Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ADL208W2.293ON50250226590.0
Ecym_33322.293ON51351419120.0
SAKL0E07524g2.293ON47950815550.0
KLTH0G10516g2.293ON47450613510.0
Kwal_27.115002.293ON47550613470.0
Smik_9.892.293ON49150612861e-174
NCAS0B062202.293ON48651112731e-172
Suva_9.1092.293ON49150612701e-171
Skud_9.832.293ON49150812641e-170
CAGL0D04202g2.293ON49951212521e-168
NDAI0B035202.293ON50150812511e-168
YIL090W (ICE2)2.293ON49150812501e-168
KNAG0A053902.293ON49750712421e-167
TDEL0G022302.293ON48851012361e-166
KLLA0E08207g2.293ON48650212151e-163
KAFR0J013302.293ON49151212151e-163
ZYRO0A02024g2.293ON48650811801e-158
Kpol_1003.422.293ON49051511391e-151
TPHA0C034402.293ON57954611001e-144
TBLA0B059802.293ON4935159901e-129
TBLA0B069902.293ON5365469401e-121
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADL208W
         (502 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADL208W Chr4 (337118..338626) [1509 bp, 502 aa] {ON} Syntenic ho...  1028   0.0  
Ecym_3332 Chr3 (634314..635855) [1542 bp, 513 aa] {ON} similar t...   741   0.0  
SAKL0E07524g Chr5 complement(609285..610724) [1440 bp, 479 aa] {...   603   0.0  
KLTH0G10516g Chr7 (889468..890892) [1425 bp, 474 aa] {ON} simila...   525   0.0  
Kwal_27.11500 s27 complement(825779..827206) [1428 bp, 475 aa] {...   523   0.0  
Smik_9.89 Chr9 (172734..174209) [1476 bp, 491 aa] {ON} YIL090W (...   499   e-174
NCAS0B06220 Chr2 complement(1173970..1175430) [1461 bp, 486 aa] ...   494   e-172
Suva_9.109 Chr9 (187818..189293) [1476 bp, 491 aa] {ON} YIL090W ...   493   e-171
Skud_9.83 Chr9 (170322..171797) [1476 bp, 491 aa] {ON} YIL090W (...   491   e-170
CAGL0D04202g Chr4 (414049..415548) [1500 bp, 499 aa] {ON} simila...   486   e-168
NDAI0B03520 Chr2 complement(885459..886964) [1506 bp, 501 aa] {O...   486   e-168
YIL090W Chr9 (193595..195070) [1476 bp, 491 aa] {ON}  ICE2Integr...   486   e-168
KNAG0A05390 Chr1 complement(793701..795194) [1494 bp, 497 aa] {O...   483   e-167
TDEL0G02230 Chr7 (437121..438587) [1467 bp, 488 aa] {ON} Anc_2.2...   480   e-166
KLLA0E08207g Chr5 complement(740213..741673) [1461 bp, 486 aa] {...   472   e-163
KAFR0J01330 Chr10 complement(243571..245046) [1476 bp, 491 aa] {...   472   e-163
ZYRO0A02024g Chr1 (167059..168519) [1461 bp, 486 aa] {ON} simila...   459   e-158
Kpol_1003.42 s1003 (100704..102176) [1473 bp, 490 aa] {ON} (1007...   443   e-151
TPHA0C03440 Chr3 (752685..754424) [1740 bp, 579 aa] {ON} Anc_2.2...   428   e-144
TBLA0B05980 Chr2 (1412745..1414226) [1482 bp, 493 aa] {ON} Anc_2...   385   e-129
TBLA0B06990 Chr2 (1649581..1651191) [1611 bp, 536 aa] {ON}            366   e-121

>ADL208W Chr4 (337118..338626) [1509 bp, 502 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL090W
          Length = 502

 Score = 1028 bits (2659), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 502/502 (100%), Positives = 502/502 (100%)

Query: 1   MVPKGLLRSLRFALASFYLFLVLITVPISFQIGGLYCGLSFTVTLFILYFVTTTLKITAA 60
           MVPKGLLRSLRFALASFYLFLVLITVPISFQIGGLYCGLSFTVTLFILYFVTTTLKITAA
Sbjct: 1   MVPKGLLRSLRFALASFYLFLVLITVPISFQIGGLYCGLSFTVTLFILYFVTTTLKITAA 60

Query: 61  TRGDEWKHIASTLYYLQHFLMPSILFLFLSGFNNDQLQKKLVGSDPKGARGGFIFDGNMN 120
           TRGDEWKHIASTLYYLQHFLMPSILFLFLSGFNNDQLQKKLVGSDPKGARGGFIFDGNMN
Sbjct: 61  TRGDEWKHIASTLYYLQHFLMPSILFLFLSGFNNDQLQKKLVGSDPKGARGGFIFDGNMN 120

Query: 121 ESLLQLLGRSRDDRATMAYLHYYRYVVRPWQYMLLHATPCFTLTEGFFTVLAIQVIGETG 180
           ESLLQLLGRSRDDRATMAYLHYYRYVVRPWQYMLLHATPCFTLTEGFFTVLAIQVIGETG
Sbjct: 121 ESLLQLLGRSRDDRATMAYLHYYRYVVRPWQYMLLHATPCFTLTEGFFTVLAIQVIGETG 180

Query: 181 RWLRYKRNSTAWVISSLMVSGVVITTSMYYLYRIYVTPIWPLSVHTATLLGFTLSLVFGL 240
           RWLRYKRNSTAWVISSLMVSGVVITTSMYYLYRIYVTPIWPLSVHTATLLGFTLSLVFGL
Sbjct: 181 RWLRYKRNSTAWVISSLMVSGVVITTSMYYLYRIYVTPIWPLSVHTATLLGFTLSLVFGL 240

Query: 241 GLYGIISGKGSAIESSLFFAYMVHCIYEISPQLALTAMSEIFQVVHNTWQMQQGTLPKNS 300
           GLYGIISGKGSAIESSLFFAYMVHCIYEISPQLALTAMSEIFQVVHNTWQMQQGTLPKNS
Sbjct: 241 GLYGIISGKGSAIESSLFFAYMVHCIYEISPQLALTAMSEIFQVVHNTWQMQQGTLPKNS 300

Query: 301 LLAYYKNFILNAENLWDVLLKKAFLLHSVELDQAPSSVVVKDALVLVQQQWWNKSQQLWS 360
           LLAYYKNFILNAENLWDVLLKKAFLLHSVELDQAPSSVVVKDALVLVQQQWWNKSQQLWS
Sbjct: 301 LLAYYKNFILNAENLWDVLLKKAFLLHSVELDQAPSSVVVKDALVLVQQQWWNKSQQLWS 360

Query: 361 FTKNFSAGIPRSIHEIFIVTLGLARESINAAVVSNLVFRVIVFYSATRIIPALQRATGGT 420
           FTKNFSAGIPRSIHEIFIVTLGLARESINAAVVSNLVFRVIVFYSATRIIPALQRATGGT
Sbjct: 361 FTKNFSAGIPRSIHEIFIVTLGLARESINAAVVSNLVFRVIVFYSATRIIPALQRATGGT 420

Query: 421 QSRKLMRIIYWYSPCIVIAMYTHMILRYSGELNNELCIWGCFPWLQSEANRDRWVVDAWG 480
           QSRKLMRIIYWYSPCIVIAMYTHMILRYSGELNNELCIWGCFPWLQSEANRDRWVVDAWG
Sbjct: 421 QSRKLMRIIYWYSPCIVIAMYTHMILRYSGELNNELCIWGCFPWLQSEANRDRWVVDAWG 480

Query: 481 FWNWCNLFFTLLIYAVELIGSR 502
           FWNWCNLFFTLLIYAVELIGSR
Sbjct: 481 FWNWCNLFFTLLIYAVELIGSR 502

>Ecym_3332 Chr3 (634314..635855) [1542 bp, 513 aa] {ON} similar to
           Ashbya gossypii ADL208W
          Length = 513

 Score =  741 bits (1912), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/514 (74%), Positives = 436/514 (84%), Gaps = 13/514 (2%)

Query: 1   MVPKGLLRSLRFALASFYLFLVLITVPISFQIGGLYCGLSFTVTLFILYFVTTTLKITAA 60
           M+ +GLLRS+RF+LA FYLFLVLIT+PISFQ+GGLYCGLSFTVTLFILYF TTTLKIT  
Sbjct: 1   MLSRGLLRSIRFSLAIFYLFLVLITIPISFQVGGLYCGLSFTVTLFILYFTTTTLKITTT 60

Query: 61  TRGDEWKHIASTLYYLQHFLMPSILFLFLSGFNNDQLQKKLVGSDPKGARG-GFIFDGNM 119
               ++K +AS +YYLQHFL+PSILFLFLS FN+DQLQ+ LV SD  GA   GFIF+GN+
Sbjct: 61  NGSGKFKLLASLIYYLQHFLIPSILFLFLSAFNSDQLQR-LVDSDAVGASSKGFIFEGNV 119

Query: 120 NESLLQLLGRSRDDRATMA-YLHYYRYVVRPWQYMLLHATPCFTLTEGFFTVLAIQVIGE 178
           NESLLQLL     +  ++A Y +YY+Y+V+PWQYMLLHATP FTLTEGFFTVLAIQ IGE
Sbjct: 120 NESLLQLLSLPPGNEGSVASYYYYYKYIVKPWQYMLLHATPYFTLTEGFFTVLAIQAIGE 179

