Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ADL209C2.292ON70470433840.0
Ecym_33312.292ON70871621980.0
SAKL0E07546g2.292ON71870421320.0
KAFR0J013402.292ON72871921120.0
KNAG0A054002.292ON72172020720.0
YIL091C (UTP25)2.292ON72171320550.0
Suva_9.1082.292ON72256620480.0
Kwal_27.115032.292ON72756420490.0
KLTH0G10494g2.292ON74756420490.0
Smik_9.882.292ON72456620460.0
KLLA0E08229g2.292ON70470520430.0
Skud_9.822.292ON72271320260.0
CAGL0D04180g2.292ON70070720150.0
TDEL0G022202.292ON71070520090.0
NDAI0B035302.292ON73966120050.0
Kpol_1039.462.292ON70469820000.0
NCAS0B062302.292ON72356719970.0
TBLA0B059702.292ON71970719840.0
ZYRO0A02002g2.292ON70970619330.0
TPHA0D015202.292ON71656519200.0
TBLA0I012402.467ON470152752.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADL209C
         (704 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADL209C Chr4 complement(334817..336931) [2115 bp, 704 aa] {ON} S...  1308   0.0  
Ecym_3331 Chr3 complement(631944..634070) [2127 bp, 708 aa] {ON}...   851   0.0  
SAKL0E07546g Chr5 (610979..613135) [2157 bp, 718 aa] {ON} simila...   825   0.0  
KAFR0J01340 Chr10 (245485..247671) [2187 bp, 728 aa] {ON} Anc_2....   818   0.0  
KNAG0A05400 Chr1 (795728..797893) [2166 bp, 721 aa] {ON} Anc_2.2...   802   0.0  
YIL091C Chr9 complement(191030..193195) [2166 bp, 721 aa] {ON}  ...   796   0.0  
Suva_9.108 Chr9 complement(185226..187394) [2169 bp, 722 aa] {ON...   793   0.0  
Kwal_27.11503 s27 (828115..830298) [2184 bp, 727 aa] {ON} YIL091...   793   0.0  
KLTH0G10494g Chr7 complement(885735..887978) [2244 bp, 747 aa] {...   793   0.0  
Smik_9.88 Chr9 complement(170163..172337) [2175 bp, 724 aa] {ON}...   792   0.0  
KLLA0E08229g Chr5 (742066..744180) [2115 bp, 704 aa] {ON} simila...   791   0.0  
Skud_9.82 Chr9 complement(167750..169918) [2169 bp, 722 aa] {ON}...   785   0.0  
CAGL0D04180g Chr4 complement(411498..413600) [2103 bp, 700 aa] {...   780   0.0  
TDEL0G02220 Chr7 complement(434650..436782) [2133 bp, 710 aa] {O...   778   0.0  
NDAI0B03530 Chr2 (887479..889698) [2220 bp, 739 aa] {ON} Anc_2.2...   776   0.0  
Kpol_1039.46 s1039 complement(138925..141039) [2115 bp, 704 aa] ...   775   0.0  
NCAS0B06230 Chr2 (1175844..1178015) [2172 bp, 723 aa] {ON} Anc_2...   773   0.0  
TBLA0B05970 Chr2 complement(1410055..1412214) [2160 bp, 719 aa] ...   768   0.0  
ZYRO0A02002g Chr1 complement(164386..166515) [2130 bp, 709 aa] {...   749   0.0  
TPHA0D01520 Chr4 (310797..312947) [2151 bp, 716 aa] {ON} Anc_2.2...   744   0.0  
TBLA0I01240 Chr9 (265144..266556) [1413 bp, 470 aa] {ON} Anc_2.4...    33   2.1  

>ADL209C Chr4 complement(334817..336931) [2115 bp, 704 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL091C
          Length = 704

 Score = 1308 bits (3384), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 644/704 (91%), Positives = 644/704 (91%)

Query: 1   MGITDSHGIMDGKRGRKQLRNITRIGRAIHVQEDEAKSREEHTVEEAQAGEQTSNRKRGN 60
           MGITDSHGIMDGKRGRKQLRNITRIGRAIHVQEDEAKSREEHTVEEAQAGEQTSNRKRGN
Sbjct: 1   MGITDSHGIMDGKRGRKQLRNITRIGRAIHVQEDEAKSREEHTVEEAQAGEQTSNRKRGN 60

Query: 61  HPAEDDGGARESQSYGALLTLLSAEHGKQRKKRLRKXXXXXXXXXXXXXXXXXXITAALX 120
           HPAEDDGGARESQSYGALLTLLSAEHGKQRKKRLRK                  ITAAL 
Sbjct: 61  HPAEDDGGARESQSYGALLTLLSAEHGKQRKKRLRKAEAEAAEAAEAGEDPEEAITAALE 120

Query: 121 XXXXXXXXXXXXXXXXXXXXXXQDHFDVHFNRVSAADVAQLDAAFKNGRAQYRVQKEARG 180
                                 QDHFDVHFNRVSAADVAQLDAAFKNGRAQYRVQKEARG
Sbjct: 121 NSAQDAEDAEDAFDDSGESDEEQDHFDVHFNRVSAADVAQLDAAFKNGRAQYRVQKEARG 180

Query: 181 EEEILYSKPVASSEGTEGPVRVPARSLRGYAIKQRLRMHNGLTADDPEKPLTPQQKVLLD 240
           EEEILYSKPVASSEGTEGPVRVPARSLRGYAIKQRLRMHNGLTADDPEKPLTPQQKVLLD
Sbjct: 181 EEEILYSKPVASSEGTEGPVRVPARSLRGYAIKQRLRMHNGLTADDPEKPLTPQQKVLLD 240

Query: 241 PMFQYQDIXXXXXXXXXXXXXXXXXXXHILNHVYKTRDRILKNNQKLQDNPDQELLDQGF 300
           PMFQYQDI                   HILNHVYKTRDRILKNNQKLQDNPDQELLDQGF
Sbjct: 241 PMFQYQDILYEYEGYDREREYRELYTLHILNHVYKTRDRILKNNQKLQDNPDQELLDQGF 300

Query: 301 TRPKALVVVPTRATAYDVVDLLLQQSGIEQVDKKSKFKDQFYDPSLPPASKPKSFQHVFK 360
           TRPKALVVVPTRATAYDVVDLLLQQSGIEQVDKKSKFKDQFYDPSLPPASKPKSFQHVFK
Sbjct: 301 TRPKALVVVPTRATAYDVVDLLLQQSGIEQVDKKSKFKDQFYDPSLPPASKPKSFQHVFK 360

Query: 361 GNTNDFFVLGMKFTRKAIRLYSNFYQSDVIVCSPLGLQLIIENTDKKKRQDDFLSSIEVM 420
           GNTNDFFVLGMKFTRKAIRLYSNFYQSDVIVCSPLGLQLIIENTDKKKRQDDFLSSIEVM
Sbjct: 361 GNTNDFFVLGMKFTRKAIRLYSNFYQSDVIVCSPLGLQLIIENTDKKKRQDDFLSSIEVM 420

Query: 421 VLDQLHSIEFQNIAHVSNIFAHINKIPQQQRDADFSRIRMWYIEDQAKLFRQTMVFTRYI 480
           VLDQLHSIEFQNIAHVSNIFAHINKIPQQQRDADFSRIRMWYIEDQAKLFRQTMVFTRYI
Sbjct: 421 VLDQLHSIEFQNIAHVSNIFAHINKIPQQQRDADFSRIRMWYIEDQAKLFRQTMVFTRYI 480

Query: 481 SPFANALLNRKCANWAGRVKSHRVVSAEKSVIGQLGLKLRQIFQRFEVLGGSTVDEPDFR 540
           SPFANALLNRKCANWAGRVKSHRVVSAEKSVIGQLGLKLRQIFQRFEVLGGSTVDEPDFR
Sbjct: 481 SPFANALLNRKCANWAGRVKSHRVVSAEKSVIGQLGLKLRQIFQRFEVLGGSTVDEPDFR 540

Query: 541 FKFFTSVVVPGIEKTTGYDSGILLYIPEYTDFIRVRNYLKDKTRILFGDINEYSDQRQLT 600
           FKFFTSVVVPGIEKTTGYDSGILLYIPEYTDFIRVRNYLKDKTRILFGDINEYSDQRQLT
Sbjct: 541 FKFFTSVVVPGIEKTTGYDSGILLYIPEYTDFIRVRNYLKDKTRILFGDINEYSDQRQLT 600

Query: 601 SNRALFQLGRIKVLLYTERLHHFRRFELKGVKSVILYKPPSNPEFYQELLRYIGKSAFLG 660
           SNRALFQLGRIKVLLYTERLHHFRRFELKGVKSVILYKPPSNPEFYQELLRYIGKSAFLG
Sbjct: 601 SNRALFQLGRIKVLLYTERLHHFRRFELKGVKSVILYKPPSNPEFYQELLRYIGKSAFLG 660

Query: 661 VADLNIATVRCLYSKMDSLALERIVGTKRAAVLTHGQNEVYEFK 704
           VADLNIATVRCLYSKMDSLALERIVGTKRAAVLTHGQNEVYEFK
Sbjct: 661 VADLNIATVRCLYSKMDSLALERIVGTKRAAVLTHGQNEVYEFK 704

>Ecym_3331 Chr3 complement(631944..634070) [2127 bp, 708 aa] {ON}
           similar to Ashbya gossypii ADL209C
          Length = 708

 Score =  851 bits (2198), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/716 (59%), Positives = 524/716 (73%), Gaps = 29/716 (4%)

Query: 10  MDGKRGRKQLRNITRIGRAIHVQEDEAKSREEHTVEE--AQAGEQTSNRKRGNH--PAED 65
           MD KRGRKQLR ITRIGR  +  ED+A       +E+     G++ +    G H   A+D
Sbjct: 1   MDSKRGRKQLRKITRIGR--NRSEDKANGS---ALEKRGNNDGDEYAEIAMGEHEKAADD 55

Query: 66  DGGARESQSYGALLTLLSAEHGKQRKKRLRKXXXXXXX-------XXXXXXXXXXXITAA 118
           D   R +  YGALL++L++ H + R+KR++                          I+A+
Sbjct: 56  DQEERTAHVYGALLSILNSAHPEIRRKRVKVEKTTDAVVEERKNGSRNYETDEVATISAS 115

Query: 119 LXXXXXXXXXXXXXXXXXXXXXXXQDH---FDVHFNRVSAADVAQLDAAFKNGRAQYRVQ 175
           L                       +D    F+ HFN++S  D  +LDAAFK    QY   
Sbjct: 116 LDDSVDKDEEVEEDDGVYSDGEDSEDERDPFEYHFNQISEMDTNKLDAAFKEKTVQYEST 175

Query: 176 K--EARGEEEILYSKPVASSEGTEGP-----VRVPARSLRGYAIKQRLRMHNGLTADDPE 228
           K       E  ++SKPV   EG +G        V   ++  Y +K++L++HNGL  DD +
Sbjct: 176 KLPYMHDNEGFIFSKPVI--EGLKGSDAVNDTPVCKGNIHSYFMKKKLKVHNGL-LDDKK 232

Query: 229 KPLTPQQKVLLDPMFQYQDIXXXXXXXXXXXXXXXXXXXHILNHVYKTRDRILKNNQKLQ 288
           KPLTP  K L+DP+FQY+D+                   HILNH+YKTRDRILKNN KLQ
Sbjct: 233 KPLTPLSKTLVDPIFQYRDLLFEYEDFSQETEYRDLYTLHILNHIYKTRDRILKNNHKLQ 292

Query: 289 DNPDQELLDQGFTRPKALVVVPTRATAYDVVDLLLQQSGIEQVDKKSKFKDQFYDPSLPP 348
           +N DQELLDQGFTRPK LVV PTR TAYD+++ ++ +SG++QVDKKSKFKDQFY+ SLPP
Sbjct: 293 ENDDQELLDQGFTRPKVLVVAPTRNTAYDIIEKIIDKSGLDQVDKKSKFKDQFYEDSLPP 352

Query: 349 ASKPKSFQHVFKGNTNDFFVLGMKFTRKAIRLYSNFYQSDVIVCSPLGLQLIIENTDKKK 408
            SKPKSFQHVFKGNTNDFFVLGMKFTRK ++LYSNFYQSDVIVCSPLG+QLI+ENTDKKK
Sbjct: 353 TSKPKSFQHVFKGNTNDFFVLGMKFTRKTLKLYSNFYQSDVIVCSPLGIQLILENTDKKK 412

Query: 409 RQDDFLSSIEVMVLDQLHSIEFQNIAHVSNIFAHINKIPQQQRDADFSRIRMWYIEDQAK 468
           RQDDFLSSIE++V+DQLHS+EFQN AHV +IF HINKIPQ+Q D+DFSRIRMWYI DQA+
Sbjct: 413 RQDDFLSSIEMLVVDQLHSLEFQNPAHVLSIFQHINKIPQKQHDSDFSRIRMWYINDQAR 472

Query: 469 LFRQTMVFTRYISPFANALLNRKCANWAGRVKSHRVVSAEKSVIGQLGLKLRQIFQRFEV 528
           LFRQT++FT+Y+SPFAN+L+N KC NW+GR K+ R +S EKS I QLGLK+RQ+F RF++
Sbjct: 473 LFRQTLIFTKYVSPFANSLINGKCCNWSGRFKNRRYISPEKSAINQLGLKVRQVFHRFDL 532

Query: 529 LGGSTVDEPDFRFKFFTSVVVPGIEKTTGYDSGILLYIPEYTDFIRVRNYLKDKTRILFG 588
             GS+VDEPD+RFKFFTSV VP I+K+TGY+ GILLYIP+YTDF+RVRNY KD+TRILFG
Sbjct: 533 FTGSSVDEPDYRFKFFTSVTVPIIQKSTGYEDGILLYIPDYTDFLRVRNYFKDQTRILFG 592

Query: 589 DINEYSDQRQLTSNRALFQLGRIKVLLYTERLHHFRRFELKGVKSVILYKPPSNPEFYQE 648
           +I EYSDQRQ+TSNRALFQ G++KVLLYTERLHHFRR+++KGVKSVI YKPPSNPEFYQE
Sbjct: 593 EITEYSDQRQVTSNRALFQQGKVKVLLYTERLHHFRRYQIKGVKSVIFYKPPSNPEFYQE 652

