MAINQ NS
Sbjct: 61 ACILMAINQFNS 72

>KLTH0G10472g Chr7 (885262..885480) [219 bp, 72 aa] {ON} highly
          similar to uniprot|Q8TGJ3 Saccharomyces cerevisiae
          YNL024C-A Identified by gene-trapping microarray-based
          expression analysis and genome-wide homology searching
          Length = 72

 Score =  109 bits (272), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 57/72 (79%), Positives = 64/72 (88%)

Query: 1  MSALFKFSALLQVILLLICSSTYVHAQWPSLLERYKEHSVLGIFWKFARIGERASPYVSI 60
          MSALF F ALLQV+LLLICS TY+H+QWPSLL+RYKEHS+LG FWK ARIGERASPYVSI
Sbjct: 1  MSALFNFQALLQVLLLLICSCTYIHSQWPSLLDRYKEHSMLGAFWKCARIGERASPYVSI 60

Query: 61 ACIAMAINQINS 72
          ACI MA+NQ  +
Sbjct: 61 ACIIMAVNQFQT 72

>Kwal_YGOB_Anc_2.291 s27 complement(830525..830743) [219 bp, 72
          aa] {ON} ANNOTATED BY YGOB -
          Length = 72

 Score =  107 bits (268), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 64/72 (88%)

Query: 1  MSALFKFSALLQVILLLICSSTYVHAQWPSLLERYKEHSVLGIFWKFARIGERASPYVSI 60
          MSALF F ALLQV+LLLICS TY+H+QWPSLL+RYK+HS+LG FWK ARIGERASPYVS+
Sbjct: 1  MSALFNFQALLQVLLLLICSCTYIHSQWPSLLDRYKDHSMLGAFWKCARIGERASPYVSL 60

Query: 61 ACIAMAINQINS 72
          ACI MA+NQ  +
Sbjct: 61 ACIIMAVNQFQT 72

>Skud_14.304 Chr14 complement(557335..557550) [216 bp, 72 aa] {ON}
          YNL024C-A (REAL)
          Length = 72

 Score =  105 bits (263), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 56/72 (77%), Positives = 62/72 (86%)

Query: 1  MSALFKFSALLQVILLLICSSTYVHAQWPSLLERYKEHSVLGIFWKFARIGERASPYVSI 60
          MSALF F +LLQV+LLLICS +YVH QWPSLL+RYK H VLG FWK ARIGERASPYVS+
Sbjct: 1  MSALFNFRSLLQVLLLLICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARIGERASPYVSL 60

Query: 61 ACIAMAINQINS 72
          ACI MAI+Q NS
Sbjct: 61 ACILMAISQFNS 72

>ZYRO0A01980g Chr1 (164037..164255) [219 bp, 72 aa] {ON} highly
          similar to uniprot|Q8TGJ3 Saccharomyces cerevisiae
          YNL024C-A Identified by gene-trapping microarray-based
          expression analysis and genome-wide homology searching
          Length = 72

 Score =  103 bits (257), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 63/72 (87%)

Query: 1  MSALFKFSALLQVILLLICSSTYVHAQWPSLLERYKEHSVLGIFWKFARIGERASPYVSI 60
          MSALF F +LLQVILLL+CS TYVHAQWPSLL+RYK H VL  FWK AR+GERASPYVS+
Sbjct: 1  MSALFNFKSLLQVILLLLCSCTYVHAQWPSLLDRYKGHGVLSAFWKMARVGERASPYVSL 60

Query: 61 ACIAMAINQINS 72
          ACI MA++Q+NS
Sbjct: 61 ACILMALSQLNS 72

>ABL198C Chr2 complement(37526..38551) [1026 bp, 341 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL231C
           (PDR16)
          Length = 341

 Score = 29.3 bits (64), Expect = 0.62,   Method: Composition-based stats.
 Identities = 12/18 (66%), Positives = 15/18 (83%), Gaps = 1/18 (5%)

Query: 22  TYVHAQ-WPSLLERYKEH 38
           TYVH Q WPSLL+R +E+
Sbjct: 294 TYVHEQYWPSLLQRTREN 311

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.329    0.136    0.418 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 6,091,067
Number of extensions: 172287
Number of successful extensions: 560
Number of sequences better than 10.0: 21
Number of HSP's gapped: 560
Number of HSP's successfully gapped: 21
Length of query: 72
Length of database: 53,481,399
Length adjustment: 45
Effective length of query: 27
Effective length of database: 48,321,429
Effective search space: 1304678583
Effective search space used: 1304678583
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 59 (27.3 bits)