Query: 179 TGRWLRYKRNSTAWVISSLMVSGVVITTSMYYLYRIYVTPIWPLSVHTATLLGFTLSLVF 238
           TGRWLRYK+NS  WVI SL+VSGVVITTSM+YLYRIYVTPIWPLSV TATLLGFTLSLVF
Sbjct: 180 TGRWLRYKKNSNTWVILSLLVSGVVITTSMFYLYRIYVTPIWPLSVQTATLLGFTLSLVF 239

Query: 239 GLGLYGIISGKGSAIESSLFFAYMVHCIYEISPQLALTAMSEIFQVVHNTWQMQQGTLPK 298
           GLGLYGIISGKGS IESSLFFAYMV CIYEISPQLALTAM+EIFQVVH+TWQ+QQGTL K
Sbjct: 240 GLGLYGIISGKGSTIESSLFFAYMVRCIYEISPQLALTAMTEIFQVVHDTWQLQQGTLSK 299

Query: 299 NSLLAYYKNFILNAENLWDVLLKKAFLLHSVELDQA--------P-SSVVVKDALVLVQQ 349
           N+LL YY  F+ NAE+ WD LLKK  +  +   ++         P +S + KD L+++Q 
Sbjct: 300 NNLLTYYNTFVSNAESFWDSLLKKTAIGTAAAAEETYTIFGYSMPFTSTIAKDTLIILQT 359

Query: 350 QWWNKSQQLWSFTKNFSAGIPRSIHEIFIVTLGLARESINAAVVSNLVFRVIVFYSATRI 409
           QWW K QQ+WSFTKNFS GIPRSIHEI +VTL +A+ESIN AV++NLVFRV+VFYSATRI
Sbjct: 360 QWWLKCQQIWSFTKNFSVGIPRSIHEILMVTLKMAKESINPAVITNLVFRVLVFYSATRI 419

Query: 410 IPALQRATGGTQSRKLMRIIYWYSPCIVIAMYTHMILRYSGELNNELCIWGCFPWLQ-SE 468
           IPALQ+ATG TQSRKLMRIIYWYSPCIVIAMYTH+ILRYSGELNN+LCIWGCFPWL  S 
Sbjct: 420 IPALQKATGATQSRKLMRIIYWYSPCIVIAMYTHLILRYSGELNNDLCIWGCFPWLNFSA 479

Query: 469 ANRDRWVVDAWGFWNWCNLFFTLLIYAVELIGSR 502
             R +WVVDAW FWNWCNLFFTLLIYAVELIGSR
Sbjct: 480 KTRSKWVVDAWSFWNWCNLFFTLLIYAVELIGSR 513

>SAKL0E07524g Chr5 complement(609285..610724) [1440 bp, 479 aa] {ON}
           similar to uniprot|P40499 Saccharomyces cerevisiae
           YIL090W ICE2 Integral ER membrane protein with type-III
           transmembrane domains mutations cause defects in
           cortical ER morphology in both the mother and daughter
           cells
          Length = 479

 Score =  603 bits (1555), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/508 (58%), Positives = 377/508 (74%), Gaps = 37/508 (7%)

Query: 1   MVPKGLLRSLRFALASFYLFLVLITVPISFQIGGLYCGLSFTVTLFILYFVTTTLKITAA 60
           M+P+ L++S+R  L +FYL LVLIT+PISFQ+GGLYCGLSFTVTLF LYF+TTTLKI + 
Sbjct: 1   MLPRSLIQSIRGCLTTFYLLLVLITIPISFQVGGLYCGLSFTVTLFNLYFLTTTLKIVSK 60

Query: 61  TRGDEWKHIASTLYYLQHFLMPSILFLFLSGFNNDQLQKKLVGSDPKGARGGFIFDGNMN 120
                +  I S +YYLQHF++PS+LFLFLSGFNND+L++++              DG++N
Sbjct: 61  KYNRLYYSITSFVYYLQHFIIPSLLFLFLSGFNNDELKRQI--------------DGDVN 106

Query: 121 ---ESLLQLLGRSRDDRATMAYLHYYRYVVRPWQYMLLHATPCFTLTEGFFTVLAIQVIG 177
              ESL+  L       + + Y +YY++ V+PWQ++LLH+TP FTL EGFFTVL IQ IG
Sbjct: 107 LPRESLVNFLRNKSGKHSWIFYYYYYKFTVKPWQFVLLHSTPYFTLLEGFFTVLGIQAIG 166

Query: 178 ETGRWLRYKRNSTAWVISSLMVSGVVITTSMYYLYRIYVTPIWPLSVHTATLLGFTLSLV 237
           ET +WLRY +NS  W+I SL++SG VITTS+YYLYRIYVTP+W LS+ TA+LLGFTLS+V
Sbjct: 167 ETNKWLRYHKNSNTWIIVSLLISGGVITTSLYYLYRIYVTPVWELSIQTASLLGFTLSIV 226

Query: 238 FGLGLYGIISGKGSAIESSLFFAYMVHCIYEISPQLALTAMSEIFQVVHNTWQMQQGTLP 297
            GLGLYGI+SGKGS IESSLFFAY+V CIYEISPQLA +AM EIF++V +TWQ  QG LP
Sbjct: 227 CGLGLYGIVSGKGSVIESSLFFAYIVRCIYEISPQLATSAMDEIFKIVKDTWQKHQGNLP 286

Query: 298 KNSLLAYYKNFIL-NAENLWDVLLKKAFLLHSVELDQAPSSVVVKDALVLVQQQWWNKSQ 356
            ++LL+YY+N +L N E +WD +++K           +PS+           Q  W + Q
Sbjct: 287 TDNLLSYYRNVVLKNGEMIWDAIVQKTG-------TTSPSTT----------QMVWLRLQ 329

Query: 357 QLWSFTKNFSAGIPRSIHEIFIVTLGLARESINAAVVSNLVFRVIVFYSATRIIPALQR- 415
            LW FTKNF+  +P SI EIF VTL +A ES+   VV NLVFR++VFYSATRIIPALQ+ 
Sbjct: 330 PLWKFTKNFTISVPSSIREIFRVTLKMATESVTPTVVINLVFRILVFYSATRIIPALQKD 389

Query: 416 -ATGGTQSRKLMRIIYWYSPCIVIAMYTHMILRYSGELNNELCIWGCFPWLQSEANRDRW 474
            + G   SR+LMR+IYWYSPCIVIAMYTH+IL+YSGELNN+LC+WGCFPW  +     + 
Sbjct: 390 DSNGRKSSRRLMRLIYWYSPCIVIAMYTHLILQYSGELNNDLCLWGCFPWSHTNDPSSKV 449

Query: 475 VVDAWGFWNWCNLFFTLLIYAVELIGSR 502
           VVDAWGFWNWCN+F TL IY +ELIG +
Sbjct: 450 VVDAWGFWNWCNVFCTLAIYGLELIGGK 477

>KLTH0G10516g Chr7 (889468..890892) [1425 bp, 474 aa] {ON} similar
           to uniprot|P40499 Saccharomyces cerevisiae YIL090W ICE2
           Integral ER membrane protein with type-III transmembrane
           domains mutations cause defects in cortical ER
           morphology in both the mother and daughter cells
          Length = 474

 Score =  525 bits (1351), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/506 (55%), Positives = 363/506 (71%), Gaps = 37/506 (7%)

Query: 1   MVPKGLLRSLRFALASFYLFLVLITVPISFQIGGLYCGLSFTVTLFILYFVTTTLKITAA 60
           M P+ +++S R  L SFYL L+LIT+PISFQ+GGLYCGLSFTVTLF LY +TTTLKI A 
Sbjct: 1   MFPRSVIQSARVCLTSFYLLLILITIPISFQVGGLYCGLSFTVTLFNLYLITTTLKIAAR 60

Query: 61  TRGDEWKHIASTLYYLQHFLMPSILFLFLSGFNNDQLQKKLVGSDPKGARGGFIFDGNM- 119
            RG     +AS  YY QHF +PS+LFLFLSGF+ND+L++++              D N  
Sbjct: 61  ARG--LAKLASAAYYAQHFFIPSLLFLFLSGFSNDELKRQI--------------DTNTR 104

Query: 120 -NESLLQLLGRSRDDRATMAYLHYYRYVVRPWQYMLLHATPCFTLTEGFFTVLAIQVIGE 178
            +ESL+ LL  +   +  + Y +YY+YVVRPWQ+MLL +TP FTL EGFFTVL IQ +GE
Sbjct: 105 PDESLIDLLRSTTQSQTWVFYYYYYQYVVRPWQFMLLRSTPYFTLLEGFFTVLGIQAVGE 164

Query: 179 TGRWLRYKRNSTAWVISSLMVSGVVITTSMYYLYRIYVTPIWPLSVHTATLLGFTLSLVF 238
           T RWL     S  WVIS LM SG VIT ++YYLYRIYVTPIW LSV TA+LLGFT S+V 
Sbjct: 165 TNRWLSRGNGSNMWVISGLMASGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVS 224

Query: 239 GLGLYGIISGKGSAIESSLFFAYMVHCIYEISPQLALTAMSEIFQVVHNTWQMQQGTL-P 297
           GLG+YGI+SG+GS IESSLFFAY+V C+YEISPQLA +AM EIF +V  TW  Q  +L  
Sbjct: 225 GLGIYGIVSGRGSTIESSLFFAYIVRCLYEISPQLATSAMDEIFTLVKETWHNQHRSLRS 284