Query: 649 LLRYIGKSAFLGVADLNIATVRCLYSKMDSLALERIVGTKRAAVLTHGQNEVYEFK 704
           L+R IGK+AFLG ADLNI+TVRC Y K+DSL+LERIVG+KRAAVLT  QNE+YEFK
Sbjct: 653 LIRCIGKNAFLGNADLNISTVRCTYCKLDSLSLERIVGSKRAAVLTRSQNEIYEFK 708

>SAKL0E07546g Chr5 (610979..613135) [2157 bp, 718 aa] {ON} similar
           to uniprot|P40498 Saccharomyces cerevisiae YIL091C
           Protein required for cell viability
          Length = 718

 Score =  825 bits (2132), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/704 (58%), Positives = 519/704 (73%), Gaps = 19/704 (2%)

Query: 13  KRGRKQLRNITRIGRAIHVQE--DEAKSREEHTVEEAQAGEQTSNRKRGNHPAEDDGGAR 70
           K GRK+LR ITR   A H  E  D+ ++  + + EE +  +   N+ R +   E+D   +
Sbjct: 22  KTGRKELRTITR-ANARHANESKDDFENEPDMSSEEEELAD---NKPRSDEEEEEDIETK 77

Query: 71  ESQSYGALLTLLSAEHGKQRKKRLRKXXXXXX------XXXXXXXXXXXXITAALXXXXX 124
           + + Y ALLTLL +EH  ++ K+ R+                        I  AL     
Sbjct: 78  KQKVYNALLTLLESEHPHKKSKKNREGGKEKQGNLQEGVETYSDEDEEEAIENALVETND 137

Query: 125 XXXXXXXXXXXXXXXXXXQDHFDVHFNRVSAADVAQLDAAFKNGRAQYRVQKEARGEEEI 184
                              D F++HFN VS     +L +AF++ + +Y+  K    E+E 
Sbjct: 138 DEDDVGSDINGDEDDEDKADSFELHFNNVSELQATKLASAFRDKKIRYKSVKVPVNEDEF 197

Query: 185 -LYSKPVASSEGTEGP-VRVPA--RSLRGYAIKQRLRMHNGLTADDPEKPLTPQQKVLLD 240
            +YS+P    EG +G  V  P+  +SL  Y IKQ+L++ N L  DD ++ L P QK L+D
Sbjct: 198 FIYSRPTV--EGEDGSSVVAPSCKKSLHSYFIKQKLKIQNNL-LDDKKEALAPLQKNLVD 254

Query: 241 PMFQYQDIXXXXXXXXXXXXXXXXXXXHILNHVYKTRDRILKNNQKLQDNPDQELLDQGF 300
           PMFQYQD+                   H+LNHVYKTRDRIL+N+QKLQDN DQELLDQGF
Sbjct: 255 PMFQYQDLLYEYRSYEQEEEYRDLYALHVLNHVYKTRDRILRNSQKLQDNSDQELLDQGF 314

Query: 301 TRPKALVVVPTRATAYDVVDLLLQQSGIEQVDKKSKFKDQFYDPSLPPASKPKSFQHVFK 360
           TRPK L+VVPTR  AY +V  ++++SG++QVDK+ KF+DQF+D SLPP+SKPKSF+H+FK
Sbjct: 315 TRPKVLIVVPTRDVAYQIVTKIIEKSGLDQVDKRGKFQDQFFDASLPPSSKPKSFKHIFK 374

Query: 361 GNTNDFFVLGMKFTRKAIRLYSNFYQSDVIVCSPLGLQLIIENTDKKKRQDDFLSSIEVM 420
           GNTNDFFVLG KFTRK ++LYSNFYQSDVI CSPLG+QLI+ENTDKKKRQDDFLSSIE+M
Sbjct: 375 GNTNDFFVLGAKFTRKTLKLYSNFYQSDVIFCSPLGIQLILENTDKKKRQDDFLSSIELM 434

Query: 421 VLDQLHSIEFQNIAHVSNIFAHINKIPQQQRDADFSRIRMWYIEDQAKLFRQTMVFTRYI 480
           V+DQLHSIE+QN++H++ IF HINKIPQQQ DADFSRIRMWYI +QA LFRQTMVFT+Y 
Sbjct: 435 VIDQLHSIEYQNLSHITTIFQHINKIPQQQHDADFSRIRMWYINEQATLFRQTMVFTKYA 494

Query: 481 SPFANALLNRKCANWAGRVKSHRVVSAEKSVIGQLGLKLRQIFQRFEVLGGSTVDEPDFR 540
           SPFAN+L+N KC N AGR K+H +V  EKS I QLGLK+RQIFQRF+++GGS +DEPD+R
Sbjct: 495 SPFANSLINGKCRNHAGRWKNHNIVLPEKSSINQLGLKVRQIFQRFDLVGGSAMDEPDYR 554

Query: 541 FKFFTSVVVPGIEKTTGYDSGILLYIPEYTDFIRVRNYLKDKTRILFGDINEYSDQRQLT 600
           FKFFTSV++  I K+TGY+ GILLYIP+YTD++RVRN+L++KT +LFGDINEYS+Q+QLT
Sbjct: 555 FKFFTSVIIASIIKSTGYEDGILLYIPDYTDYVRVRNHLREKTTLLFGDINEYSEQKQLT 614

Query: 601 SNRALFQLGRIKVLLYTERLHHFRRFELKGVKSVILYKPPSNPEFYQELLRYIGKSAFLG 660
           SNRALFQ G++KVLLYTERLHHFRR+E+KGVKSVI YKPP+NPEFY+E++RYIGKSAFLG
Sbjct: 615 SNRALFQQGKVKVLLYTERLHHFRRYEIKGVKSVIFYKPPTNPEFYREVVRYIGKSAFLG 674

Query: 661 VADLNIATVRCLYSKMDSLALERIVGTKRAAVLTHGQNEVYEFK 704
            ADLNI+TVRC+Y K+D L+LER+VGTKRAAVLTHGQNE+YEFK
Sbjct: 675 SADLNISTVRCVYCKLDGLSLERVVGTKRAAVLTHGQNEIYEFK 718

>KAFR0J01340 Chr10 (245485..247671) [2187 bp, 728 aa] {ON} Anc_2.292
           YIL091C
          Length = 728

 Score =  818 bits (2112), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/719 (57%), Positives = 509/719 (70%), Gaps = 33/719 (4%)

Query: 13  KRGRKQLRNITRIG-----------RAIHVQEDEAKSREEHTVEEAQAGEQTSNRKRGNH 61
           KRGRK+LRNI R G             I V E+  +  EE +   A  G+   + + G+ 
Sbjct: 16  KRGRKELRNIRRAGGRKPRDAQENGNGISVSENTGEVEEEPS--SAANGDDVGD-EVGDE 72

Query: 62  PAEDDGGARESQSYGALLTLLSAEHGKQRKKR--------LRKXXXXXXXXXXXXXXXXX 113
            A DD    + Q YGALLT+L +EH + +K++        L                   
Sbjct: 73  -ASDDEEEMKKQVYGALLTILKSEHPEPKKQKKEKVNKVLLDNEQQDESDASEEEEDETQ 131

Query: 114 XITAALXXXXXXXXXXXXXXX---XXXXXXXXQDHFDVHFNRVSAADVAQLDAAFKNGRA 170
            I  AL                          QD F+ HFN V      +LD +FKN   
Sbjct: 132 QIENALMGSHADDASEDDDKEHGDDNEESDEEQDPFETHFNSVDEKFTDKLDVSFKNNDI 191

Query: 171 QYRVQKEARGEEE-ILYSKPVASSEGTEGPVR--VPARSLRGYAIKQRLRMHNGLTADDP 227
           +Y+  K    E+E  ++SKPV  S+  E PV   V   S+  Y +KQRL+M N L   DP
Sbjct: 192 KYKSTKLPISEDEYAIFSKPVIKSDEIESPVELSVNKSSIHSYFLKQRLKMQNNLM--DP 249

Query: 228 E-KPLTPQQKVLLDPMFQYQDIXXXXXXX-XXXXXXXXXXXXHILNHVYKTRDRILKNNQ 285
           +  PLTP QK L+DPMFQY+DI                    H+LNH+YKTRD+ILKNNQ
Sbjct: 250 KVDPLTPLQKQLVDPMFQYKDILYQYDSYGKDEDEYRDLYSLHVLNHLYKTRDKILKNNQ 309

Query: 286 KLQDNPDQELLDQGFTRPKALVVVPTRATAYDVVDLLLQQSGIEQVDKKSKFKDQFYDPS 345
           +LQDN D E LDQGFTRPK L+VVPTR TAY V++ ++ +SGI+QVDKK KFKDQF++ S
Sbjct: 310 RLQDNNDTECLDQGFTRPKVLIVVPTRDTAYQVIEKIIAKSGIDQVDKKGKFKDQFFEDS 369

Query: 346 LPPASKPKSFQHVFKGNTNDFFVLGMKFTRKAIRLYSNFYQSDVIVCSPLGLQLIIENTD 405
           LPP+SKPKSFQ +FKGNTNDFFVLG+KFTRKAI+LYSNFYQSD+I+CSPLG+Q+I+ENTD
Sbjct: 370 LPPSSKPKSFQDIFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIICSPLGIQMILENTD 429

Query: 406 KKKRQDDFLSSIEVMVLDQLHSIEFQNIAHVSNIFAHINKIPQQQRDADFSRIRMWYIED 465
           KKKRQDDFLSSIE+M++DQLHSIE+QNI+H+  I  HINKIPQ+Q DADFSR+RMWYI D
Sbjct: 430 KKKRQDDFLSSIELMIIDQLHSIEYQNISHLFTICNHINKIPQEQHDADFSRVRMWYIND 489

Query: 466 QAKLFRQTMVFTRYISPFANALLNRKCANWAGRVKSHRVVSAEKSVIGQLGLKLRQIFQR 525
           QAKLFRQTM+FT+YISP AN+LLN KC NW+GR K+H+V+S   S I ++G+K+RQIFQR
Sbjct: 490 QAKLFRQTMLFTKYISPMANSLLNGKCQNWSGRWKNHKVISTNSSSISKVGIKIRQIFQR 549

Query: 526 FEVLGGSTVDEPDFRFKFFTSVVVPGIEKTTGYDSGILLYIPEYTDFIRVRNYLKDKTRI 585
           FE + GS VDEPD+RFKFFTSV VP I KTTGY+ G L+YIPEYTD+IRVRNYLKDKT I
Sbjct: 550 FETVNGSVVDEPDYRFKFFTSVTVPNIVKTTGYEDGTLIYIPEYTDYIRVRNYLKDKTTI 609

Query: 586 LFGDINEYSDQRQLTSNRALFQLGRIKVLLYTERLHHFRRFELKGVKSVILYKPPSNPEF 645
           LFGDINEYSDQ+QL SNR+LFQ GR+KVLLYTERLHH+RR+E+KGVK+V+ Y+PP NPEF
Sbjct: 610 LFGDINEYSDQKQLNSNRSLFQQGRVKVLLYTERLHHYRRYEIKGVKNVVFYQPPKNPEF 669

Query: 646 YQELLRYIGKSAFLGVADLNIATVRCLYSKMDSLALERIVGTKRAAVLTHGQNEVYEFK 704
           Y E++RYIGK+AFLG  DLNI+TVRCLYSK+D+L+LE IVG+KRA VL H QNEVYEFK
Sbjct: 670 YTEVVRYIGKNAFLGNTDLNISTVRCLYSKLDALSLENIVGSKRAGVLCHAQNEVYEFK 728

>KNAG0A05400 Chr1 (795728..797893) [2166 bp, 721 aa] {ON} Anc_2.292
           YIL091C
          Length = 721

 Score =  802 bits (2072), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/720 (55%), Positives = 506/720 (70%), Gaps = 31/720 (4%)

Query: 12  GKRGRKQLRNITRIGR--AIHVQEDEAKSREEHTVEEAQAGEQTSNRKRGNHPAEDDGGA 69
           GKRGRK+LR++ R  +  AI     E+   E+  V  A      S+       ++ D  A
Sbjct: 6   GKRGRKELRHLKRTTKRPAIDDPPRESAPVEDDFVGPADQMVNVSDSAEDGDGSDSDAEA 65

Query: 70  RESQSYGALLTLLSAEHGKQRKKRLRKXXX----------XXXXXXXXXXXXXXXITAAL 119
           R+ + YGALLT+L +EH + +K++ +K                            I  A+
Sbjct: 66  RKGKVYGALLTILKSEHPEAKKRKTKKSSDGGEVDKILVHDDNHEELEEENEEEQIDNAI 125

Query: 120 XXXXXXXXXXXXXXXXXXX--XXXXQDHFDVHFNRVSAADVAQLDAAFKNGRAQYRVQKE 177
                                    QD F+ HFN+    ++  LDAAFK+ + QYR  K 
Sbjct: 126 LDNRTQSDSEDEQDVAAEEFDSEDEQDPFESHFNQFPETEINTLDAAFKSKQLQYRSVKL 185

Query: 178 ARG------EEEILYSKPVA------SSEGTEGPVRVPARSLRGYAIKQRLRMHNGLTAD 225
                    +E ++YS+P        S +  E   +    S+  Y +K+RL++ N L  +
Sbjct: 186 QPAKVTKVKDEYLIYSEPTVPGGKQLSKKLIESNTKC---SIGSYFLKKRLKIQNDLLEN 242

Query: 226 DPEKPLTPQQKVLLDPMFQYQDIXXXXXXX-XXXXXXXXXXXXHILNHVYKTRDRILKNN 284
            P+  L   QK L+DPMFQY+DI                    H LNHVYKTRDRILKNN
Sbjct: 243 KPDN-LASIQKELVDPMFQYKDILYEYENYGKSEDEYRQLYALHALNHVYKTRDRILKNN 301

Query: 285 QKLQDNPDQELLDQGFTRPKALVVVPTRATAYDVVDLLLQQSGIEQVDKKSKFKDQFYDP 344
           Q+LQ+N D E LDQGFTRPK L++ PTR TAY +V  ++ +SGI+QVDK+ KFKDQFY+ 
Sbjct: 302 QRLQENSDTECLDQGFTRPKVLIIAPTRDTAYSIVTTIINKSGIDQVDKRGKFKDQFYED 361

Query: 345 SLPPASKPKSFQHVFKGNTNDFFVLGMKFTRKAIRLYSNFYQSDVIVCSPLGLQLIIENT 404
           SLPP+SKPKSFQ +FKGNTNDFFVLGMKFTRKAI+LYSNFYQSD+IVCSPLGLQ+I+ENT
Sbjct: 362 SLPPSSKPKSFQSIFKGNTNDFFVLGMKFTRKAIKLYSNFYQSDIIVCSPLGLQMIVENT 421

Query: 405 DKKKRQDDFLSSIEVMVLDQLHSIEFQNIAHVSNIFAHINKIPQQQRDADFSRIRMWYIE 464
           DKKKRQDDFLSSIE+ ++DQLHSIE+QNI+H+  IF H+N IP +Q DADFSRIRMWYI 
Sbjct: 422 DKKKRQDDFLSSIEITIIDQLHSIEYQNISHLYTIFEHLNNIPDEQHDADFSRIRMWYIN 481

Query: 465 DQAKLFRQTMVFTRYISPFANALLNRKCANWAGRVKSHRVVSAEKSVIGQLGLKLRQIFQ 524
           DQA+ FRQTMVFT+YISP AN+++N KC NW+GR K+HR+VS E S IG+L L++RQIFQ
Sbjct: 482 DQARFFRQTMVFTKYISPTANSIINGKCRNWSGRWKNHRIVSNEASHIGKLSLRVRQIFQ 541

Query: 525 RFEVLGGSTVDEPDFRFKFFTSVVVPGIEKTTGYDSGILLYIPEYTDFIRVRNYLKDKTR 584
           RFEV GGS VDEPD+RFKFFTSV++PGI K+TGY+ GIL+YIPEYTD++RVRNYLK+KTR
Sbjct: 542 RFEVTGGSIVDEPDYRFKFFTSVIIPGILKSTGYEDGILIYIPEYTDYVRVRNYLKEKTR 601

Query: 585 ILFGDINEYSDQRQLTSNRALFQLGRIKVLLYTERLHHFRRFELKGVKSVILYKPPSNPE 644
           ILFGDINEYS Q+QLT+NR+LFQ GR+KVLLYTERLHH+RR+E+KGVKSVI YKPPS+PE
Sbjct: 602 ILFGDINEYSSQKQLTANRSLFQQGRLKVLLYTERLHHYRRYEIKGVKSVIFYKPPSDPE 661

Query: 645 FYQELLRYIGKSAFLGVADLNIATVRCLYSKMDSLALERIVGTKRAAVLTHGQNEVYEFK 704
           FY E++R IG++AFLG  DLNI+TVRC+YSK+D+LALE +VGT+RA VL HGQNE+YEFK
Sbjct: 662 FYTEVVRNIGRNAFLGNTDLNISTVRCIYSKLDALALENVVGTQRAGVLCHGQNEIYEFK 721

>YIL091C Chr9 complement(191030..193195) [2166 bp, 721 aa] {ON}
           UTP25Nucleolar protein required for 35S pre-RNA
           processing and 40S ribosomal subunit biogenesis
          Length = 721

 Score =  796 bits (2055), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/713 (56%), Positives = 504/713 (70%), Gaps = 30/713 (4%)

Query: 13  KRGRKQLRNITRI-----GRAIHVQEDEAKSREEHTVEEAQAGEQTSNRKRGNHPAEDDG 67
           KRGR++LR I R      G +    ED A+  + H  +E +  +  S     +   ED+ 
Sbjct: 18  KRGRQELRKIKRSSARTEGGSTETLEDVAEDID-HRSDEDEVSDVDSG---DDFDIEDEE 73

Query: 68  GARESQSYGALLTLLSAEHGKQRKKRLRKXXXXXXXXXXXXXXXXXXI------------ 115
           G +E + Y ALLT+L +EH  + K+R R+                               
Sbjct: 74  GKKE-KVYDALLTILKSEH-PEPKRRRREADESNKAPAEVGEDEHENTEHGPVDDQLEIE 131

Query: 116 TAALXXXXXXXXXXXXXXXXXXXXXXXQDHFDVHFNRVSAADVAQLDAAFKNGRAQYR-V 174
              L                       QD F+ HFN+V    V +L  AFK    +Y+ V
Sbjct: 132 NGLLGNHEDDNDDDSSGDEKDIDSEDEQDPFESHFNQVPEKFVDKLSNAFKTKSVKYKSV 191

Query: 175 QKEARGEEEILYSKPVASSEGTEGPVRVPARS--LRGYAIKQRLRMHNGLTADDPEKPLT 232
           +      E  +Y+KPV    G E  V  P RS  +  Y +KQRL++ NGL  D    PLT
Sbjct: 192 KGSLSDSESYIYAKPVVI--GEEALVESPYRSSSIYSYFLKQRLKVQNGL-LDKKTDPLT 248

Query: 233 PQQKVLLDPMFQYQDIXXXXXXXXXXXXXXXXXXX-HILNHVYKTRDRILKNNQKLQDNP 291
             QK L+DPMFQY+DI                    H+LNH+YKTRDRILKNNQ+LQDNP
Sbjct: 249 ALQKKLVDPMFQYKDILYEYDSYEKDEDEYRDLYALHVLNHIYKTRDRILKNNQRLQDNP 308

Query: 292 DQELLDQGFTRPKALVVVPTRATAYDVVDLLLQQSGIEQVDKKSKFKDQFYDPSLPPASK 351
           D E LDQGFTRPK L+VVPTR  AY VVD ++ +SGI+QVDKK KF DQF D SLPP SK
Sbjct: 309 DTEHLDQGFTRPKVLIVVPTREVAYRVVDKIISKSGIDQVDKKGKFYDQFRDDSLPPKSK 368

Query: 352 PKSFQHVFKGNTNDFFVLGMKFTRKAIRLYSNFYQSDVIVCSPLGLQLIIENTDKKKRQD 411
           PKSFQH+F+GNTNDFFV+G+KFTRKAI+LYSNFYQSD+IVCSPLG+Q+I+ENTDKKKRQD
Sbjct: 369 PKSFQHIFRGNTNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMILENTDKKKRQD 428

Query: 412 DFLSSIEVMVLDQLHSIEFQNIAHVSNIFAHINKIPQQQRDADFSRIRMWYIEDQAKLFR 471
           DFLSSIE+MV+DQLHSIE+QNI+H+  IF H+NKIP QQ +ADFSRIRMWYI +QAKLFR
Sbjct: 429 DFLSSIELMVIDQLHSIEYQNISHIFTIFDHLNKIPDQQHEADFSRIRMWYINEQAKLFR 488

Query: 472 QTMVFTRYISPFANALLNRKCANWAGRVKSHRVVSAEKSVIGQLGLKLRQIFQRFEVLGG 531
           QTMVFT+YISP AN+L+N +C N AGR K+H+V+ +E S IGQ GLK+RQIFQRF+++G 
Sbjct: 489 QTMVFTKYISPAANSLINGRCRNMAGRWKNHKVIGSENSSIGQSGLKIRQIFQRFDIIGN 548

Query: 532 STVDEPDFRFKFFTSVVVPGIEKTTGYDSGILLYIPEYTDFIRVRNYLKDKTRILFGDIN 591
           S ++EPD+RFKFFTSV++PGI K+TGY+ GIL+YIP+YTDFIR+RNY+K+KT ILFGDIN
Sbjct: 549 SIIEEPDYRFKFFTSVIIPGIVKSTGYEDGILIYIPDYTDFIRIRNYMKEKTTILFGDIN 608

Query: 592 EYSDQRQLTSNRALFQLGRIKVLLYTERLHHFRRFELKGVKSVILYKPPSNPEFYQELLR 651
           EYS QRQL +NR+LFQ GR+KV+LYTERLHH+RR+E+KGVKSV+ YKPP+NPEFY E++R
Sbjct: 609 EYSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKGVKSVVFYKPPNNPEFYNEVVR 668

Query: 652 YIGKSAFLGVADLNIATVRCLYSKMDSLALERIVGTKRAAVLTHGQNEVYEFK 704
           +IGK+AFLG  DLNI+TVRC+YSK+D L+LERIVGTKRAAVL+H Q E+YEFK
Sbjct: 669 FIGKNAFLGNTDLNISTVRCIYSKLDGLSLERIVGTKRAAVLSHAQKEIYEFK 721

>Suva_9.108 Chr9 complement(185226..187394) [2169 bp, 722 aa] {ON}
           YIL091C (REAL)
          Length = 722

 Score =  793 bits (2048), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/566 (66%), Positives = 458/566 (80%), Gaps = 7/566 (1%)

Query: 143 QDHFDVHFNRVSAADVAQLDAAFKNGRAQYRVQKEARGEEE-ILYSKPVASSEGTEGPVR 201
           QD F+ HFN+VS   V  +  AFK    +Y+  K   G++E  +YSKPV +  G E PV 
Sbjct: 160 QDPFESHFNQVSEKYVDDVSNAFKANNIKYKSVKSPLGDDESCIYSKPVVN--GDETPVE 217

Query: 202 VP--ARSLRGYAIKQRLRMHNGLTADDPEKPLTPQQKVLLDPMFQYQDIXXXXXXXXXXX 259
            P  + S+  Y +KQRL++ NGL  D    PLT  QK L+DPMFQY+DI           
Sbjct: 218 RPYKSSSIYSYFLKQRLKIQNGL-LDKKIDPLTSLQKKLVDPMFQYKDILYEYDSYEKDE 276

Query: 260 XXXXXXXX-HILNHVYKTRDRILKNNQKLQDNPDQELLDQGFTRPKALVVVPTRATAYDV 318
                    H LNH+YKTRDRILKNNQ+LQDNPD E LDQGFTRPK L+VVPTR  AY V
Sbjct: 277 DEYRDLYTLHALNHIYKTRDRILKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTRDAAYHV 336

Query: 319 VDLLLQQSGIEQVDKKSKFKDQFYDPSLPPASKPKSFQHVFKGNTNDFFVLGMKFTRKAI 378
           VD ++++SGI+QVDKK KF DQF D SLPP+SKPKSFQH+F+GNT+DFFV+G+KFTRKAI
Sbjct: 337 VDKIIKKSGIDQVDKKGKFYDQFRDDSLPPSSKPKSFQHIFRGNTSDFFVVGLKFTRKAI 396

Query: 379 RLYSNFYQSDVIVCSPLGLQLIIENTDKKKRQDDFLSSIEVMVLDQLHSIEFQNIAHVSN 438
           +LYSNFYQSD+IVCSPLG+Q+I+ENTDKKKRQDDFLSSIE+MV+DQLHSIE+QNI+H+  
Sbjct: 397 KLYSNFYQSDIIVCSPLGIQMILENTDKKKRQDDFLSSIELMVIDQLHSIEYQNISHIFT 456

Query: 439 IFAHINKIPQQQRDADFSRIRMWYIEDQAKLFRQTMVFTRYISPFANALLNRKCANWAGR 498
           IF HINKIP QQ +ADFSRIRMWYI +QAKL RQTMVFT+YISP AN+L+N +C N AGR
Sbjct: 457 IFDHINKIPDQQHEADFSRIRMWYINEQAKLLRQTMVFTKYISPAANSLINGRCRNLAGR 516

Query: 499 VKSHRVVSAEKSVIGQLGLKLRQIFQRFEVLGGSTVDEPDFRFKFFTSVVVPGIEKTTGY 558
            K+H+V+ +E S IGQLGLK+RQIFQRF+++G S ++EPD+RFKFFTSV++P I K+TGY
Sbjct: 517 WKNHKVIESETSSIGQLGLKIRQIFQRFDIIGNSIIEEPDYRFKFFTSVIIPSIVKSTGY 576

Query: 559 DSGILLYIPEYTDFIRVRNYLKDKTRILFGDINEYSDQRQLTSNRALFQLGRIKVLLYTE 618
           + GIL+YIP+YTDFIR+RNY+K+KT ILFGDINEYS Q+QL +NR+LFQ GR+KVLLYTE
Sbjct: 577 EDGILIYIPDYTDFIRIRNYMKEKTTILFGDINEYSSQKQLNANRSLFQQGRVKVLLYTE 636

Query: 619 RLHHFRRFELKGVKSVILYKPPSNPEFYQELLRYIGKSAFLGVADLNIATVRCLYSKMDS 678
           RLHH+RR+E+KGVK+VI YKPP+NPEFY E +RYIGK+AFLG  DLNI+TVRC+YSK+D 
Sbjct: 637 RLHHYRRYEIKGVKNVIFYKPPNNPEFYNETVRYIGKNAFLGNTDLNISTVRCVYSKLDG 696

Query: 679 LALERIVGTKRAAVLTHGQNEVYEFK 704
           L+LERIVGTKRA VL+H Q EVYEFK
Sbjct: 697 LSLERIVGTKRAGVLSHAQKEVYEFK 722

 Score = 36.2 bits (82), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 47/96 (48%), Gaps = 7/96 (7%)

Query: 4   TDSHGIMDGKRGRKQLRNITRIG--RAIHVQEDEAKSREEHTVEEAQAGEQTSNRKRGNH 61
            D H     KRGR+++R I R    R   V  +E     E +VE  +A +  S+   G+ 
Sbjct: 9   NDEHFRGHRKRGRQEMRKIKRTTARRTEDVDTNEVDHVAEESVE-TKAEDAISDA--GSE 65

Query: 62  PAEDDGGARESQS--YGALLTLLSAEHGKQRKKRLR 95
              D G   E Q   Y ALLT+L +EH + ++K+ +
Sbjct: 66  SDLDIGDEEEKQEKVYDALLTILKSEHPEPKRKKTK 101

>Kwal_27.11503 s27 (828115..830298) [2184 bp, 727 aa] {ON} YIL091C -
           Protein required for cell viability [contig 27] FULL
          Length = 727

 Score =  793 bits (2049), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/564 (66%), Positives = 456/564 (80%), Gaps = 6/564 (1%)