Query: 298 KNSLLAYYKNFIL-NAENLWDVLLKKAFLLHSVELDQAPSSVVVKDALVLVQQQWWNKSQ 356
            ++LL YY++ IL N E +WD +L +     +V +  + + V             WN+ Q
Sbjct: 285 SDTLLTYYRDIILKNGEMVWDAILART----NVNVGASGTPVWAS----------WNRVQ 330

Query: 357 QLWSFTKNFSAGIPRSIHEIFIVTLGLARESINAAVVSNLVFRVIVFYSATRIIPALQRA 416
            LW F K+F++ +P SI EIF +TL +ARE+I  AVV NL FR+++FYSATRIIPALQ+ 
Sbjct: 331 PLWKFVKHFTSSVPSSIQEIFYLTLEMAREAIAPAVVINLCFRILIFYSATRIIPALQKK 390

Query: 417 TGGTQSRKLMRIIYWYSPCIVIAMYTHMILRYSGELNNELCIWGCFPWLQSEANRDRWVV 476
               +SR+ MR++YWYSPCIVIAMYTH+IL+YSG+++N+LC+WGCFPW  S  +  + VV
Sbjct: 391 -HKRRSRRFMRMLYWYSPCIVIAMYTHLILQYSGQISNDLCLWGCFPW--SVPDTPKVVV 447

Query: 477 DAWGFWNWCNLFFTLLIYAVELIGSR 502
           D+WGFWNWCN+F T+ IYA EL+GS+
Sbjct: 448 DSWGFWNWCNIFCTMAIYASELLGSK 473

>Kwal_27.11500 s27 complement(825779..827206) [1428 bp, 475 aa] {ON}
           YIL090W - Hypothetical ORF [contig 27] FULL
          Length = 475

 Score =  523 bits (1347), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/506 (55%), Positives = 363/506 (71%), Gaps = 37/506 (7%)

Query: 1   MVPKGLLRSLRFALASFYLFLVLITVPISFQIGGLYCGLSFTVTLFILYFVTTTLKITAA 60
           M+P+ +L+S+R  L SFYL L+LIT+PI+FQ+GGLYCGLSFTVTLF LY +TTTLKI A 
Sbjct: 1   MIPRSILQSIRVCLTSFYLLLILITIPIAFQVGGLYCGLSFTVTLFNLYLITTTLKIAAR 60

Query: 61  TRGDEWKHIASTLYYLQHFLMPSILFLFLSGFNNDQLQKKLVGSDPKGARGGFIFDGNM- 119
            RG  +  +AS  YY QHF +PS+LFLFLSGF+ND+L+ ++              D N  
Sbjct: 61  ARG--FAKLASAAYYAQHFFIPSLLFLFLSGFSNDELKHQI--------------DTNTR 104

Query: 120 -NESLLQLLGRSRDDRATMAYLHYYRYVVRPWQYMLLHATPCFTLTEGFFTVLAIQVIGE 178
            +ESL+ LL  S   +  + Y +YY YVVRPWQ++LL +TP FTL EGFFTVL IQ +GE
Sbjct: 105 PDESLIDLLRSSTHSQPWIFYYYYYHYVVRPWQFLLLRSTPYFTLLEGFFTVLGIQAVGE 164

Query: 179 TGRWLRYKRNSTAWVISSLMVSGVVITTSMYYLYRIYVTPIWPLSVHTATLLGFTLSLVF 238
           T RWL     S  WVIS LM SG VIT ++YYLYRIYVTPIW LSV TA+LLGFT S+V 
Sbjct: 165 TNRWLSRGHGSNVWVISGLMTSGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVS 224

Query: 239 GLGLYGIISGKGSAIESSLFFAYMVHCIYEISPQLALTAMSEIFQVVHNTWQMQQGTL-P 297
           GLG++GI+SG+GS IESSLFFAY+V C+YEISPQLA +AM EI  +V +TW  Q  +L  
Sbjct: 225 GLGIFGIVSGRGSTIESSLFFAYIVRCLYEISPQLATSAMDEISNLVKDTWHNQHRSLRS 284

Query: 298 KNSLLAYYKNFIL-NAENLWDVLLKKAFLLHSVELDQAPSSVVVKDALVLVQQQWWNKSQ 356
            ++ LAYY++ IL N E +WD +L +     +V +  A     +           W++ Q
Sbjct: 285 SDTFLAYYRDIILKNGEMIWDAVLART----NVNVSGAGPVAWIS----------WHRVQ 330

Query: 357 QLWSFTKNFSAGIPRSIHEIFIVTLGLARESINAAVVSNLVFRVIVFYSATRIIPALQRA 416
            LW F K+F++ +P SI EIF++TL +ARE+I  AVV NL FR+++FYSATRIIPALQR 
Sbjct: 331 PLWKFVKHFTSSVPSSIQEIFLLTLSMAREAIAPAVVINLCFRILIFYSATRIIPALQRK 390

Query: 417 TGGTQSRKLMRIIYWYSPCIVIAMYTHMILRYSGELNNELCIWGCFPWLQSEANRDRWVV 476
               +SR+ MR++YWYSPCIVIAMYTH+I++YSG+++N+LC+WGCFPW   E ++   VV
Sbjct: 391 H-KRRSRRFMRMLYWYSPCIVIAMYTHLIMQYSGQISNDLCLWGCFPWSPPEGSKV--VV 447

Query: 477 DAWGFWNWCNLFFTLLIYAVELIGSR 502
           D+WGFWNWCN+F T+ IYA EL GS+
Sbjct: 448 DSWGFWNWCNIFCTMAIYASELFGSK 473

>Smik_9.89 Chr9 (172734..174209) [1476 bp, 491 aa] {ON} YIL090W
           (REAL)
          Length = 491

 Score =  499 bits (1286), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 264/506 (52%), Positives = 345/506 (68%), Gaps = 30/506 (5%)

Query: 4   KGLLRSLRFALASFYLFLVLITVPISFQIGGLYCGLSFTVTLFILYFVTTTLKITAATRG 63
           K  ++S R   A FYL   L+++PISF++GGL CGLSFTVTLF LYF+TTTL + A   G
Sbjct: 6   KSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVLARRYG 65

Query: 64  DE-WKHIASTLYYLQHFLMPSILFLFLSGFNNDQLQKKLVGSDPKGARGGFIFDGNMNES 122
            + +  + S LYY QHF++ S+L+LFLSGF+ND+L   L                N +ES
Sbjct: 66  GKLYIFLTSCLYYSQHFIIASLLYLFLSGFSNDELGNVLKKRP------------NESES 113

Query: 123 LLQLLGRSRDDRAT--MAYLHYYRYVVRPWQYMLLHATPCFTLTEGFFTVLAIQVIGETG 180
            L+ L  S +      + Y +Y+R+VV+PWQ++L  +TP FTL+EGFFT+LAIQ +GET 
Sbjct: 114 FLEALKNSLNSNQINYVLYYYYFRFVVQPWQFILTKSTPFFTLSEGFFTILAIQAVGETN 173

Query: 181 RWLRYKRNSTAWVISSLMVSGVVITTSMYYLYRIYVTPIWPLSVHTATLLGFTLSLVFGL 240
           RWL    NS  W+ISSL+ SG VIT S+YYLYRIYVTPIWPLS+ TA+LLGF LS+V GL
Sbjct: 174 RWLSNDLNSNTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGL 233

Query: 241 GLYGIISGKGSAIESSLFFAYMVHCIYEISPQLALTAMSEIFQVVHNTWQMQQGTLP-KN 299
           GLYGI+S KGS IESSLFFAY+V CIYEISP+LA TA  EI  +  + WQ  Q  LP  +
Sbjct: 234 GLYGIVSQKGSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTAD 293

Query: 300 SLLAYYKNFIL-NAENLWDVLLKKAFLLHSVELDQAPSSVVVKDALVLVQQQWWNKSQQL 358
           +LL Y+ N IL NAE LW   + +     + +      SV+  + + L+       S+  
Sbjct: 294 NLLCYFHNVILKNAEMLWGSFIPRG-RKKTGDFHDKLISVLSFEKVSLI-------SKPF 345

Query: 359 WSFTKNFSAGIPRSIHEIFIVTLGLARESINAAVVSNLVFRVIVFYSATRIIPALQRATG 418
           W F KNF+  +P SI+E   VT+ +A ES++ A+V NL FRV++FYSATRIIPALQR   
Sbjct: 346 WKFFKNFTFSVPLSINEFCQVTIKMASESVSPAIVVNLCFRVLMFYSATRIIPALQRKND 405

Query: 419 GT--QSRKLMRIIYWYSPCIVIAMYTHMILRYSGELNNELCIWGCF-PWLQSEANRDRWV 475
               +SR++M+ +YWYSPCI+IAMYTH+IL+YSGEL  +LCIWGC   W  S+  +   +
Sbjct: 406 KQLRKSRRIMKGLYWYSPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGSD--QPEII 463

Query: 476 VDAWGFWNWCNLFFTLLIYAVELIGS 501
           VD+WGFWNWCN+F T+L+YA ELIGS
Sbjct: 464 VDSWGFWNWCNIFCTILVYATELIGS 489