Query: 144 DHFDVHFNRVSAADVAQLDAAFKNGRAQYRVQK-EARGEEEILYSKPVASSEGTEGPVRV 202
           D  + HFN V   D   LD AFK  + +YR  K +    EE +YS+P  + E +  P++V
Sbjct: 167 DPLEAHFNSVPEKDTDALDQAFKTKQVRYRSSKIKISKNEEFIYSRPDLNLE-SRTPIQV 225

Query: 203 P--ARSLRGYAIKQRLRMHNGLTADDPEKPLTPQQKVLLDPMFQYQDIXXXXXXXXXXXX 260
           P   +SL  Y IKQRL++ N L   D +  LTP QK ++DP+FQYQD+            
Sbjct: 226 PQGTQSLSPYFIKQRLKIQNDLL--DSKNNLTPLQKKIVDPIFQYQDLLYEYENYDQETE 283

Query: 261 XXXXXXXHILNHVYKTRDRILKNNQKLQDNPDQELLDQGFTRPKALVVVPTRATAYDVVD 320
                  H L+H+YKTRDRILKNNQ+LQDNPDQE+LDQGFTRPK L+VVPTR  AY V+ 
Sbjct: 284 YRDLYALHALDHIYKTRDRILKNNQRLQDNPDQEVLDQGFTRPKVLIVVPTRDVAYSVLS 343

Query: 321 LLLQQSGIEQVDKKSKFKDQFYDPSLPPASKPKSFQHVFKGNTNDFFVLGMKFTRKAIRL 380
            ++++SG++QVDKKSKF+DQFY  SLPP  KPKSFQ VFKGNTNDFFVLG KFTRK I+L
Sbjct: 344 KIIEKSGLDQVDKKSKFRDQFYQDSLPPKYKPKSFQQVFKGNTNDFFVLGAKFTRKTIKL 403

Query: 381 YSNFYQSDVIVCSPLGLQLIIENTDKKKRQDDFLSSIEVMVLDQLHSIEFQNIAHVSNIF 440
           YSNFYQSD+IVCSPLG+QLI+ENTDKKKRQDDFLSSIE++V+DQLHSIEFQN+ H+++IF
Sbjct: 404 YSNFYQSDIIVCSPLGIQLILENTDKKKRQDDFLSSIELLVIDQLHSIEFQNVLHLTSIF 463

Query: 441 AHINKIPQQQRDADFSRIRMWYIEDQAKLFRQTMVFTRYISPFANALLNRKCANWAGRVK 500
            HINKIPQQQ DADFSRI+MWYI DQAKLFRQT++FTR+ +PFAN+L+N KC N+AGR K
Sbjct: 464 EHINKIPQQQHDADFSRIKMWYINDQAKLFRQTLIFTRHSTPFANSLINGKCRNYAGRWK 523

Query: 501 SHRVVSAEKSVIGQLGLKLRQIFQRFEVLGGSTVDEPDFRFKFFTSVVVPGIEKTTGYDS 560
           +H +V AEKS + QLG++ R +FQRF+V GG+  DEPDFRFK F SV+VP I ++TGY+ 
Sbjct: 524 NHTIVGAEKSSLSQLGMRTRLVFQRFDVAGGAATDEPDFRFKHFCSVIVPNIVQSTGYED 583

Query: 561 GILLYIPEYTDFIRVRNYLKDKTRILFGDINEYSDQRQLTSNRALFQLGRIKVLLYTERL 620
           GILLYIP+YTDFIRVRNYL++KT ILFGDI+EYS+QRQLT+NRALFQ GR+KVLLYTERL
Sbjct: 584 GILLYIPDYTDFIRVRNYLREKTTILFGDISEYSEQRQLTANRALFQQGRVKVLLYTERL 643

Query: 621 HHFRRFELKGVKSVILYKPPSNPEFYQELLRYIGKSAFLGVADLNIATVRCLYSKMDSLA 680
           HHFRR+E+KGVK+VI YKPP+NPEF++E +RY+ KSAFLGVADLNI+ VRCLYSK+D LA
Sbjct: 644 HHFRRYEIKGVKTVIFYKPPTNPEFFEETVRYLAKSAFLGVADLNISVVRCLYSKLDGLA 703

Query: 681 LERIVGTKRAAVLTHGQNEVYEFK 704
           LERIVGT+RAA+LTHG NE YEFK
Sbjct: 704 LERIVGTERAAILTHGPNETYEFK 727

 Score = 39.3 bits (90), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 44/91 (48%), Gaps = 12/91 (13%)

Query: 7  HGIMDGKR----GRKQLRNITRIGRAIHVQ-EDEAKSREEHTVEEAQAGEQTSNRKRGNH 61
          H   DG++    GRKQLR+I +  R    + EDE     E  + E +   +   R   + 
Sbjct: 11 HDRHDGEKFTKGGRKQLRSIRKASRYDSKKPEDEPVETPEEEINEVEDVHE--ERTEVSR 68

Query: 62 PAEDDGGARESQSYGALLTLLSAEHGKQRKK 92
            E +G A     Y ALLTLL AEHG  +KK
Sbjct: 69 KQESNGEA-----YAALLTLLKAEHGTGKKK 94

>KLTH0G10494g Chr7 complement(885735..887978) [2244 bp, 747 aa] {ON}
           similar to uniprot|P40498 Saccharomyces cerevisiae
           YIL091C Protein required for cell viability
          Length = 747

 Score =  793 bits (2049), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/564 (65%), Positives = 456/564 (80%), Gaps = 6/564 (1%)

Query: 144 DHFDVHFNRVSAADVAQLDAAFKNGRAQYRVQK-EARGEEEILYSKPVASSEGTEGPVRV 202
           D  ++HFN VS  D   LDAAFK    +YR  K      +E +YS+P   +E     V  
Sbjct: 187 DTLEIHFNSVSEKDTNALDAAFKAKEVRYRSCKLHVDKNQEFIYSRPTLVNEPASA-VSA 245

Query: 203 P--ARSLRGYAIKQRLRMHNGLTADDPEKPLTPQQKVLLDPMFQYQDIXXXXXXXXXXXX 260
           P  ++SL  Y IKQRL++ N L   D +  LTP QK ++DPMFQYQD+            
Sbjct: 246 PDGSQSLNSYFIKQRLKIQNDLL--DSQDKLTPLQKQIVDPMFQYQDLLYEYEDYDKETE 303

Query: 261 XXXXXXXHILNHVYKTRDRILKNNQKLQDNPDQELLDQGFTRPKALVVVPTRATAYDVVD 320
                  H+LNH+YKTRDRILKNNQ+LQ+NPDQELLDQGFTRPK L+V PTR  AYD++ 
Sbjct: 304 YRDLYALHVLNHIYKTRDRILKNNQRLQENPDQELLDQGFTRPKVLIVAPTRDAAYDILS 363

Query: 321 LLLQQSGIEQVDKKSKFKDQFYDPSLPPASKPKSFQHVFKGNTNDFFVLGMKFTRKAIRL 380
            ++Q+SG++QVDKK+KFKDQF+  +LPP+ KPKSFQ +FKGNTNDFFVLG KFTRK I+L
Sbjct: 364 KIIQKSGLDQVDKKAKFKDQFFQEALPPSYKPKSFQQLFKGNTNDFFVLGAKFTRKTIKL 423

Query: 381 YSNFYQSDVIVCSPLGLQLIIENTDKKKRQDDFLSSIEVMVLDQLHSIEFQNIAHVSNIF 440
           YSNFYQSD+I+CSPLG+QLI+ENTDKKKRQDDFLSSIE++V+DQLHSIEFQN+ H+++IF
Sbjct: 424 YSNFYQSDIIICSPLGIQLILENTDKKKRQDDFLSSIELLVVDQLHSIEFQNMLHLTSIF 483

Query: 441 AHINKIPQQQRDADFSRIRMWYIEDQAKLFRQTMVFTRYISPFANALLNRKCANWAGRVK 500
            HINKIPQQQ DADFSRI+MWYI DQAKLFRQT++FT++ SPFAN+L+N KC N+AGR K
Sbjct: 484 EHINKIPQQQHDADFSRIKMWYINDQAKLFRQTLIFTKFSSPFANSLINGKCRNYAGRWK 543

Query: 501 SHRVVSAEKSVIGQLGLKLRQIFQRFEVLGGSTVDEPDFRFKFFTSVVVPGIEKTTGYDS 560
           +HRV+  E S +GQLG++ R IFQRF+++G S  +EPD RFK F SV+VP I K+TGY+ 
Sbjct: 544 NHRVIFPENSSLGQLGMRTRLIFQRFDLVGKSVSEEPDSRFKHFCSVIVPNIVKSTGYED 603

Query: 561 GILLYIPEYTDFIRVRNYLKDKTRILFGDINEYSDQRQLTSNRALFQLGRIKVLLYTERL 620
           GILLYIP+YTDF+RVRNYL++KT ILFGDINEYS+QRQLTSNRA+FQ GR+KVLLYTERL
Sbjct: 604 GILLYIPDYTDFVRVRNYLREKTTILFGDINEYSEQRQLTSNRAMFQQGRVKVLLYTERL 663

Query: 621 HHFRRFELKGVKSVILYKPPSNPEFYQELLRYIGKSAFLGVADLNIATVRCLYSKMDSLA 680
           HHFRR+E+KGVK+VI YKPP+NPEF++E+ RY+GKSAFLG+ADLNI+ VRCL+SK+D L+
Sbjct: 664 HHFRRYEIKGVKTVIFYKPPTNPEFFEEVARYLGKSAFLGLADLNISVVRCLFSKLDGLS 723

Query: 681 LERIVGTKRAAVLTHGQNEVYEFK 704
           LERIVGT+RAAVLTHG NE YEFK
Sbjct: 724 LERIVGTERAAVLTHGPNETYEFK 747

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 48/94 (51%), Gaps = 4/94 (4%)

Query: 2  GITDSHGIMDGKRGRKQLRNITRIGRAIHVQEDEAKSREEHTVEEAQAGEQTSNRKRGNH 61
           I  S+     K GRKQLR I +         +E+ + EE+   E +A ++ +  +  N 
Sbjct: 10 AIKGSNEYRSSKSGRKQLRTIRKASGPRRGLAEES-ANEENNGSETEAEDKLAAPEL-NE 67

Query: 62 PAEDDGGARESQSYGALLTLLSAEHGKQRKKRLR 95
          PA+D     E+  Y ALLTLL AEHG   +++ +
Sbjct: 68 PAQDQRAGGEA--YAALLTLLKAEHGGPARRKTK 99

>Smik_9.88 Chr9 complement(170163..172337) [2175 bp, 724 aa] {ON}
           YIL091C (REAL)
          Length = 724

 Score =  792 bits (2046), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/566 (66%), Positives = 458/566 (80%), Gaps = 7/566 (1%)

Query: 143 QDHFDVHFNRVSAADVAQLDAAFKNGRAQYRVQKEARGEEE-ILYSKPVASSEGTEGPVR 201
           QD F+ HFN+VS   V  L  AFK+   +Y+  K + G++E  +Y+KP     G E  V 
Sbjct: 162 QDPFESHFNQVSEKYVDDLSNAFKSKSIKYKSVKASLGDDESYIYAKPFMV--GEEALVE 219

Query: 202 VPARS--LRGYAIKQRLRMHNGLTADDPEKPLTPQQKVLLDPMFQYQDIXXXXXXXXXXX 259
            P RS  +  Y +KQRL++ NGL  D    PLT  QK L+DPMFQY+DI           
Sbjct: 220 SPYRSSSIYSYFLKQRLKVQNGLL-DKKIDPLTCMQKKLIDPMFQYKDILYEYDSYEKDE 278

Query: 260 XXXXXXXX-HILNHVYKTRDRILKNNQKLQDNPDQELLDQGFTRPKALVVVPTRATAYDV 318
                    H+LNH+YKTRDRILKNNQ+LQDNPD E LDQGFTRPK L+VVPTR  AY V
Sbjct: 279 SEYRDLYALHVLNHIYKTRDRILKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTREVAYRV 338

Query: 319 VDLLLQQSGIEQVDKKSKFKDQFYDPSLPPASKPKSFQHVFKGNTNDFFVLGMKFTRKAI 378
           VD ++ +SGI+QVDKK KF DQF D SLPP SKPKSFQH+FKGNT+DFFV+G+KFTRKAI
Sbjct: 339 VDKIISKSGIDQVDKKGKFYDQFRDDSLPPESKPKSFQHIFKGNTSDFFVVGLKFTRKAI 398

Query: 379 RLYSNFYQSDVIVCSPLGLQLIIENTDKKKRQDDFLSSIEVMVLDQLHSIEFQNIAHVSN 438
           +LYSNFYQSD+I+CSPLG+Q+I+ENTDKKKRQDDFLSSIE+MV+DQLHSIE+QNI+H+  
Sbjct: 399 KLYSNFYQSDIIICSPLGIQMILENTDKKKRQDDFLSSIELMVIDQLHSIEYQNISHIFT 458

Query: 439 IFAHINKIPQQQRDADFSRIRMWYIEDQAKLFRQTMVFTRYISPFANALLNRKCANWAGR 498
           IF HINKIP QQ +ADFSRIRMWYI +QAKLFRQTMVFT+YISP AN+L+N +C N AGR
Sbjct: 459 IFDHINKIPDQQHEADFSRIRMWYINEQAKLFRQTMVFTKYISPAANSLINGRCCNMAGR 518

Query: 499 VKSHRVVSAEKSVIGQLGLKLRQIFQRFEVLGGSTVDEPDFRFKFFTSVVVPGIEKTTGY 558
            K+H+V+ +E S IGQLGLK+RQIFQRF+++G S ++EPD+RFKFFTSV++P I K+ GY
Sbjct: 519 WKNHKVIGSESSSIGQLGLKVRQIFQRFDIIGNSIIEEPDYRFKFFTSVIIPSIVKSVGY 578

Query: 559 DSGILLYIPEYTDFIRVRNYLKDKTRILFGDINEYSDQRQLTSNRALFQLGRIKVLLYTE 618
           + GIL+YIP+YTDFIR+RNY+K+KT ILFGDINEYS+QRQL +NR+LFQ GR+KV+LYTE
Sbjct: 579 EDGILVYIPDYTDFIRIRNYMKEKTTILFGDINEYSNQRQLNANRSLFQQGRLKVMLYTE 638