>NCAS0B06220 Chr2 complement(1173970..1175430) [1461 bp, 486 aa]
           {ON} Anc_2.293 YIL090W
          Length = 486

 Score =  494 bits (1273), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 262/511 (51%), Positives = 346/511 (67%), Gaps = 41/511 (8%)

Query: 1   MVPKGLLRSLRFALASFYLFLVLITVPISFQIGGLYCGLSFTVTLFILYFVTTTLKITAA 60
           M+    +R +R   A+FYL   LI++PISF+IGGL+CGL+FTV+LFILYF++TTL I A 
Sbjct: 1   MISSSFIRGIRICSATFYLLFTLISIPISFKIGGLHCGLAFTVSLFILYFLSTTLSIWAR 60

Query: 61  TRGDEWKHIAST--LYYLQHFLMPSILFLFLSGFNNDQLQKKLVGSDPKGARGGFIFDGN 118
             G    HI  T  LYY QHF++ S+L+LFLSGF+N+QL   L   +        IF  N
Sbjct: 61  KYGSR-IHILLTNILYYFQHFIIASLLYLFLSGFSNEQLSSMLRDGNKPIDSIADIFKKN 119

Query: 119 MNESLLQLLGRSRDDRATMAYLHYYRYVVRPWQYMLLHATPCFTLTEGFFTVLAIQVIGE 178
           +  S              + Y +YYR+ V+PWQ++L ++TP FTL+EGFFT+LAIQ IGE
Sbjct: 120 VASS---------TQANWVLYYYYYRFFVQPWQFILSYSTPFFTLSEGFFTILAIQAIGE 170

Query: 179 TGRWLRYKRNSTAWVISSLMVSGVVITTSMYYLYRIYVTPIWPLSVHTATLLGFTLSLVF 238
           T +WL Y+ NS  WVISSL+ SG VIT S+YYLYRIYVTPIW LSV TA+LLGFTLSLV 
Sbjct: 171 TNKWLVYEINSNTWVISSLLASGGVITASLYYLYRIYVTPIWQLSVQTASLLGFTLSLVG 230

Query: 239 GLGLYGIISGKGSAIESSLFFAYMVHCIYEISPQLALTAMSEIFQVVHNTWQMQQGTLPK 298
           GLG+YGI++ KGS IESS+FFAY+V CIYEISP+LA TA  EI +V    WQ  Q  L  
Sbjct: 231 GLGIYGIVTDKGSVIESSVFFAYIVRCIYEISPKLATTATEEILEVFKEVWQRHQANLTS 290

Query: 299 -NSLLAYYKNFIL-NAENLWDVLLKKAFLLHSVELDQAPSSVVVKDALVLVQQQWWNKSQ 356
            N+LL+YY N +L N E +W+     +F ++      + S+  V    +           
Sbjct: 291 PNNLLSYYHNVVLKNIETIWE-----SFKINDNSFITSFSTERVITIFM----------- 334

Query: 357 QLWSFTKNFSAGIPRSIHEIFIVTLGLARESINAAVVSNLVFRVIVFYSATRIIPALQRA 416
            +W   K F+  +P SI+E+  VT  +A ESI+ AV+ NL FRV++FYSATRIIPALQR 
Sbjct: 335 PIWKLLKTFTITVPSSINELCFVTYKMACESISPAVIVNLCFRVLIFYSATRIIPALQRR 394

Query: 417 TGGT--QSRKLMRIIYWYSPCIVIAMYTHMILRYSGELNNELCIWGC----FPWLQSEAN 470
                 +SR++M+++YWYSPCI+IAMY H+IL+YSGEL +ELC+WGC    FP     ++
Sbjct: 395 DDNELRKSRRIMKVLYWYSPCILIAMYAHLILQYSGELKDELCLWGCNSKIFP-----SD 449

Query: 471 RDRWVVDAWGFWNWCNLFFTLLIYAVELIGS 501
           + + +VD+WGFWNWCN+FFT+L+YA ELIG+
Sbjct: 450 QPKIIVDSWGFWNWCNIFFTILVYASELIGT 480

>Suva_9.109 Chr9 (187818..189293) [1476 bp, 491 aa] {ON} YIL090W
           (REAL)
          Length = 491

 Score =  493 bits (1270), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 264/506 (52%), Positives = 344/506 (67%), Gaps = 30/506 (5%)

Query: 4   KGLLRSLRFALASFYLFLVLITVPISFQIGGLYCGLSFTVTLFILYFVTTTLKITAATRG 63
           K  ++S R   A FYL   L+++PISF++GGL CGLSFTVTLF LYF+TTTL + A   G
Sbjct: 6   KSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVLARRNG 65

Query: 64  DE-WKHIASTLYYLQHFLMPSILFLFLSGFNNDQLQKKLVGSDPKGARGGFIFDGNMNES 122
              +  + S LYY QHF++ S+LFLFLSGF+ND+L   L                N +ES
Sbjct: 66  GRLYIFLTSCLYYSQHFVIASLLFLFLSGFSNDELGNVLKNRS------------NESES 113

Query: 123 LLQLLGRSRDDRATMAYLHYY--RYVVRPWQYMLLHATPCFTLTEGFFTVLAIQVIGETG 180
            L+ L  S +       L+YY  R+VV+PWQ++L  +TP FTL+EGFFT+LAIQ +GET 
Sbjct: 114 FLEALKNSLNSNQINYVLYYYYYRFVVQPWQFILTKSTPFFTLSEGFFTILAIQAVGETN 173

Query: 181 RWLRYKRNSTAWVISSLMVSGVVITTSMYYLYRIYVTPIWPLSVHTATLLGFTLSLVFGL 240
           RWL    NS  W+ISSL+ SG VIT S+YYLYRIYVTPIWPLS+ TA+LLGF LS+V GL
Sbjct: 174 RWLSNDLNSNTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGL 233

Query: 241 GLYGIISGKGSAIESSLFFAYMVHCIYEISPQLALTAMSEIFQVVHNTWQMQQGTLP-KN 299
           GLYGI+S +GS IESSLFFAY+V CIYEISP+LA TA  EI  +  + WQ  Q  LP  +
Sbjct: 234 GLYGIVSQRGSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTAD 293

Query: 300 SLLAYYKNFIL-NAENLWDVLLKKAFLLHSVELDQAPSSVVVKDALVLVQQQWWNKSQQL 358
           +LL Y+ N IL NAE LW   + +     S +L +   S++  + + L+       S+  
Sbjct: 294 NLLCYFHNVILKNAEVLWGSFIPRRRKTTS-DLHEKIISILSFEKVSLI-------SKPF 345

Query: 359 WSFTKNFSAGIPRSIHEIFIVTLGLARESINAAVVSNLVFRVIVFYSATRIIPALQRATG 418
           W F KNF+  +P SI+E   VT+ +A ES++ A+V NL FRV++FYSATRIIPALQR   
Sbjct: 346 WRFCKNFTFSVPLSINEFCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRKND 405

Query: 419 GT--QSRKLMRIIYWYSPCIVIAMYTHMILRYSGELNNELCIWGCF-PWLQSEANRDRWV 475
               +SR++M+ +YWYSPCI+IAMYTH+IL+YSGEL  +LCIWGC   W   +  +   +
Sbjct: 406 KQLRKSRRIMKGLYWYSPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGPD--QPEII 463

Query: 476 VDAWGFWNWCNLFFTLLIYAVELIGS 501
           VD+WGFWNWCN+F T+L+YA EL+GS
Sbjct: 464 VDSWGFWNWCNIFCTILVYATELVGS 489

>Skud_9.83 Chr9 (170322..171797) [1476 bp, 491 aa] {ON} YIL090W
           (REAL)
          Length = 491

 Score =  491 bits (1264), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 263/508 (51%), Positives = 344/508 (67%), Gaps = 30/508 (5%)

Query: 2   VPKGLLRSLRFALASFYLFLVLITVPISFQIGGLYCGLSFTVTLFILYFVTTTLKITAAT 61
           + K  ++S R   A FYL   L+++PISF++GGL CGLSFTVTLF LYF+TTTL + A  
Sbjct: 4   LSKSFMQSGRVCAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVLAKR 63

Query: 62  RGDE-WKHIASTLYYLQHFLMPSILFLFLSGFNNDQLQKKLVGSDPKGARGGFIFDGNMN 120
            G + +  + + LYY QHF++ S+L+LFLSGF+ND+L   L                N +
Sbjct: 64  HGGKLYIFLTNCLYYSQHFVIASLLYLFLSGFSNDELGNVLKNRS------------NES 111

Query: 121 ESLLQLLGRSRDDRATMAYLHYY--RYVVRPWQYMLLHATPCFTLTEGFFTVLAIQVIGE 178
           ES L  L  S +       L+YY  R+VV+PWQ++L  +TP FTL+EGFFT+LAIQ +GE
Sbjct: 112 ESFLDALKDSLNSNQINYVLYYYYYRFVVQPWQFVLTKSTPFFTLSEGFFTILAIQAVGE 171

Query: 179 TGRWLRYKRNSTAWVISSLMVSGVVITTSMYYLYRIYVTPIWPLSVHTATLLGFTLSLVF 238
           T RWL    NS  W+ISSL+ SG VIT S+YYLYRIYVTPIWPLS+ TA+LLGF LS+V 
Sbjct: 172 TNRWLSNDLNSNTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVC 231