Query: 619 RLHHFRRFELKGVKSVILYKPPSNPEFYQELLRYIGKSAFLGVADLNIATVRCLYSKMDS 678
           RLHH+RR+E+KGVKSV+ YKPP+NPEFY E +R+IGK+AFLG  DLNI+TVRC+YSK+D 
Sbjct: 639 RLHHYRRYEIKGVKSVVFYKPPNNPEFYNETVRFIGKNAFLGNTDLNISTVRCIYSKLDG 698

Query: 679 LALERIVGTKRAAVLTHGQNEVYEFK 704
           L+LERIVGTKRAAVL+H Q EVYEFK
Sbjct: 699 LSLERIVGTKRAAVLSHAQKEVYEFK 724

 Score = 38.9 bits (89), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 48/86 (55%), Gaps = 8/86 (9%)

Query: 13  KRGRKQLRNITRIGRAIHVQEDEAKSREEHTVEEA--QAGEQTSN---RKRGNHPAEDDG 67
           KRGR++LR I R   ++   +DE+ +  +H  +E     GE   +    +  N   ED+ 
Sbjct: 18  KRGRQELRKIKR--SSVRRTKDESVNEVDHVADEIVHSTGEDKISDIGSEEDNLDVEDEE 75

Query: 68  GARESQSYGALLTLLSAEHGKQRKKR 93
           G +E + Y ALLT+L +EH + ++++
Sbjct: 76  GKKE-KVYDALLTILKSEHPEPKRRK 100

>KLLA0E08229g Chr5 (742066..744180) [2115 bp, 704 aa] {ON} similar
           to uniprot|P40498 Saccharomyces cerevisiae YIL091C
           Protein required for cell viability
          Length = 704

 Score =  791 bits (2043), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/705 (56%), Positives = 500/705 (70%), Gaps = 22/705 (3%)

Query: 13  KRGRKQLRNITRIGRAIHVQEDEAKSREEHTVEEAQAGEQTSNRKRGNHPAE-DDGGARE 71
           K GRKQLR ITR G+     +DEA        +     E  S+    +  AE +D     
Sbjct: 9   KSGRKQLREITRAGQKRVRYDDEAT-----VADLTPDNESDSDNAEPSVAAEREDVEQHR 63

Query: 72  SQSYGALLTLLSAEHGKQRKKRL--------RKXXXXXXXXXXXXXXXXXXITAALXXXX 123
            Q+Y ALLTLL +EH +++ K          R                   I  AL    
Sbjct: 64  GQAYNALLTLLKSEHPERKHKSNKKIKKDSQRAEEDSPENDGINSEDEQQNIENALDDVS 123

Query: 124 XXXXXXXXXXXXXXXXXXXQDH---FDVHFNRVSAADVAQLDAAFKNGRAQYRVQKEARG 180
                              +D    F+ HF++ S + +   D  FK+   +Y+  K    
Sbjct: 124 GGVVDEEDMEDSLSDVDESEDESDPFESHFSKYSESRLYAFDKGFKDKTVKYKSSKTDVS 183

Query: 181 EEE-ILYSKPVASSEGTEGPVRVPARSLRGYAIKQRLRMHNGLTADDPEKPLTPQQKVLL 239
           EEE ++YSKP    E    PV+   ++L  Y IKQ+L++ N    +    PLT  QK L+
Sbjct: 184 EEESLIYSKPCLDDEEV-LPVK-GKQTLSSYFIKQKLKLANDFQNNGL--PLTEIQKELV 239

Query: 240 DPMFQYQDIXXXXXXXXXXXXXXXXXXXHILNHVYKTRDRILKNNQKLQDNPDQELLDQG 299
           DPMFQY+D+                   H LNHVYKTRDRILKNNQKLQ+N D+ELLDQG
Sbjct: 240 DPMFQYKDMLYEYDDYADEDQYRDLYSLHALNHVYKTRDRILKNNQKLQENNDEELLDQG 299

Query: 300 FTRPKALVVVPTRATAYDVVDLLLQQSGIEQVDKKSKFKDQFYDPSLPPASKPKSFQHVF 359
           FTRPK L+VVPTR  A+ +V  ++++SG++Q DKKSKF+DQF++ SLPP SKPKSFQH+F
Sbjct: 300 FTRPKVLIVVPTRDAAHKIVRKIMEKSGLDQFDKKSKFEDQFFEDSLPPTSKPKSFQHIF 359

Query: 360 KGNTNDFFVLGMKFTRKAIRLYSNFYQSDVIVCSPLGLQLIIENTDKKKRQDDFLSSIEV 419
           +GNTNDFFVLG+KFTRK++++YSNFYQSD+I+CSPLG+QLI+ENTDKKKRQDDFLSSIEV
Sbjct: 360 QGNTNDFFVLGLKFTRKSLKIYSNFYQSDIIICSPLGIQLILENTDKKKRQDDFLSSIEV 419

Query: 420 MVLDQLHSIEFQNIAHVSNIFAHINKIPQQQRDADFSRIRMWYIEDQAKLFRQTMVFTRY 479
           M++DQLHSIE+QN  HV+ IF HINKIP+QQR+ADFSRIRMWYI +QAK FRQT+VFT+Y
Sbjct: 420 MIIDQLHSIEYQNAMHVTTIFQHINKIPEQQREADFSRIRMWYINEQAKFFRQTIVFTKY 479

Query: 480 ISPFANALLNRKCANWAGRVKSHRVVSAEKSVIGQLGLKLRQIFQRFEVLGGSTVDEPDF 539
           ISPFAN++LN KC N AGR K+HR +  E+S IGQLGLK+RQIFQRF++ GG+ +DEPD+
Sbjct: 480 ISPFANSILNGKCRNLAGRWKNHRKIKPEQSSIGQLGLKVRQIFQRFDLAGGTALDEPDY 539

Query: 540 RFKFFTSVVVPGIEKTTGYDSGILLYIPEYTDFIRVRNYLKDKTRILFGDINEYSDQRQL 599
           RFKFFTSV+VP I K+TGY+ GILLYIP+YTDFIRVRNYLK+KT I+FG+INEYS+Q+QL
Sbjct: 540 RFKFFTSVIVPSIVKSTGYEDGILLYIPDYTDFIRVRNYLKEKTTIIFGEINEYSNQKQL 599

Query: 600 TSNRALFQLGRIKVLLYTERLHHFRRFELKGVKSVILYKPPSNPEFYQELLRYIGKSAFL 659
           TSNRA FQ G++KVLLYTERLHHFRR+E+K VKSVI YKPP NPEFY E++R IGK+ FL
Sbjct: 600 TSNRARFQHGKVKVLLYTERLHHFRRYEIKNVKSVIFYKPPGNPEFYSEVVRNIGKNVFL 659

Query: 660 GVADLNIATVRCLYSKMDSLALERIVGTKRAAVLTHGQNEVYEFK 704
           G  D+NI+TVRC+YSKMD L+LER+VG+KRAAVL HGQNEVYEFK
Sbjct: 660 GNCDINISTVRCIYSKMDGLSLERVVGSKRAAVLAHGQNEVYEFK 704

>Skud_9.82 Chr9 complement(167750..169918) [2169 bp, 722 aa] {ON}
           YIL091C (REAL)
          Length = 722

 Score =  785 bits (2026), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/713 (55%), Positives = 497/713 (69%), Gaps = 29/713 (4%)

Query: 13  KRGRKQLRNITRI-GRAIHVQEDEAKSREEHTVEEAQAGEQTSNRKRGNHPAEDD----- 66
           KRGR++LR I R  GR     ED    + ++  EE     +  N    +  +EDD     
Sbjct: 18  KRGRQELRKIKRSSGRRT---EDVDADKIDYVAEEPVG--RNDNDAVSDVGSEDDLDVGD 72

Query: 67  GGARESQSYGALLTLLSAEHG--KQRKKRLRKXXXXXXXXXXXXXXXXXXITAALX---- 120
              ++ + Y ALLT+L +EH   K+ K +  +                  +   L     
Sbjct: 73  EDEKKKKVYDALLTILKSEHPEPKRMKTKAEESSDRTTQSDGNENAESEPVDDQLEIENG 132

Query: 121 -----XXXXXXXXXXXXXXXXXXXXXXQDHFDVHFNRVSAADVAQLDAAFKNGRAQYR-V 174
                                      QD F+ HFN+V   DV  L  AFK+   +Y+ V
Sbjct: 133 LLGDREDESEDDGSEDEKHDDVDSEDEQDPFESHFNQVPEKDVDDLSNAFKSKNIRYKSV 192

Query: 175 QKEARGEEEILYSKPVASSEGTEGPVRVP--ARSLRGYAIKQRLRMHNGLTADDPEKPLT 232
           +    G+E  +Y++PV    G E  V  P  + S+  Y +KQRL++ NGL  D    PL 
Sbjct: 193 KAPLNGDESYIYAQPVVV--GEESSVESPYKSSSIYSYFLKQRLKIQNGL-QDKKIDPLN 249

Query: 233 PQQKVLLDPMFQYQDIXXXXXXXXXXXXXXXXXXX-HILNHVYKTRDRILKNNQKLQDNP 291
             Q+ L+DPMFQY+DI                    H+LNH+YKTRDRILKNNQ+LQDNP
Sbjct: 250 ALQRKLVDPMFQYKDILYEYDSYEKDEDEYRDLYTLHVLNHIYKTRDRILKNNQRLQDNP 309

Query: 292 DQELLDQGFTRPKALVVVPTRATAYDVVDLLLQQSGIEQVDKKSKFKDQFYDPSLPPASK 351
           D E LDQGFTRPK L+VVPTR  AY VVD ++ +SGI+QVDKK KF DQF D SLPP SK
Sbjct: 310 DTEHLDQGFTRPKVLIVVPTRDVAYRVVDKIISKSGIDQVDKKGKFYDQFRDDSLPPKSK 369

Query: 352 PKSFQHVFKGNTNDFFVLGMKFTRKAIRLYSNFYQSDVIVCSPLGLQLIIENTDKKKRQD 411
           P+SFQH+FKGNTNDFFV+G+KFTRKAI+LYSNFYQSD+IVCSPLG+Q+I+ENTDKKKRQD
Sbjct: 370 PRSFQHIFKGNTNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMILENTDKKKRQD 429

Query: 412 DFLSSIEVMVLDQLHSIEFQNIAHVSNIFAHINKIPQQQRDADFSRIRMWYIEDQAKLFR 471
           DFLSSIE+MV+DQLHSIE+QNI+H+  IF H+NKIP QQ +ADFSRIRMWYI +QAK FR
Sbjct: 430 DFLSSIEIMVIDQLHSIEYQNISHILTIFDHLNKIPDQQHEADFSRIRMWYINEQAKFFR 489

Query: 472 QTMVFTRYISPFANALLNRKCANWAGRVKSHRVVSAEKSVIGQLGLKLRQIFQRFEVLGG 531
           QTMVFT+YISP  N+L+N +C N AGR K+HR +  E S IGQLGLK+RQIFQRF+ +G 
Sbjct: 490 QTMVFTKYISPTVNSLINGRCRNMAGRWKNHRTIGPETSSIGQLGLKIRQIFQRFDTIGN 549

Query: 532 STVDEPDFRFKFFTSVVVPGIEKTTGYDSGILLYIPEYTDFIRVRNYLKDKTRILFGDIN 591
           S V+EPD+RFKFFTSV++P I K+TGY+ GIL+YIP+YTDFIR+RNY+K+KT ILFGDIN
Sbjct: 550 SIVEEPDYRFKFFTSVMIPSIVKSTGYEDGILIYIPDYTDFIRIRNYMKEKTTILFGDIN 609

Query: 592 EYSDQRQLTSNRALFQLGRIKVLLYTERLHHFRRFELKGVKSVILYKPPSNPEFYQELLR 651
           EYS QRQL +NR+LFQ GR+KV+LYTERLHH+RR+++KGVKSVI YKPP+NPEFY E +R
Sbjct: 610 EYSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYDIKGVKSVIFYKPPNNPEFYSETVR 669

Query: 652 YIGKSAFLGVADLNIATVRCLYSKMDSLALERIVGTKRAAVLTHGQNEVYEFK 704
           +IGK+AF G  DLNI+TVRC+YSK+D ++LERIVGTKRAAVL+H Q EVYEFK
Sbjct: 670 FIGKNAFSGNTDLNISTVRCIYSKLDGISLERIVGTKRAAVLSHAQKEVYEFK 722

>CAGL0D04180g Chr4 complement(411498..413600) [2103 bp, 700 aa] {ON}
           similar to uniprot|P40498 Saccharomyces cerevisiae
           YIL091c
          Length = 700

 Score =  780 bits (2015), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/707 (56%), Positives = 489/707 (69%), Gaps = 24/707 (3%)

Query: 13  KRGRKQLRNITRIGRAIHVQEDEAKSREEHTVEEAQAGEQTSNRKRGNHPAEDDGGARES 72
           KRGRK+LR+I R  R     E EA +  E +    +AG     + + +   EDD    + 
Sbjct: 3   KRGRKELRSIRRAKRT--KIEPEADAGVESSGSVLEAGPAVEEKVQDDGEKEDD----KE 56

Query: 73  QSYGALLTLLSAEHGKQRKKRLRKXXXXXXXXXXXXXXXXXXITA----ALXXXXXXXXX 128
           Q Y ALLT+L +EH + + K  R                     A               
Sbjct: 57  QVYNALLTILKSEHKEDKVKTHRDHDEEESEAEEEEQAEDQYNDAFADGESDDEDDDEDE 116

Query: 129 XXXXXXXXXXXXXXQDHFDVHFNRVSAADVAQ-LDAAFKNGRAQYRVQK-------EARG 180
                         +D FD HFN   AA   + L  A K+ + +Y+  K       E + 
Sbjct: 117 QAQEQEEIESDDEEKDPFDTHFNGEEAAKHGEALGNALKDNKLRYKSIKLKVGSADEDQV 176