Query: 239 GLGLYGIISGKGSAIESSLFFAYMVHCIYEISPQLALTAMSEIFQVVHNTWQMQQGTLP- 297
           GLGLYGI+S KGS IESSLFFAY+V CIYEISP+LA TA  EI  +  + WQ  Q  LP 
Sbjct: 232 GLGLYGIVSQKGSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPT 291

Query: 298 KNSLLAYYKNFIL-NAENLWDVLLKKAFLLHSVELDQAPSSVVVKDALVLVQQQWWNKSQ 356
            ++LL Y+ N +L NAE LW   + +     + +      S++  + + L+       S+
Sbjct: 292 ADNLLCYFHNVVLKNAEMLWGSFIPRG-RKKTGDFHDKIISILSFEKVSLI-------SR 343

Query: 357 QLWSFTKNFSAGIPRSIHEIFIVTLGLARESINAAVVSNLVFRVIVFYSATRIIPALQRA 416
             W F KNF+  +P SI+E   VT+ +A ES++ A+V NL FRV++FYSATRIIPALQR 
Sbjct: 344 PFWKFFKNFTFSVPLSINEFCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRK 403

Query: 417 TGGT--QSRKLMRIIYWYSPCIVIAMYTHMILRYSGELNNELCIWGCF-PWLQSEANRDR 473
                 +SR++MR +YWYSPCI+IAMYTH+IL+YSGEL  +LCIWGC   W  +E  +  
Sbjct: 404 NDKQLRKSRRIMRGLYWYSPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFGAE--QPE 461

Query: 474 WVVDAWGFWNWCNLFFTLLIYAVELIGS 501
            +VD+WGFWNWCN+F T+L+YA ELIGS
Sbjct: 462 IIVDSWGFWNWCNIFCTILVYATELIGS 489

>CAGL0D04202g Chr4 (414049..415548) [1500 bp, 499 aa] {ON} similar
           to uniprot|P40499 Saccharomyces cerevisiae YIL090w
          Length = 499

 Score =  486 bits (1252), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 252/512 (49%), Positives = 359/512 (70%), Gaps = 31/512 (6%)

Query: 1   MVPKGLLRSLRFALASFYLFLVLITVPISFQIGGLYCGLSFTVTLFILYFVTTTLKITAA 60
           ++ +G+ RS+R + A+ YL L L+++PISF+IGGL CGLSFTVTLF LY ++TTL + A 
Sbjct: 3   LITEGVQRSIRISSAALYLVLTLVSIPISFKIGGLQCGLSFTVTLFNLYLISTTLSVLAR 62

Query: 61  TRGDE-WKHIASTLYYLQHFLMPSILFLFLSGFNNDQLQKKLVGSDPKGARGGFIFDGNM 119
              +  +    S LYY QH ++  +LFLFLSGF+N++  + L    P G+      DG+ 
Sbjct: 63  RSCNRGYVFATSILYYSQHLVIAPLLFLFLSGFSNEEFNRFL---SPVGSYQELDPDGSF 119

Query: 120 NESL---LQLLGRSRDDRATMAYLHYYRYVVRPWQYMLLHATPCFTLTEGFFTVLAIQVI 176
            + L   + +   + + +    Y +Y++++V+PWQ++L ++TP FTL EGFFT+LAIQ I
Sbjct: 120 LDLLKHRILMATTAENSKNWTLYYYYFKFIVQPWQWLLSYSTPFFTLLEGFFTILAIQAI 179

Query: 177 GETGRWLRYKRNSTAWVISSLMVSGVVITTSMYYLYRIYVTPIWPLSVHTATLLGFTLSL 236
           GET +WL Y+ NS  W+I+SL+VSG VIT S+YYLYRIYVTPIW L++ +A+LLGF LS+
Sbjct: 180 GETNKWLSYEMNSNTWIITSLLVSGGVITGSLYYLYRIYVTPIWKLTIQSASLLGFVLSI 239

Query: 237 VFGLGLYGIISGKGSAIESSLFFAYMVHCIYEISPQLALTAMSEIFQVVHNTWQM-QQGT 295
           VF LGLYGIIS KGS IESSLFFAY+V CIYEISP+LA  A  EI  +V + WQ  Q+  
Sbjct: 240 VFCLGLYGIISRKGSVIESSLFFAYIVRCIYEISPKLATRATEEILDLVKDVWQTHQRNL 299

Query: 296 LPKNSLLAYYKNFIL-NAENLWD-VLLKKAFLLHSVELDQAPSSVVVKDALVLVQQQWWN 353
           L +++LLAYY N +L NAE +W+  +L ++  L+++E                 + ++W 
Sbjct: 300 LNRDNLLAYYHNVVLKNAEMVWESFILPRSRSLNAME-----------------KIRFWL 342

Query: 354 KSQQLWSFTKNFSAGIPRSIHEIFIVTLGLARESINAAVVSNLVFRVIVFYSATRIIPAL 413
               +W F KNF+  +P SI E+  VT  +A ES++ AV+ NL FR+++FYSATRIIPAL
Sbjct: 343 DVTPVWKFFKNFTVSVPSSIVELVSVTYKMASESLSPAVIVNLCFRILIFYSATRIIPAL 402

Query: 414 QRAT--GGTQSRKLMRIIYWYSPCIVIAMYTHMILRYSGELNNELCIWGCFP-WLQSEAN 470
           QR++     QSR++++++YWYSPC++IAMYTH+IL+YSGEL  ELC+WGC   W  S+ +
Sbjct: 403 QRSSYKEQRQSRRILKLLYWYSPCVLIAMYTHLILQYSGELKRELCLWGCTSNWFGSK-D 461

Query: 471 RDRWVVDAWGFWNWCNLFFTLLIYAVELIGSR 502
           + R V D+W FWNWCN+F+T+L+YA ELIG++
Sbjct: 462 QPRIVTDSWSFWNWCNIFWTVLVYANELIGTQ 493

>NDAI0B03520 Chr2 complement(885459..886964) [1506 bp, 501 aa] {ON}
           Anc_2.293 YIL090W
          Length = 501

 Score =  486 bits (1251), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 253/508 (49%), Positives = 344/508 (67%), Gaps = 21/508 (4%)

Query: 1   MVPKGLLRSLRFALASFYLFLVLITVPISFQIGGLYCGLSFTVTLFILYFVTTTLKITAA 60
           M+    +R +R   A+FYL   LI++PISF+IGGL CGL+FT TLF +YF++TTL + A 
Sbjct: 1   MISSSFMRGVRTFSAAFYLLFTLISIPISFKIGGLQCGLAFTATLFTIYFLSTTLSLLAR 60

Query: 61  TRGDEWK-HIASTLYYLQHFLMPSILFLFLSGFNNDQLQKKLVGSDPKGARGGFIFDGNM 119
             G  +   +   LYY QH ++ S+L+LFLSGF+++ L   L     K      +   N+
Sbjct: 61  KYGSNFSIFLTGFLYYSQHLIIASLLYLFLSGFSHEDLTIPLSDDTQKVDIISDVVRRNL 120

Query: 120 NESLLQLLGRSRDDRATMAYLHYYRYVVRPWQYMLLHATPCFTLTEGFFTVLAIQVIGET 179
                     S  +     Y +YY + V+PW+Y+L ++TP FTL+EGFFT+LAIQ +GET
Sbjct: 121 ----------SSTNSNWNLYHNYYTFFVQPWKYLLSYSTPFFTLSEGFFTILAIQAVGET 170

Query: 180 GRWLRYKRNSTAWVISSLMVSGVVITTSMYYLYRIYVTPIWPLSVHTATLLGFTLSLVFG 239
            +WL  + NS  W+ISSL+ SG VIT S+YYLYRIYVTPIW LS+ TA+LLGFTLSLV G
Sbjct: 171 NKWLVNEINSNTWIISSLLTSGGVITASLYYLYRIYVTPIWQLSIQTASLLGFTLSLVGG 230

Query: 240 LGLYGIISGKGSAIESSLFFAYMVHCIYEISPQLALTAMSEIFQVVHNTWQMQQGTLP-K 298
           LGLYGI++ KGS IESSLFFAY+V CIYEISP+LA TA  EI ++    WQ  QG LP  
Sbjct: 231 LGLYGIVTEKGSVIESSLFFAYIVRCIYEISPKLATTATDEILEIFKEVWQRHQGNLPTT 290

Query: 299 NSLLAYYKNFIL-NAENLWDVLLKKAFLLHSVELDQAPSSVVVKDALVLVQQQWWNK-SQ 356
           ++LL YY NF+L + + LW++L+ K  +  +   +  PSS  +      + +    +  +
Sbjct: 291 DNLLFYYNNFVLRHIDMLWELLVSK--INQNDPNNTLPSSFNINFLTTFLSKDLLLRICK 348

Query: 357 QLWSFTKNFSAGIPRSIHEIFIVTLGLARESINAAVVSNLVFRVIVFYSATRIIPALQRA 416
            +W   KNF+  +P SI E+ +VT  +ARES++ AVV NL FRV++FYSATRIIPALQR 
Sbjct: 349 PIWKLFKNFTVSVPSSISELVLVTYQMARESVSPAVVINLCFRVLIFYSATRIIPALQRR 408