Query: 181 EEEILYSKPVASSEGTEGPVRVPAR--SLRGYAIKQRLRMHNGLTADDPEKPLTPQQKVL 238
           +E+ ++S P    EG    +  P    SL  Y +K+RLR+ N L  D     LT  Q+ +
Sbjct: 177 QEDAIFSVPYI--EGETPKIEDPKLKCSLSSYFLKKRLRIQNNL-LDTESNALTDLQRKI 233

Query: 239 LDPMFQYQDIXXXXXXX-XXXXXXXXXXXXHILNHVYKTRDRILKNNQKLQDNPDQELLD 297
           +DPM QY+DI                    H+LNHVYKTRD+I+KNNQKLQDNPD E LD
Sbjct: 234 VDPMMQYKDILYEYDTYGKDEDEYRDLYTLHVLNHVYKTRDKIIKNNQKLQDNPDSEFLD 293

Query: 298 QGFTRPKALVVVPTRATAYDVVDLLLQQSGIEQVDKKSKFKDQFYDPSLPPASKPKSFQH 357
           QGFTRPK L++ PTR +AY +V  L+++SG++QVDKK KF+DQFYDPS PP+SKPKSFQH
Sbjct: 294 QGFTRPKVLIIAPTRDSAYQIVTKLIEKSGLDQVDKKGKFRDQFYDPSFPPSSKPKSFQH 353

Query: 358 VFKGNTNDFFVLGMKFTRKAIRLYSNFYQSDVIVCSPLGLQLIIENTDKKKRQDDFLSSI 417
           +FKGNTND+FVLG+KFTRKAI+LYSNFYQSD+IVCSPLGLQ+I+ENTDKKKRQDDFLSS+
Sbjct: 354 IFKGNTNDYFVLGVKFTRKAIKLYSNFYQSDIIVCSPLGLQMIVENTDKKKRQDDFLSSV 413

Query: 418 EVMVLDQLHSIEFQNIAHVSNIFAHINKIPQQQRDADFSRIRMWYIEDQAKLFRQTMVFT 477
           EV ++DQ HSIE+QN  H+  IF H+NKIPQ+Q DADFSRIRMWYI DQAK FRQTM+FT
Sbjct: 414 EVTIIDQFHSIEYQNYTHLFTIFDHLNKIPQEQHDADFSRIRMWYINDQAKFFRQTMIFT 473

Query: 478 RYISPFANALLNRKCANWAGRVKSHRVVSAEKSVIGQLGLKLRQIFQRFEVLGGSTVDEP 537
           +YISP AN+LLN KC N  GR K+H++VS+E S +G +GLK+RQIFQRF VLG S  DEP
Sbjct: 474 KYISPVANSLLNIKCRNLEGRWKNHKIVSSEDSSVGTVGLKVRQIFQRFNVLGNSVADEP 533

Query: 538 DFRFKFFTSVVVPGIEKTTGYDSGILLYIPEYTDFIRVRNYLKDKTRILFGDINEYSDQR 597
           D+RFKFFTSVV+  I K+TGYD G L+YIPEY+D++RVRNY+K+KT ILFGDINEYS+QR
Sbjct: 534 DYRFKFFTSVVISNITKSTGYDDGTLIYIPEYSDYVRVRNYMKEKTSILFGDINEYSEQR 593

Query: 598 QLTSNRALFQLGRIKVLLYTERLHHFRRFELKGVKSVILYKPPSNPEFYQELLRYIGKSA 657
            LTSNR LF  GR+KVLLYTERLHHFRR+ELKGVK+V+ YKPPS+PEFY+E++RYIGK+ 
Sbjct: 594 SLTSNRTLFNQGRLKVLLYTERLHHFRRYELKGVKNVVFYKPPSDPEFYKEVVRYIGKTV 653

Query: 658 FLGVADLNIATVRCLYSKMDSLALERIVGTKRAAVLTHGQNEVYEFK 704
           FLG ADLNI+TVRC YSK+D LALE+IVGTKR  VLTHGQNE YEFK
Sbjct: 654 FLGDADLNISTVRCCYSKLDGLALEKIVGTKRTGVLTHGQNETYEFK 700

>TDEL0G02220 Chr7 complement(434650..436782) [2133 bp, 710 aa] {ON}
           Anc_2.292 YIL091C
          Length = 710

 Score =  778 bits (2009), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/705 (55%), Positives = 497/705 (70%), Gaps = 25/705 (3%)

Query: 13  KRGRKQLRNITRIGRAIHVQEDEAKSREEHTVEEAQAGEQTSNRKRGNHP-----AEDDG 67
           KRGRK+LR+I R       Q ++A    EH + E+  GE  ++     H       E+D 
Sbjct: 18  KRGRKELRSIRR------PQRNKAHEEPEH-LNESSEGEVKNHHNGMQHNEEIANVEEDE 70

Query: 68  GARESQSYGALLTLLSAEHGKQRKKR----LRKXXXXXXXXXXXXXXXXXXITAALXXXX 123
             +  + YGALLT+L++EH K + K+      +                  +   L    
Sbjct: 71  ENKRRKVYGALLTILNSEHPKPKPKQEVTVQSRKEDSESDVEEDERDEVEQLEDNLARVD 130

Query: 124 XXXXXXXXXXXXXXXXXXXQDHFDVHFNRVSAADVAQLDAAFKNGRAQYRVQKEARGEEE 183
                              QD FD HFN+V    V +LDAAFK  + +Y+  K   GE E
Sbjct: 131 ENPSEDDLSEDADEESDDEQDTFDSHFNQVPENVVDKLDAAFKERQLKYKSAKVPIGENE 190

Query: 184 -ILYSKPVASSEGTEGPVRVPAR--SLRGYAIKQRLRMHNGLTADDPEKPLTPQQKVLLD 240
            ++YSKP+   E     + +P+R  SL+ Y  KQRL++ N L  ++    LT  Q+ L+D
Sbjct: 191 SMVYSKPLLL-EDQSKKLEIPSRHESLKSYVFKQRLKIQNDLEHEN----LTSTQRTLVD 245

Query: 241 PMFQYQDIXXXXXXXXXXXXXXXXX-XXHILNHVYKTRDRILKNNQKLQDNPDQELLDQG 299
           PM QY D+                    H+LNHVYKTRD+ILKNNQ++ DNPD + LDQG
Sbjct: 246 PMLQYNDLLYEYNSYEKDEDEYRDLYALHVLNHVYKTRDKILKNNQRISDNPDADYLDQG 305

Query: 300 FTRPKALVVVPTRATAYDVVDLLLQQSGIEQVDKKSKFKDQFYDPSLPPASKPKSFQHVF 359
           FTRPK L+VVPTR TAY V++ ++ +SGI+Q+DKK KF+DQF++ SLPP+SKPKSFQHVF
Sbjct: 306 FTRPKVLIVVPTRDTAYQVLEKIIDKSGIDQIDKKGKFRDQFFEESLPPSSKPKSFQHVF 365

Query: 360 KGNTNDFFVLGMKFTRKAIRLYSNFYQSDVIVCSPLGLQLIIENTDKKKRQDDFLSSIEV 419
           KGNTNDFFVLG+KFTRKAI+LYSNFYQSD+I+CSPLG+QLI+ENTDKKKRQDDFLSSIE+
Sbjct: 366 KGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIICSPLGIQLILENTDKKKRQDDFLSSIEI 425

Query: 420 MVLDQLHSIEFQNIAHVSNIFAHINKIPQQQRDADFSRIRMWYIEDQAKLFRQTMVFTRY 479
            + DQLHSIE+QN++HV  IF H+N IPQ+Q D DF R+R+WYI +QAKLFRQTM+FT+Y
Sbjct: 426 SIFDQLHSIEYQNVSHVMTIFDHLNLIPQEQHDTDFGRVRLWYINEQAKLFRQTMIFTKY 485

Query: 480 ISPFANALLNRKCANWAGRVKSHRVVSAEKSVIGQLGLKLRQIFQRFEVLGGSTVDEPDF 539
           +SP ANAL+N KC N  GR K+H  +   +S IG+LGLK+RQIFQR ++   S ++E DF
Sbjct: 486 VSPTANALINNKCQNMTGRWKNHHFIEPNQSSIGKLGLKVRQIFQRIDLGAASILEESDF 545

Query: 540 RFKFFTSVVVPGIEKTTGYDSGILLYIPEYTDFIRVRNYLKDKTRILFGDINEYSDQRQL 599
           RFKFFTSV++P I K+TGY+ GIL+YIP+Y DFIRVRNY+K+KT I+FGDINEYS+Q+QL
Sbjct: 546 RFKFFTSVIIPSIIKSTGYEDGILVYIPDYADFIRVRNYMKEKTTIIFGDINEYSNQKQL 605

Query: 600 TSNRALFQLGRIKVLLYTERLHHFRRFELKGVKSVILYKPPSNPEFYQELLRYIGKSAFL 659
            SNRALFQ GR KVLLYTERLHHFRR+E+KGVKSV+ Y+PP+NPEFY E++R+I KSA L
Sbjct: 606 NSNRALFQQGRAKVLLYTERLHHFRRYEIKGVKSVVFYQPPTNPEFYSEVVRFIAKSAAL 665

Query: 660 GVADLNIATVRCLYSKMDSLALERIVGTKRAAVLTHGQNEVYEFK 704
           G  DLNI+TVR +YSK+D ++LERIVGTKRAA+LTHGQNEVYEFK
Sbjct: 666 GTTDLNISTVRTIYSKLDGISLERIVGTKRAAILTHGQNEVYEFK 710

>NDAI0B03530 Chr2 (887479..889698) [2220 bp, 739 aa] {ON} Anc_2.292
           YIL091C
          Length = 739

 Score =  776 bits (2005), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/661 (57%), Positives = 477/661 (72%), Gaps = 24/661 (3%)

Query: 66  DGGARESQSYGALLTLLSAEHGKQRKKR------LRKXXXXXXXXXXXXXXXXXXI---- 115
           D   R+ + YGALLT+L  EH + + KR      L++                  I    
Sbjct: 81  DEDERKGKVYGALLTILETEHPEPKHKRQPKEKLLKEQVSDSNLNNTGDRETEDSIIEED 140

Query: 116 ------TAALXXXXXXXXXXXXXXXXXXXXXXXQDHFDVHFNRVSAADVAQLDAAFKNGR 169
                    L                       QD F+ HFN+ +   V +L AAF++  
Sbjct: 141 ETEQIENGLLDRDDEQSDDDQLNDSNDVESDDEQDPFESHFNKPTEQFVDKLHAAFESRE 200

Query: 170 AQYRVQKEARGEEE-ILYSKPVASSEGTEGPVRVPAR---SLRGYAIKQRLRMHNGLTAD 225
            +Y+  K    +   ++ SKP    E  E      ++   S+  Y IKQRL++ N L   
Sbjct: 201 IKYKATKIVIDDSHSVISSKPTIFGEELETNRLSSSKHGQSIFSYFIKQRLKIQNNLL-- 258

Query: 226 DPE-KPLTPQQKVLLDPMFQYQDIXXXXXXX-XXXXXXXXXXXXHILNHVYKTRDRILKN 283
           +P+  PLTP QK LLDPMFQY+DI                    H LNHVYKTRDRILKN
Sbjct: 259 NPKVDPLTPLQKELLDPMFQYKDILYEYDSYGKDEDEYRDLYALHALNHVYKTRDRILKN 318

Query: 284 NQKLQDNPDQELLDQGFTRPKALVVVPTRATAYDVVDLLLQQSGIEQVDKKSKFKDQFYD 343
           NQ+LQDN D E LDQGFTRPK L+VVPTR TAY+V D ++++SG++QVDKK KF DQF D
Sbjct: 319 NQRLQDNTDTEYLDQGFTRPKVLIVVPTRDTAYEVTDKIIKKSGLDQVDKKGKFYDQFKD 378

Query: 344 PSLPPASKPKSFQHVFKGNTNDFFVLGMKFTRKAIRLYSNFYQSDVIVCSPLGLQLIIEN 403
            SLPP+SKPKSFQ +FKGNTNDFFVLG+KFTRKAI+LYSNFYQSD+IVCSPLG+Q+I+EN
Sbjct: 379 DSLPPSSKPKSFQQIFKGNTNDFFVLGLKFTRKAIKLYSNFYQSDIIVCSPLGMQMIVEN 438

Query: 404 TDKKKRQDDFLSSIEVMVLDQLHSIEFQNIAHVSNIFAHINKIPQQQRDADFSRIRMWYI 463
           TDKKKRQDDFLSSIE++++DQLHS+E+QN+AH+  IF H+NKIP +Q DADFSRIRMWYI
Sbjct: 439 TDKKKRQDDFLSSIELLIVDQLHSLEYQNLAHIFTIFDHLNKIPTEQHDADFSRIRMWYI 498

Query: 464 EDQAKLFRQTMVFTRYISPFANALLNRKCANWAGRVKSHRVVSAEKSVIGQLGLKLRQIF 523
            DQAKLFRQTMVFT+Y+SP ANA++N +C NW GR K+H++V+ E S IG+LGLK++QIF
Sbjct: 499 NDQAKLFRQTMVFTKYVSPAANAIINNRCRNWEGRWKNHKIVAPEVSSIGKLGLKIKQIF 558

Query: 524 QRFEVLGGSTVDEPDFRFKFFTSVVVPGIEKTTGYDSGILLYIPEYTDFIRVRNYLKDKT 583
           QRF+++GGS VDEPD+RFK FTSV++P I K+T YD GIL+YIP+YTD++R+RNYLK+KT
Sbjct: 559 QRFDIMGGSIVDEPDYRFKHFTSVIIPSIVKSTSYDDGILIYIPDYTDYVRIRNYLKEKT 618

Query: 584 RILFGDINEYSDQRQLTSNRALFQLGRIKVLLYTERLHHFRRFELKGVKSVILYKPPSNP 643
           RILFGDINEYS+QR+L SNR+L Q GR+KVLLYTERLHH+RR+E+KGVKSV+ YKPP+NP
Sbjct: 619 RILFGDINEYSEQRELNSNRSLLQQGRVKVLLYTERLHHYRRYEIKGVKSVVFYKPPTNP 678

Query: 644 EFYQELLRYIGKSAFLGVADLNIATVRCLYSKMDSLALERIVGTKRAAVLTHGQNEVYEF 703
           EFY E++R+IGK+AFLG  DLNI+TVR +Y K+D L+LERIVGTKRA +L H QNEVYEF
Sbjct: 679 EFYNEVVRFIGKNAFLGNTDLNISTVRTVYCKLDGLSLERIVGTKRAGILCHAQNEVYEF 738

Query: 704 K 704
           K
Sbjct: 739 K 739

>Kpol_1039.46 s1039 complement(138925..141039) [2115 bp, 704 aa]
           {ON} complement(138925..141039) [2115 nt, 705 aa]
          Length = 704

 Score =  775 bits (2000), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/698 (55%), Positives = 503/698 (72%), Gaps = 12/698 (1%)

Query: 13  KRGRKQLRNITRIGRAIHVQEDEAKSREEHTVEEAQAGEQTSNRKRGNHPAEDDGGARES 72
           KRGR +LR+I R  R+ H + D+   +  H  E   + E +S+       AE +   R+ 
Sbjct: 13  KRGRTELRSIRRPNRSQHSKHDQ---QVVHESENEDSLESSSDDDEDIAQAEAENSDRKE 69

Query: 73  QSYGALLTLLSAEHGKQRKKRLRKXXXXXXXXXXXXXXXXXXITAALXXXXXXXXXXXXX 132
           + YGALLT+L++EH +++K +                       +               
Sbjct: 70  KVYGALLTILNSEHPERKKHKSHSTDFVKEIDEQEEIEQGMASESEEEDEENDEEESNEG 129

Query: 133 XXXXXXXXXXQ-DHFDVHFNRVSAADVAQLDAAFKNGRAQYRVQKEARGEEE-ILYSKPV 190
                     Q D F+ HFN VS   V  + A FK+ + +Y+  K +  ++E  ++ KP+
Sbjct: 130 DEEEEEEPTDQLDTFESHFNDVSQDLVDDISAGFKDKQIKYKSMKYSLDKKESAIFGKPL 189

Query: 191 ---ASSEGTEGPVRVPARSLRGYAIKQRLRMHNGLTADDPEKPLTPQQKVLLDPMFQYQD 247
                 E  + PV     S   Y IKQRL++ N L  D  ++ LTP +K LLDPMFQY+D
Sbjct: 190 LLTQQDETIDNPVLTS--SYDSYFIKQRLKIQNDL-LDSSKENLTPLKKKLLDPMFQYKD 246

Query: 248 IXXXXXXXXXXXXXX-XXXXXHILNHVYKTRDRILKNNQKLQDNPDQELLDQGFTRPKAL 306
           +                    H+LNH+YKTRD+ILK+NQ+LQ+N D E LDQGFTRPK L
Sbjct: 247 VLCEYTNYENDEKEYRELYSLHVLNHIYKTRDKILKDNQRLQENDDLECLDQGFTRPKVL 306

Query: 307 VVVPTRATAYDVVDLLLQQSGIEQVDKKSKFKDQFYDPSLPPASKPKSFQHVFKGNTNDF 366
           +VVPTR TAY VV+ ++++SG++Q+DKK KFKDQF+D SLPP SKPKSF+HVFKGNTNDF
Sbjct: 307 IVVPTRDTAYQVVETIIEKSGLDQIDKKGKFKDQFFDDSLPPTSKPKSFRHVFKGNTNDF 366

Query: 367 FVLGMKFTRKAIRLYSNFYQSDVIVCSPLGLQLIIENTDKKKRQDDFLSSIEVMVLDQLH 426
           FVLGMKFTRKAI+LYSNFYQSD+I+CSPLG+Q+I+ENTDKKKRQDDFLSSIEVM++DQLH
Sbjct: 367 FVLGMKFTRKAIKLYSNFYQSDIIICSPLGIQMILENTDKKKRQDDFLSSIEVMIVDQLH 426

Query: 427 SIEFQNIAHVSNIFAHINKIPQQQRDADFSRIRMWYIEDQAKLFRQTMVFTRYISPFANA 486
           SIE+QNI+HV  I  HINKIPQQQR+ADFSRIRMWYI DQAK  RQTM+FTRYISP ANA
Sbjct: 427 SIEYQNISHVYTILEHINKIPQQQREADFSRIRMWYINDQAKFLRQTMLFTRYISPTANA 486

Query: 487 LLNRKCANWAGRVKSHRVVSAEKSVIGQLGLKLRQIFQRFEVLGGSTVDEPDFRFKFFTS 546
           ++N KC N AGR K+++++S+E S IGQLG+K++QIFQRF+++GG+ VDE D+RFK+FTS
Sbjct: 487 IINGKCHNMAGRWKNNQIISSEDSSIGQLGIKIKQIFQRFDLVGGTVVDESDYRFKYFTS 546

Query: 547 VVVPGIEKTTGYDSGILLYIPEYTDFIRVRNYLKDKTRILFGDINEYSDQRQLTSNRALF 606
           VV+  I K+TGY+ GIL+YIPEYTD++R+RNY+K+KT ILF +INEYS Q+QL SNR++F
Sbjct: 547 VVMQNIVKSTGYEDGILVYIPEYTDYMRLRNYMKEKTTILFSEINEYSTQKQLDSNRSMF 606

Query: 607 QLGRIKVLLYTERLHHFRRFELKGVKSVILYKPPSNPEFYQELLRYIGKSAFLGVADLNI 666
           Q GR KVLLYTERLHH+RR+ELKG+KSVI YKPP+NPEFY E++R+  K+AFLG +D+NI
Sbjct: 607 QQGRTKVLLYTERLHHYRRYELKGIKSVIFYKPPTNPEFYNEVIRFTAKNAFLGKSDINI 666

Query: 667 ATVRCLYSKMDSLALERIVGTKRAAVLTHGQNEVYEFK 704
           +T+R +YSK+D LAL+RIVG+KRAA+L HGQNE Y+FK
Sbjct: 667 STIRTVYSKLDGLALQRIVGSKRAAILCHGQNESYDFK 704

>NCAS0B06230 Chr2 (1175844..1178015) [2172 bp, 723 aa] {ON}
           Anc_2.292 YIL091C
          Length = 723

 Score =  773 bits (1997), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/567 (62%), Positives = 446/567 (78%), Gaps = 6/567 (1%)

Query: 143 QDHFDVHFNRVSAADVAQLDAAFKNGRAQYRVQKEARGEEEILYSK--PVASSEGTEGPV 200
           QD F+ HFN+VS      L+ AF  G  +Y+  K   G+ + + S    +   E TE   
Sbjct: 158 QDPFESHFNQVSEKTADDLNTAFNTGSVKYKSTKSVIGDNKTVISSIPTIIGKENTEEEK 217

Query: 201 RVPARS--LRGYAIKQRLRMHNGLTADDPEKPLTPQQKVLLDPMFQYQDIXXXXXXXXXX 258
               +S  +  Y +KQRLR+ N +  D  + PL P QK L+DPMFQY+DI          
Sbjct: 218 DSAPKSSSIHSYFLKQRLRVANDM-LDSKKDPLGPLQKELVDPMFQYRDILCEYSSYEKD 276

Query: 259 XXXXXXXXX-HILNHVYKTRDRILKNNQKLQDNPDQELLDQGFTRPKALVVVPTRATAYD 317
                     H LNHVYKTRDRILK+N +LQDN D E  DQGFTRPK L+VVPTR TAY+
Sbjct: 277 EDEYRDLYALHALNHVYKTRDRILKDNGRLQDNSDTEYFDQGFTRPKVLIVVPTRDTAYE 336

Query: 318 VVDLLLQQSGIEQVDKKSKFKDQFYDPSLPPASKPKSFQHVFKGNTNDFFVLGMKFTRKA 377
           V+  ++ +SG++QVDKK KF DQF+D +LPP+SKPKSFQH+FKGNTNDFFVLG+KFTRKA
Sbjct: 337 VISKIISKSGLDQVDKKGKFNDQFHDETLPPSSKPKSFQHIFKGNTNDFFVLGVKFTRKA 396

Query: 378 IRLYSNFYQSDVIVCSPLGLQLIIENTDKKKRQDDFLSSIEVMVLDQLHSIEFQNIAHVS 437
           I+LYSNFYQSD+IVCSPLG+Q+I+ENTDKK RQDDFLSSIEV+++DQLHSIE+QN+AHV 
Sbjct: 397 IKLYSNFYQSDIIVCSPLGMQMIVENTDKKNRQDDFLSSIEVLIIDQLHSIEYQNLAHVF 456

Query: 438 NIFAHINKIPQQQRDADFSRIRMWYIEDQAKLFRQTMVFTRYISPFANALLNRKCANWAG 497
            IF H+NKIP+QQ +ADFSRIRMWYI DQA+LFRQTM+FT+Y++P ANAL+N +C NWAG
Sbjct: 457 TIFDHLNKIPEQQHEADFSRIRMWYINDQARLFRQTMIFTKYVTPAANALINNRCRNWAG 516

Query: 498 RVKSHRVVSAEKSVIGQLGLKLRQIFQRFEVLGGSTVDEPDFRFKFFTSVVVPGIEKTTG 557
           R K+H ++  E S I QLGLK++Q FQRF+++GGS +DEPD+RFK F+SV++P I K+T 
Sbjct: 517 RWKNHEIIEPEASAISQLGLKVKQTFQRFDMMGGSVIDEPDYRFKHFSSVIIPSIVKSTS 576

Query: 558 YDSGILLYIPEYTDFIRVRNYLKDKTRILFGDINEYSDQRQLTSNRALFQLGRIKVLLYT 617
           Y  GIL+YIP+YTD++R+RNYLK+KT +LFGDINEYS+QR+L SNR+LFQ GR+KVLLYT
Sbjct: 577 YSDGILIYIPDYTDYVRIRNYLKEKTTLLFGDINEYSEQRELNSNRSLFQQGRVKVLLYT 636

Query: 618 ERLHHFRRFELKGVKSVILYKPPSNPEFYQELLRYIGKSAFLGVADLNIATVRCLYSKMD 677
           ERLHH+RR+ELKGVKSV+ YKPP+NPEFY E++RYIGKSAFLG ADLNI+TVR LY K+D
Sbjct: 637 ERLHHYRRYELKGVKSVVFYKPPTNPEFYNEVVRYIGKSAFLGNADLNISTVRTLYCKLD 696

Query: 678 SLALERIVGTKRAAVLTHGQNEVYEFK 704
            L+LERIVG+KRA +L H QNEVYEF+
Sbjct: 697 GLSLERIVGSKRAGILCHAQNEVYEFQ 723

>TBLA0B05970 Chr2 complement(1410055..1412214) [2160 bp, 719 aa]
           {ON} Anc_2.292 YIL091C
          Length = 719

 Score =  768 bits (1984), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/707 (53%), Positives = 494/707 (69%), Gaps = 16/707 (2%)

Query: 12  GKRGRKQLRNITRIGRAIHVQEDEAKSREEHTVEEAQAGEQTSNRKRGNHPAEDDGGARE 71
           GKRGR Q R+I +   A   + ++ +  +E T+E+  + E  SN          +   ++
Sbjct: 15  GKRGRSQKRSIKKSSGAKRFKTEDTRIVKE-TIEDESSDEDVSNTSIDKEAEVTEDLEKK 73

Query: 72  SQSYGALLTLLSAEHGKQRKK-------RLRKXXXXXXXXXXXXXXXXXXITAALXXXXX 124
            Q Y AL+T+L +EH + + +       +                     I   L     
Sbjct: 74  KQVYDALVTILKSEHKEPKMRDNLNETSKEEHLTDEDLDEDEKFETEEQEIENNLLSIKD 133

Query: 125 XXXXXXXXXXXXXXXXXXQDH----FDVHFNRVSAADVAQLDAAFKNGRAQYRVQKEARG 180
                              D+    FD HFN+ +     +   AFKN + +YR  K    
Sbjct: 134 DEEEGENNDDNAGESDDESDNKSDPFDSHFNQPTEQFTNKFADAFKNKQIKYRSIKYKIN 193

Query: 181 E-EEILYSKP-VASSEGTEGPVRVPARSLRGYAIKQRLRMHNGLTADDPEKPLTPQQKVL 238
           E E  +YS+P +   E T+    V   S+  YA+K+RL+++N L  D     LT  QK L
Sbjct: 194 EYESSIYSEPRILEDEQTKVKSPVLKSSIHSYALKKRLKINNDL-LDPAVNNLTTIQKEL 252

Query: 239 LDPMFQYQDIXXXX-XXXXXXXXXXXXXXXHILNHVYKTRDRILKNNQKLQDNPDQELLD 297
           +DPMFQY+DI                    H+LNH+YKTRDRILKNN K+QDNPD E LD
Sbjct: 253 VDPMFQYKDILYEYGNYGKDEEEYRSLYCLHVLNHIYKTRDRILKNNSKVQDNPDAEFLD 312

Query: 298 QGFTRPKALVVVPTRATAYDVVDLLLQQSGIEQVDKKSKFKDQFYDPSLPPASKPKSFQH 357
           QGFTRPK L+V PTR   Y +V+ ++++SGI+Q+DKKSKF+DQFY+ SL PASKPKSFQ 
Sbjct: 313 QGFTRPKVLIVAPTRDAGYSIVNEIIKKSGIDQIDKKSKFRDQFYEESLLPASKPKSFQA 372

Query: 358 VFKGNTNDFFVLGMKFTRKAIRLYSNFYQSDVIVCSPLGLQLIIENTDKKKRQDDFLSSI 417
           VFKGN+ND+FVLG+KFTRKAI+LYSNFYQSD+IVCSPLGL +I+ENTDKKKRQDDFLSSI
Sbjct: 373 VFKGNSNDYFVLGIKFTRKAIKLYSNFYQSDIIVCSPLGLHMILENTDKKKRQDDFLSSI 432

Query: 418 EVMVLDQLHSIEFQNIAHVSNIFAHINKIPQQQRDADFSRIRMWYIEDQAKLFRQTMVFT 477
           E+M++DQLHS+EFQNI+HV++IF HINKIP++Q D DFSRI+MWYI DQAKLFRQTM+FT
Sbjct: 433 ELMIIDQLHSMEFQNISHVTSIFEHINKIPKEQHDTDFSRIKMWYINDQAKLFRQTMIFT 492