Query: 417 TGG--TQSRKLMRIIYWYSPCIVIAMYTHMILRYSGELNNELCIWGC-FPWLQSEANRDR 473
                 +SR++M+I+YWYSPC++IAMYTH+IL+YSGEL  +LC+WGC   WL    N+  
Sbjct: 409 NDSELKKSRRIMKILYWYSPCVLIAMYTHLILQYSGELKKDLCLWGCNLKWLI--PNQPE 466

Query: 474 WVVDAWGFWNWCNLFFTLLIYAVELIGS 501
            +VD+WGFWNWCN+FFT++IYA EL G+
Sbjct: 467 LIVDSWGFWNWCNIFFTIIIYASELFGT 494

>YIL090W Chr9 (193595..195070) [1476 bp, 491 aa] {ON}  ICE2Integral
           ER membrane protein with type-III transmembrane domains;
           required for ER zinc homeostasis; mutations cause
           defects in cortical ER morphology in both the mother and
           daughter cells
          Length = 491

 Score =  486 bits (1250), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 261/508 (51%), Positives = 341/508 (67%), Gaps = 30/508 (5%)

Query: 2   VPKGLLRSLRFALASFYLFLVLITVPISFQIGGLYCGLSFTVTLFILYFVTTTLKITAAT 61
           + K  ++S R   A FYL   L+++PISF++GGL CGLSFTVTLF LYF+TTTL + A  
Sbjct: 4   LSKSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVLARR 63

Query: 62  RGDE-WKHIASTLYYLQHFLMPSILFLFLSGFNNDQLQKKLVGSDPKGARGGFIFDGNMN 120
            G   +    + LYY QHF++ S+L+LFLSGF+ND+L   L                N +
Sbjct: 64  HGGRLYIFFTNCLYYSQHFIIASLLYLFLSGFSNDELGNVLKN------------KYNES 111

Query: 121 ESLLQLLGRSRDDRATMAYLHYY--RYVVRPWQYMLLHATPCFTLTEGFFTVLAIQVIGE 178
           ES L+ L  S +       L+YY  R+VV+PWQ++L  +TP FTL+EGFFT+LAIQ +GE
Sbjct: 112 ESFLEALKNSLNSNQINYVLYYYYYRFVVQPWQFVLTKSTPFFTLSEGFFTILAIQAVGE 171

Query: 179 TGRWLRYKRNSTAWVISSLMVSGVVITTSMYYLYRIYVTPIWPLSVHTATLLGFTLSLVF 238
           T RWL    NS  W+ISSL+ SG VIT S+YYLYRIYVTPIWPLS+ TA+LLG  LS+V 
Sbjct: 172 TNRWLSNDLNSNTWIISSLLTSGGVITASLYYLYRIYVTPIWPLSIQTASLLGLVLSMVC 231

Query: 239 GLGLYGIISGKGSAIESSLFFAYMVHCIYEISPQLALTAMSEIFQVVHNTWQMQQGTLP- 297
           GLGLYGI+S KGS IESSLFFAY+V CIYEISP+LA TA  EI  +  + WQ  Q  LP 
Sbjct: 232 GLGLYGIVSQKGSVIESSLFFAYIVRCIYEISPKLATTATDEILNLFKDVWQKHQRNLPT 291

Query: 298 KNSLLAYYKNFIL-NAENLWDVLLKKAFLLHSVELDQAPSSVVVKDALVLVQQQWWNKSQ 356
            ++LL Y+ N IL NAE LW   + +     + +      S++  + + L+       S+
Sbjct: 292 ADNLLCYFHNVILKNAEVLWGSFIPRG-RKKTGDFHDKLISILSFEKVSLI-------SK 343

Query: 357 QLWSFTKNFSAGIPRSIHEIFIVTLGLARESINAAVVSNLVFRVIVFYSATRIIPALQRA 416
             W F KNF+  +P SI+E   VT+ +A ES++ A+V NL FRV++FYSATRIIPALQR 
Sbjct: 344 PFWKFFKNFTFSVPLSINEFCQVTIKMASESVSPAIVINLCFRVLMFYSATRIIPALQRK 403

Query: 417 TGGT--QSRKLMRIIYWYSPCIVIAMYTHMILRYSGELNNELCIWGCF-PWLQSEANRDR 473
                 +SR++M+ +YWYSPCI+IAMYTH+IL+YSGEL  +LCIWGC   W     ++  
Sbjct: 404 NDKQLRKSRRIMKGLYWYSPCILIAMYTHLILQYSGELKKDLCIWGCSEKWFG--VDQPE 461

Query: 474 WVVDAWGFWNWCNLFFTLLIYAVELIGS 501
            +VD+WGFWNWCN+F T+L+YA ELIGS
Sbjct: 462 IIVDSWGFWNWCNIFCTILVYATELIGS 489

>KNAG0A05390 Chr1 complement(793701..795194) [1494 bp, 497 aa] {ON}
           Anc_2.293 YIL090W
          Length = 497

 Score =  483 bits (1242), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 260/507 (51%), Positives = 341/507 (67%), Gaps = 32/507 (6%)

Query: 4   KGLLRSLRFALASFYLFLVLITVPISFQIGGLYCGLSFTVTLFILYFVTTTLKITAATRG 63
            G +R  R    + YL L LI++PISF++GGLYCGL+FT TLFILYFV+TTL I A   G
Sbjct: 7   SGFIRGCRICSGALYLLLTLISIPISFKVGGLYCGLAFTATLFILYFVSTTLSIIARKNG 66

Query: 64  DE-WKHIASTLYYLQHFLMPSILFLFLSGFNNDQLQKKLVGSDPKGARGGFIFDGNMNES 122
           +  +  ++S LYY QHF++ S+L LFLSGF+N +L K +              D    ES
Sbjct: 67  NRIYIVLSSILYYCQHFIIASLLHLFLSGFSNAELHKIIEN------------DAIPIES 114

Query: 123 LLQLLGRSRDDRAT--MAYLHYYRYVVRPWQYMLLHATPCFTLTEGFFTVLAIQVIGETG 180
           L  +L  S        + Y +YY+YVV PW+++L H+TP FTL+EGFFT+LAIQ IGET 
Sbjct: 115 LTSILNVSMSSSEANWIFYYYYYKYVVTPWKFVLSHSTPFFTLSEGFFTILAIQAIGETN 174

Query: 181 RWLRYKRNSTAWVISSLMVSGVVITTSMYYLYRIYVTPIWPLSVHTATLLGFTLSLVFGL 240
           +WL Y++NS AW+ISSL+ S  VI+ ++YYLYRIYVTPIW L+V TA+LLGF LSLV GL
Sbjct: 175 KWLCYEKNSNAWIISSLLTSSAVISAALYYLYRIYVTPIWELTVQTASLLGFVLSLVSGL 234

Query: 241 GLYGIISGKGSAIESSLFFAYMVHCIYEISPQLALTAMSEIFQVVHNTWQMQQGTLP-KN 299
           G+YGI+S  GS IESSLFFAY+V CIYEISP+LA TA  E+ ++  + WQ +QG LP +N
Sbjct: 235 GIYGIVSDSGSVIESSLFFAYIVRCIYEISPKLATTATDELLELFKDVWQKRQGNLPIRN 294

Query: 300 SLLAYYKNFIL-NAENLWDVLLKKAFLLHSVELDQAPSSVVVKDALVLVQQQWWNKSQQL 358
           +L+ YY N IL N E  WD  + +     S   +  PS         L+    W   + +
Sbjct: 295 NLIFYYNNVILKNIEMAWDNFILRTG--TSGTFNYNPS---------LLLNNTWKFCKPI 343

Query: 359 WSFTKNFSAGIPRSIHEIFIVTLGLARESINAAVVSNLVFRVIVFYSATRIIPALQRATG 418
           W F KNF+  +P SI EI ++T  ++ ES++ AVV NL FR+++FYSATRI+P+LQR   
Sbjct: 344 WKFFKNFTLSVPFSIREILLMTWKMSLESVSPAVVINLCFRILIFYSATRIVPSLQRKDA 403

Query: 419 GTQ--SRKLMRIIYWYSPCIVIAMYTHMILRYSGELNNELCIWGCFPWL--QSEANRDRW 474
             Q  SRK+M ++YWYSPCI+IAMY H+IL+YS EL NELC+WGC   L   +    +  
Sbjct: 404 REQRRSRKVMELVYWYSPCILIAMYAHLILQYSSELKNELCLWGCNNILLGYNTDQNETV 463

Query: 475 VVDAWGFWNWCNLFFTLLIYAVELIGS 501
           VVDAW FWNWCN+F T+L+YA ELIG 
Sbjct: 464 VVDAWRFWNWCNVFCTILVYANELIGD 490

>TDEL0G02230 Chr7 (437121..438587) [1467 bp, 488 aa] {ON} Anc_2.293
           YIL090W
          Length = 488

 Score =  480 bits (1236), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 265/510 (51%), Positives = 350/510 (68%), Gaps = 35/510 (6%)

Query: 2   VPKGLLRSLRFALASFYLFLVLITVPISFQIGGLYCGLSFTVTLFILYFVTTTLKITAAT 61
           + K  L+  R ALA FYL   L+T+PISF++GGLYCGLSFTVTLF LY +TTTL + A +
Sbjct: 4   ISKSFLQGTRMALAGFYLLSTLVTIPISFKVGGLYCGLSFTVTLFNLYLITTTLSMVAQS 63