Query: 478 RYISPFANALLNRKCANWAGRVKSHRVVSAEKSVIGQLGLKLRQIFQRFEVLGGSTVDEP 537
           +YISP AN  LN KC NW+GR K+H++++  +S IGQLGL+++Q+F RF+++GGS VDEP
Sbjct: 493 KYISPSANFFLNGKCQNWSGRWKNHKMITPNESSIGQLGLRVKQMFHRFDIIGGSIVDEP 552

Query: 538 DFRFKFFTSVVVPGIEKTTGYDSGILLYIPEYTDFIRVRNYLKDKTRILFGDINEYSDQR 597
           D+RFK+FTSV+V  I K+T Y+ G+L+YI +YTD++RVRNYLK+KT ILFGDINEYSDQ+
Sbjct: 553 DYRFKYFTSVIVQSITKSTSYEDGMLIYITDYTDYVRVRNYLKEKTTILFGDINEYSDQK 612

Query: 598 QLTSNRALFQLGRIKVLLYTERLHHFRRFELKGVKSVILYKPPSNPEFYQELLRYIGKSA 657
           Q+ SNRALFQ  R+KVLLYTERLHHFRR+E+KGVK+++ YK P+NPEFY E++RYIGK+A
Sbjct: 613 QVNSNRALFQQRRVKVLLYTERLHHFRRYEIKGVKNIVFYKAPTNPEFYNEVVRYIGKNA 672

Query: 658 FLGVADLNIATVRCLYSKMDSLALERIVGTKRAAVLTHGQNEVYEFK 704
           F G  D+NI+ VR +YSK+D LALERI+GTKRAAVLTHGQNE YEFK
Sbjct: 673 FTGNTDINISNVRTIYSKLDGLALERIMGTKRAAVLTHGQNETYEFK 719

>ZYRO0A02002g Chr1 complement(164386..166515) [2130 bp, 709 aa] {ON}
           similar to uniprot|P40498 Saccharomyces cerevisiae
           YIL091C Protein required for cell viability
          Length = 709

 Score =  749 bits (1933), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/706 (54%), Positives = 492/706 (69%), Gaps = 19/706 (2%)

Query: 10  MDG--KRGRKQLRNITRIGRAIHVQEDEAKSREEHTVEEAQAGEQTSNRKRGNHPAEDDG 67
           +DG  KRGRK LR+I R        + E     E  V   + GE + + +        + 
Sbjct: 12  IDGSRKRGRKDLRSIRRAR-----NDKEPVEEPEIPVASEEDGELSEDSEEDATNEVQEQ 66

Query: 68  GARESQSYGALLTLLSAEHGKQRKKRLRKXXXX----XXXXXXXXXXXXXXITAALXXX- 122
              + ++YGALLT+L +EH + R++  RK                      + A L    
Sbjct: 67  EDSKEKAYGALLTILKSEHPEDRQRERRKKKQDLQDPSSSDDELSEDEKGEVEANLVDTP 126

Query: 123 --XXXXXXXXXXXXXXXXXXXXQDHFDVHFNRVSAADVAQLDAAFKNGRAQYRVQK-EAR 179
                                 +D F+ HFN  S + +  LD A+K  +   +  K    
Sbjct: 127 GEEEPQSEEELSEGDEDESEDERDPFESHFNMQSES-IDSLDEAWKQKKIVNKSGKIRVD 185

Query: 180 GEEEILYSKPVASSEGTEGPVRVPARSLRGYAIKQRLRMHNGLTADDPEKPLTPQQKVLL 239
            +E ++Y+K +A  +G E  +      L  Y +K++L++ N L  +  +  LTP Q+ ++
Sbjct: 186 DDESLIYTKTLAG-KGQEFELPSHKGHLSSYPLKRKLKIQNNL-LESQDDVLTPLQRKIV 243

Query: 240 DPMFQYQDIXXXXXXXXXXXXXXXXX-XXHILNHVYKTRDRILKNNQKLQDNPDQELLDQ 298
           DP+FQY+D+                    H+LNH+YKTRDRILK+NQ+L  NPD E LDQ
Sbjct: 244 DPIFQYRDLLYEYEDYEQDEDEYRDLYVLHVLNHIYKTRDRILKDNQRLATNPDGEFLDQ 303

Query: 299 GFTRPKALVVVPTRATAYDVVDLLLQQSGIEQVDKKSKFKDQFYDPSLPPASKPKSFQHV 358
           GFTRPK L+V PTR TAY +V  ++++SG++QVDKKSK +DQF++  LPP+SKPKSF+H 
Sbjct: 304 GFTRPKVLIVAPTRDTAYQIVSKVIEKSGLDQVDKKSKLRDQFFEDVLPPSSKPKSFRHT 363

Query: 359 FKGNTNDFFVLGMKFTRKAIRLYSNFYQSDVIVCSPLGLQLIIENTDKKKRQDDFLSSIE 418
           FKGNTNDFFVLG+KFTRKAIRLYSNFYQSD+IVCSPLGLQLI+ENTD+KKRQDDFLSSIE
Sbjct: 364 FKGNTNDFFVLGVKFTRKAIRLYSNFYQSDLIVCSPLGLQLILENTDRKKRQDDFLSSIE 423

Query: 419 VMVLDQLHSIEFQNIAHVSNIFAHINKIPQQQRDADFSRIRMWYIEDQAKLFRQTMVFTR 478
           +M++DQL+SIEFQN++H+  IFAH+NKIP++Q D DF R+RMWYI +QAKL RQT++FTR
Sbjct: 424 LMIIDQLNSIEFQNVSHLFTIFAHMNKIPKEQHDTDFGRVRMWYINEQAKLLRQTLIFTR 483

Query: 479 YISPFANALLNRKCANWAGRVKSHRVVSAEKSVIGQLGLKLRQIFQRFEVLGGSTVDEPD 538
           Y++P AN LLN KC N  GR K+H  ++ E+S + +LG ++RQIFQR ++ G S VDEPD
Sbjct: 484 YVTPTANFLLNGKCRNIGGRWKNHHQITGEQSSVSKLGFRVRQIFQRVDLGGASVVDEPD 543

Query: 539 FRFKFFTSVVVPGIEKTTGYDSGILLYIPEYTDFIRVRNYLKDKTRILFGDINEYSDQRQ 598
           +RF+FFTSV+VP I K+TGY+ GILLYIP+Y DFIRVRNYLKDKT ILFGDINEYSD RQ
Sbjct: 544 YRFRFFTSVIVPSITKSTGYEDGILLYIPDYADFIRVRNYLKDKTTILFGDINEYSDVRQ 603

Query: 599 LTSNRALFQLGRIKVLLYTERLHHFRRFELKGVKSVILYKPPSNPEFYQELLRYIGKSAF 658
           LTS R+LFQ GRIKVLLYTERLHHFRR+E+KGVKSVI Y+PPSNPEFY E++RYIGKSAF
Sbjct: 604 LTSTRSLFQQGRIKVLLYTERLHHFRRYEIKGVKSVIFYQPPSNPEFYNEVVRYIGKSAF 663

Query: 659 LGVADLNIATVRCLYSKMDSLALERIVGTKRAAVLTHGQNEVYEFK 704
           LG  DLNI+TVRC+YSK+D LALERIV +KRAAVLTHGQNE+YEFK
Sbjct: 664 LGDTDLNISTVRCVYSKLDGLALERIVSSKRAAVLTHGQNEIYEFK 709

>TPHA0D01520 Chr4 (310797..312947) [2151 bp, 716 aa] {ON} Anc_2.292
           YIL091C
          Length = 716

 Score =  744 bits (1920), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/565 (61%), Positives = 452/565 (80%), Gaps = 9/565 (1%)

Query: 146 FDVHFNRVSAADVAQLDAAFKNGRAQY---RVQKEARGEEEILYSKPVASSEGTEGPVRV 202
           FD+HFN+V    V ++   F N + +Y   ++Q     ++  +YSKP+   +G +  V  
Sbjct: 155 FDIHFNQVPENVVDKISNGFDNKKIKYVSKKIQLPHHEKDFFIYSKPIVD-DGNKHKVES 213

Query: 203 PAR--SLRGYAIKQRLRMHNGLTADDPEKPLTPQQKVLLDPMFQYQDIXXXXXXX-XXXX 259
           P +  SL  Y IK+RL + N L   D +  LT  QK L+DPMFQY DI            
Sbjct: 214 PIKKSSLDSYFIKKRLEITNNLL--DGKDNLTKLQKSLVDPMFQYVDILHEYENYGSDEQ 271

Query: 260 XXXXXXXXHILNHVYKTRDRILKNNQKLQDNPDQELLDQGFTRPKALVVVPTRATAYDVV 319
                   HILNH+YKTRD++LK+NQ+LQ+N + E LDQGFTRPK L+VVPTR TAY+VV
Sbjct: 272 EYRELYTLHILNHLYKTRDKVLKDNQRLQENNESEFLDQGFTRPKVLIVVPTRDTAYNVV 331

Query: 320 DLLLQQSGIEQVDKKSKFKDQFYDPSLPPASKPKSFQHVFKGNTNDFFVLGMKFTRKAIR 379
           + ++++SG++QV+KK KFK QF++ SLPP+SKPKSFQ +FKGNTNDFFVLG+KFTRKA++
Sbjct: 332 ETIIRKSGLDQVEKKGKFKSQFFEDSLPPSSKPKSFQSIFKGNTNDFFVLGLKFTRKALK 391

Query: 380 LYSNFYQSDVIVCSPLGLQLIIENTDKKKRQDDFLSSIEVMVLDQLHSIEFQNIAHVSNI 439
           LYSNFYQSDVI+CSPLGL +I ENTDKKK+QDDFLSSIE+ +LDQLHS+E+QNI+H+ NI
Sbjct: 392 LYSNFYQSDVIICSPLGLHMITENTDKKKKQDDFLSSIEITILDQLHSMEYQNISHIMNI 451

Query: 440 FAHINKIPQQQRDADFSRIRMWYIEDQAKLFRQTMVFTRYISPFANALLNRKCANWAGRV 499
           F H+NKIP++Q DADFSRIRMWYI DQA+LFRQTM+FT+Y+SP ANA++N KC N AGR 
Sbjct: 452 FEHLNKIPREQHDADFSRIRMWYINDQARLFRQTMIFTKYVSPTANAMINGKCRNIAGRW 511

Query: 500 KSHRVVSAEKSVIGQLGLKLRQIFQRFEVLGGSTVDEPDFRFKFFTSVVVPGIEKTTGYD 559
           ++   +++E+S +G+LGLK+RQIFQRF+++GG+  DEPDFRFKFF SVV+  I K+TGY+
Sbjct: 512 RNKIQLTSEESSLGKLGLKIRQIFQRFDLVGGTLADEPDFRFKFFVSVVMNSILKSTGYE 571

Query: 560 SGILLYIPEYTDFIRVRNYLKDKTRILFGDINEYSDQRQLTSNRALFQLGRIKVLLYTER 619
            GIL+YIP Y+D++RVRNY+K+KT +LFGDINEYSDQR+L SNR+LFQ GR+KVLLYTER
Sbjct: 572 DGILVYIPNYSDYMRVRNYMKEKTTLLFGDINEYSDQRELNSNRSLFQQGRVKVLLYTER 631

Query: 620 LHHFRRFELKGVKSVILYKPPSNPEFYQELLRYIGKSAFLGVADLNIATVRCLYSKMDSL 679
           LHH+RR+E+KGVKSVI Y PP+NPEFY E++R+IGK+AFLG  D+NIATVR +YSK+DSL
Sbjct: 632 LHHYRRYEIKGVKSVIFYGPPTNPEFYNEVVRFIGKNAFLGNVDINIATVRMVYSKLDSL 691

Query: 680 ALERIVGTKRAAVLTHGQNEVYEFK 704
           +LERIVGT+RAAVL+  +NEVYEFK
Sbjct: 692 SLERIVGTQRAAVLSRAENEVYEFK 716

 Score = 40.0 bits (92), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 38/79 (48%), Gaps = 5/79 (6%)

Query: 13 KRGRKQLRNITRIGRAIHVQ-----EDEAKSREEHTVEEAQAGEQTSNRKRGNHPAEDDG 67
          KRGR QLR I R   A         +   K  +E    +A    + +  +  +   E+D 
Sbjct: 9  KRGRSQLRTIQRSKYAKKRNSGRNYDTNTKHNDESKPADALVSGEEAESESDDAKDEEDV 68

Query: 68 GARESQSYGALLTLLSAEH 86
          G + +Q YGALLT+L +EH
Sbjct: 69 GKKRNQVYGALLTILKSEH 87

>TBLA0I01240 Chr9 (265144..266556) [1413 bp, 470 aa] {ON} Anc_2.467
           YMR094W
          Length = 470

 Score = 33.5 bits (75), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 41/152 (26%), Positives = 67/152 (44%), Gaps = 32/152 (21%)

Query: 568 EYTDFIRVRNYLKDKTRILFGDINEYSDQRQLTSNRALFQLGRIKVLLYTERLHHFRRFE 627
           EY   I V N + ++  I+ GDIN+++    +  N  LF++  +K LL  E LH  RR +
Sbjct: 139 EYRKLI-VSNSIGNRKDIMLGDINDFN----VRLNMELFEMSTMKKLL--EYLH--RRNK 189

Query: 628 LKGVKSVILYKP----PSN---------------PEFYQELLRYIGKSAFLGVADLNIAT 668
           L  +  +  Y P     SN                 F+++ LR     +F  ++D NI  
Sbjct: 190 LNIISELKFYDPDIDECSNETKHEDTRVNKQKILENFHKKKLR----DSFYDISDTNIEL 245

Query: 669 VRCLYSKMDSLALERIVGTKRAAVLTHGQNEV 700
           V    ++M  L    I G K   +L +G  ++
Sbjct: 246 VGEYLNRMLRLTNINIQGEKYVEILANGDGKI 277

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 67,307,253
Number of extensions: 2817226
Number of successful extensions: 8446
Number of sequences better than 10.0: 28
Number of HSP's gapped: 8614
Number of HSP's successfully gapped: 46
Length of query: 704
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 587
Effective length of database: 40,065,477
Effective search space: 23518434999
Effective search space used: 23518434999
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 69 (31.2 bits)