Query: 62  RGDEWKHIAST-LYYLQHFLMPSILFLFLSGFNNDQLQKKLV-GSDPKGARGGFIFDGNM 119
            G++   + +T +YYLQHF++ S+L+LFLSGF+N++L K L  GS P+            
Sbjct: 64  YGNKCYIVGTTFIYYLQHFMIASLLYLFLSGFSNEELTKVLEDGSQPE------------ 111

Query: 120 NESLLQLLGRS--RDDRATMAYLHYYRYVVRPWQYMLLHATPCFTLTEGFFTVLAIQVIG 177
            +SL+ +L  +   +  + M Y +YYRYVV+PWQ +L H+T  F L+EGFFTVL IQ IG
Sbjct: 112 -QSLVNVLRNNVFSNHSSWMLYYYYYRYVVQPWQSVLTHSTAFFALSEGFFTVLGIQAIG 170

Query: 178 ETGRWLRYKRNSTAWVISSLMVSGVVITTSMYYLYRIYVTPIWPLSVHTATLLGFTLSLV 237
           ET RWL  + NS  W+I+SL+ SG VIT S+YYLYRIYVTPIW LSV TA+LLGFTLS+V
Sbjct: 171 ETNRWLLDEMNSNTWIIASLLTSGGVITASLYYLYRIYVTPIWNLSVQTASLLGFTLSIV 230

Query: 238 FGLGLYGIISGKGSAIESSLFFAYMVHCIYEISPQLALTAMSEIFQVVHNTWQMQQGTLP 297
            G+GL+GI+S  GS IESSLFFAY+V CIYEISP+LA TA  EI +V+   WQ  Q  L 
Sbjct: 231 CGIGLFGIVSKNGSVIESSLFFAYIVRCIYEISPKLATTATDEILEVIKVAWQKHQKNLS 290

Query: 298 -KNSLLAYYKNFIL-NAENLWDVLLKKAFLLHSVELDQAPSSVVVKDALVLVQQQWWNKS 355
             N+LL+YY++ +L NAE +W+          S+ L    S      A+  + +  W+  
Sbjct: 291 TTNNLLSYYQDVVLKNAEMVWE----------SIVLRTKNSDATTFTAIQPLNKL-WHAF 339

Query: 356 QQLWSFTKNFSAGIPRSIHEIFIVTLGLARESINAAVVSNLVFRVIVFYSATRIIPALQR 415
             +W F K F   +P SI  +F VTL LA ES++ A+V NL FRV+VFYSATRIIPALQR
Sbjct: 340 TPIWKFFKGFVLSVPSSIGGVFQVTLKLASESVSPAIVLNLCFRVLVFYSATRIIPALQR 399

Query: 416 ATGGT--QSRKLMRIIYWYSPCIVIAMYTHMILRYSGELNNELCIWGCFP-WLQSEANRD 472
                  +SR++M ++YWYSPCI+IAMYTH+IL+YSGELN++LC+WGC   W  S   + 
Sbjct: 400 KNTRELRKSRRIMNVLYWYSPCILIAMYTHLILQYSGELNSDLCLWGCSEKWFGS--GQP 457

Query: 473 RWVVDAWGFWNWCNLFFTLLIYAVELIGSR 502
           +  ++ W FWNWCN+F+T+LIY  ELIG +
Sbjct: 458 KIEINTWVFWNWCNIFWTVLIYGSELIGGK 487

>KLLA0E08207g Chr5 complement(740213..741673) [1461 bp, 486 aa] {ON}
           similar to uniprot|P40499 Saccharomyces cerevisiae
           YIL090W ICE2 Integral ER membrane protein with type-III
           transmembrane domains mutations cause defects in
           cortical ER morphology in both the mother and daughter
           cells
          Length = 486

 Score =  472 bits (1215), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 249/502 (49%), Positives = 331/502 (65%), Gaps = 60/502 (11%)

Query: 1   MVPKGLLRSLRFALASFYLFLVLITVPISFQIGGLYCGLSFTVTLFILYFVTTTLKITAA 60
           ++ K +L++LR  L + YLFLVLIT+PISFQ+GGL CGLSFTVTLF LYFV+TT K+   
Sbjct: 42  LIKKSVLQTLRIFLTTMYLFLVLITIPISFQVGGLNCGLSFTVTLFALYFVSTTFKLVLL 101

Query: 61  TRGDEWKHIASTLYYLQHFLMPSILFLFLSGFNNDQLQKKLVGSDPKGARGGFIFDGNMN 120
            RG     +++ +YYLQH L+PSILF+FLS F N       + SD   +    +F     
Sbjct: 102 DRGSA---LSTLIYYLQHLLIPSILFMFLSYFEN-------IDSDTVDSEYFKVF----- 146

Query: 121 ESLLQLLGRSRDDRATMAYLHYYRYVVRPWQYMLLHATPCFTLTEGFFTVLAIQVIGETG 180
                                 +  +V+PWQ  L+H+TP FTL EG FT+LAIQ IGET 
Sbjct: 147 ----------------------WNVMVKPWQLSLIHSTPVFTLLEGVFTILAIQAIGETE 184

Query: 181 RWLRYKRNSTAWVISSLMVSGVVITTSMYYLYRIYVTPIWPLSVHTATLLGFTLSLVFGL 240
           RWL+  R S  WVI SL++SG +IT S++Y YRIYVTP+W LS  +A+LLGFT S+V G+
Sbjct: 185 RWLKMSRRSNQWVILSLLISGGIITLSLFYFYRIYVTPMWELSTPSASLLGFTFSIVCGI 244

Query: 241 GLYGIISGKGSAIESSLFFAYMVHCIYEISPQLALTAMSEIFQVVHNTWQMQQGTLPKNS 300
           GLYG I+G GS +ESSLFFAYMV  +YEISP++A+ AM EIF +V  TW++ Q  LPK  
Sbjct: 245 GLYG-INGSGSVMESSLFFAYMVRNVYEISPKMAMNAMDEIFDIVKETWKIHQANLPKK- 302

Query: 301 LLAYYKNFILNAENLWDVLLKKAFLLHSVELDQAPSSVVVKDALVLVQQQWWNKSQQLWS 360
                       +NL +++ K    + S  ++  P +   K   ++ Q +W      LW+
Sbjct: 303 ------------DNLLELMTKNYRAIWSQIVEHTPRN--HKYIKMMDQCKW--ILNPLWN 346

Query: 361 FTKNFSAGIPRSIHEIFIVTLGLARESINAAVVSNLVFRVIVFYSATRIIPALQRATGGT 420
             KNF+  +P SI EIF+VT  +A+ES+  AVV NLVFR+++FYSATRIIP LQR T   
Sbjct: 347 SVKNFTKSVPISIQEIFVVTFKMAKESLIPAVVINLVFRLLIFYSATRIIPTLQRNTKER 406

Query: 421 QS-RKLMRIIYWYSPCIVIAMYTHMILRYSGELNNELCIWGCFPWLQSEANRDRWVVDAW 479
           +S R++M  +YWYSPCI+IAMYTH+ILRYSG+L N+LCIWGCFP+        + VVD+W
Sbjct: 407 RSFRRIMNFVYWYSPCIIIAMYTHLILRYSGQLKNDLCIWGCFPY----ETEPKIVVDSW 462

Query: 480 GFWNWCNLFFTLLIYAVELIGS 501
            FWNWCN++ T+LIYA+EL+GS
Sbjct: 463 SFWNWCNIYSTMLIYALELMGS 484

>KAFR0J01330 Chr10 complement(243571..245046) [1476 bp, 491 aa] {ON}
           Anc_2.293 YIL090W
          Length = 491

 Score =  472 bits (1215), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 247/512 (48%), Positives = 338/512 (66%), Gaps = 38/512 (7%)

Query: 1   MVPKGLLRSLRFALASFYLFLVLITVPISFQIGGLYCGLSFTVTLFILYFVTTTLKITAA 60
           ++ K ++R LR    +FYL   LI++P+SF+IGG++CGLSFTVTLFI YF++TTL I A 
Sbjct: 3   LLSKSIIRGLRIFSGTFYLLFTLISIPMSFKIGGMHCGLSFTVTLFIAYFLSTTLSILAR 62

Query: 61  TRGDEWKHIASTL-YYLQHFLMPSILFLFLSGFNNDQLQKKLVGSDPKGARGGFIFDGNM 119
             G  +  + ++L YY QH ++ S+L+ FLSGF+ND+L + L     K            
Sbjct: 63  QSGSRFYIVLTSLIYYCQHLIIASLLYFFLSGFSNDELHRVLKDGTEK------------ 110

Query: 120 NESLLQLLGRSRD----DRATMAYLHYYRYVVRPWQYMLLHATPCFTLTEGFFTVLAIQV 175
               +++L  ++D    +   + Y +YY YVV+PW+++L ++TP F L EGFFT+LAIQ 
Sbjct: 111 ----IEVLVANQDLMVSESNWLLYCYYYSYVVKPWKFVLSYSTPFFALAEGFFTILAIQA 166

Query: 176 IGETGRWLRYKRNSTAWVISSLMVSGVVITTSMYYLYRIYVTPIWPLSVHTATLLGFTLS 235
           IGET RWL  ++NS +W+ISSL+ S  V+T S+YYLYRIYVTPIW LS  TATLLG  LS
Sbjct: 167 IGETNRWLSDEKNSNSWIISSLLASSGVVTASLYYLYRIYVTPIWELSAQTATLLGCVLS 226

Query: 236 LVFGLGLYGIISGKGSAIESSLFFAYMVHCIYEISPQLALTAMSEIFQVVHNTWQMQQGT 295
           L FGLG++GIIS +GS +ESSLFFAY+V CIYEISP+LA TA  EI ++    WQ  QG 
Sbjct: 227 LTFGLGIHGIISERGSVVESSLFFAYIVRCIYEISPKLATTATDEILELFKEVWQEHQGK 286

Query: 296 LP-KNSLLAYYKNFIL-NAENLWDVLLKKAFLLHSVELDQAPSSVVVKDALVLVQQQWWN 353
           LP  +++L YY++ IL N E +W+  L K     +  L+                + +W 
Sbjct: 287 LPITDNILNYYRSVILKNTEMIWEAFLSKTKQHSNHTLNS-----------FFTAENFWI 335

Query: 354 KSQQLWSFTKNFSAGIPRSIHEIFIVTLGLARESINAAVVSNLVFRVIVFYSATRIIPAL 413
               LW F KNF+  +P SI E+  + L +A ESI+ AVV NL FRV++FYSATRIIP+L
Sbjct: 336 HFNPLWKFFKNFTISVPFSISELSGMMLQMASESISPAVVVNLCFRVLIFYSATRIIPSL 395

Query: 414 QRAT--GGTQSRKLMRIIYWYSPCIVIAMYTHMILRYSGELNNELCIWGCFPWLQ--SEA 469
           QR       +SR++M+++YWYSPCI+IAMYTH+IL+YSGEL  EL +WG    L    + 
Sbjct: 396 QRKEVRDSRKSRRIMKVLYWYSPCILIAMYTHLILQYSGELKRELYLWGPDSKLSFLVDK 455

Query: 470 NRDRWVVDAWGFWNWCNLFFTLLIYAVELIGS 501
             +  VVD+W FWNWCN+F+T+LIY  EL G+
Sbjct: 456 EENNIVVDSWSFWNWCNIFWTILIYGGELFGT 487

>ZYRO0A02024g Chr1 (167059..168519) [1461 bp, 486 aa] {ON} similar
           to uniprot|P40499 Saccharomyces cerevisiae YIL090W ICE2
           Integral ER membrane protein with type-III transmembrane
           domains mutations cause defects in cortical ER
           morphology in both the mother and daughter cells
          Length = 486

 Score =  459 bits (1180), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 252/508 (49%), Positives = 351/508 (69%), Gaps = 37/508 (7%)

Query: 6   LLRSLRFALASFYLFLVLITVPISFQIGGLYCGLSFTVTLFILYFVTTTLKITAATRGDE 65
           +++S+R  LA FYL  +LIT+PISF++GGLYCGLSFTVTLF LYF++TTL +        
Sbjct: 4   VVQSVRVLLACFYLLSILITIPISFKVGGLYCGLSFTVTLFNLYFMSTTLSLFVRGYASR 63

Query: 66  WKHIAS-TLYYLQHFLMPSILFLFLSGFNNDQLQKKL-VGSDPKGARGGFIFDGNMNESL 123
           +   ++ T+YY QH ++ S+L+LFLSGF+N++L K L  GS P+             +SL
Sbjct: 64  FYVFSTATIYYSQHCIIASLLYLFLSGFSNEELTKILESGSQPE-------------QSL 110

Query: 124 LQLLGRSRDDRATMAYL---HYYRYVVRPWQYMLLHATPCFTLTEGFFTVLAIQVIGETG 180
           L++L +S    A   ++   +YY Y+V+PWQ++L H+T  F+L+EGFFT+LAIQ +GE+ 
Sbjct: 111 LEVL-KSNPFSAHSNWILYYYYYCYIVQPWQWILSHSTAFFSLSEGFFTILAIQAVGESH 169

Query: 181 RWLRYKRNSTAWVISSLMVSGVVITTSMYYLYRIYVTPIWPLSVHTATLLGFTLSLVFGL 240
           RWL Y+ NS  W I+SL++SG VIT ++YYLYRIYVTP+W LS+ TA+LLGFTLSLV GL
Sbjct: 170 RWLLYEINSNIWNITSLLISGGVITAALYYLYRIYVTPVWELSIQTASLLGFTLSLVCGL 229

Query: 241 GLYGIISGKGSAIESSLFFAYMVHCIYEISPQLALTAMSEIFQVVHNTWQMQQGTLPK-N 299
           GLYGI+S  GS IESSLFFAY+V CIYEISP+LA TA  EI ++    WQ  Q      N
Sbjct: 230 GLYGIVSKNGSVIESSLFFAYIVRCIYEISPKLATTATDEILEIFKEAWQKHQRNYSSTN 289

Query: 300 SLLAYYKNFILN-AENLWDVLLKKAFLLHSVELDQAPSSVVVKDALVLVQQQWWNKSQQL 358
           +LL+YY + +L+ AE +W+ ++ K             S      ++    +++ +  + +
Sbjct: 290 NLLSYYHDVVLDSAEMMWESIVSKTV---------TTSDPFYHTSMFPPLRKFTDIFKPV 340

Query: 359 WSFTKNFSAGIPRSIHEIFIVTLGLARESINAAVVSNLVFRVIVFYSATRIIPALQRATG 418
             F KNF+  +P SI  +F VTL +A +S++ A+V NL FRV++FYSAT+IIPALQ   G
Sbjct: 341 GIFFKNFTISVPSSIEGLFQVTLKMASDSVSPAIVVNLFFRVLIFYSATKIIPALQ-GKG 399

Query: 419 GTQ---SRKLMRIIYWYSPCIVIAMYTHMILRYSGELNNELCIWGCFP-WLQSEANRDRW 474
             Q   SR++M ++YWYSPCI+IAMYTH+IL+YSGELN +LC+WGC   W     N+ + 
Sbjct: 400 DRQLNKSRRIMNVLYWYSPCILIAMYTHLILQYSGELNRDLCLWGCNSMWF--SLNQTKI 457

Query: 475 VVDAWGFWNWCNLFFTLLIYAVELIGSR 502
           VVD+WGFWNWCN+F+T+L+Y  ELIG +
Sbjct: 458 VVDSWGFWNWCNIFWTILVYGSELIGGK 485

>Kpol_1003.42 s1003 (100704..102176) [1473 bp, 490 aa] {ON}
           (100704..102176) [1473 nt, 491 aa]
          Length = 490

 Score =  443 bits (1139), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 243/515 (47%), Positives = 332/515 (64%), Gaps = 43/515 (8%)

Query: 2   VPKGLLRSLRFALASFYLFLVLITVPISFQIGGLYCGLSFTVTLFILYFVTTTLKITAAT 61
           V K L+RS++  L  FYL  ++ T+PISF+IGGLYCGL+FTVTLF LYF +TTL I A  
Sbjct: 4   VLKNLIRSVQVVLVCFYLLNIVTTIPISFKIGGLYCGLTFTVTLFYLYFTSTTLNIIARR 63

Query: 62  RGDEWKHI-ASTLYYLQHFLMPSILFLFLSGFNNDQLQKKL-VGSDPKGARGGFIFDGNM 119
            G +   I  S+ +Y Q+F++PS+L LFL+GF N+ L K +  G  PK            
Sbjct: 64  WGSKPAIIITSSFFYFQNFIIPSLLHLFLNGFANEDLIKSIRSGIQPK------------ 111

Query: 120 NESLLQLLGRSRDD-----RATMAYLHYYRYVVRPWQYMLLHATPCFTLTEGFFTVLAIQ 174
            E+ L LL   R D     +  + + +YY Y V+PWQ +L ++TP FTL EGFFT+L IQ
Sbjct: 112 -ETFLDLL---RGDIPVSVKNWLLFYYYYSYTVKPWQVILSYSTPVFTLLEGFFTILGIQ 167

Query: 175 VIGETGRWLRYKRNSTAWVISSLMVSGVVITTSMYYLYRIYVTPIWPLSVHTATLLGFTL 234
            IGE   WL+++RNS  W+ISSL+ SG +IT S+YYLYRIY TPIW LSV  ATLLGFTL
Sbjct: 168 TIGEMNTWLKHERNSNIWIISSLLTSGGLITGSLYYLYRIYATPIWNLSVGAATLLGFTL 227

Query: 235 SLVFGLGLYGIISGKGSAIESSLFFAYMVHCIYEISPQLALTAMSEIFQVVHNTWQMQQG 294
           SLV  LG+YGI+S  GS IESSLFFAY+V CIYEI+P+LA TA  E  + +   WQ    
Sbjct: 228 SLVGSLGIYGIVSHNGSVIESSLFFAYIVRCIYEIAPELATTATEEFLEGIKEVWQSHHA 287

Query: 295 TLP-KNSLLAY-YKNFILNAENLWDVLLKKA---FLLHSVELDQAPSSVVVKDALVLVQQ 349
            L   +  ++Y Y +F + A   W +   +      LH+  +D  PS V+++        
Sbjct: 288 NLNVADGFISYFYDSFHMQAHKFWTLFTSRTPYYGYLHNYCMDY-PSLVMIRSNF----- 341

Query: 350 QWWNKSQQLWSFTKNFSAGIPRSIHEIFIVTLGLARESINAAVVSNLVFRVIVFYSATRI 409
                   +W   K  +  +P SI E+F +T+ +A +S++ A++ NL FR+++FYSATRI
Sbjct: 342 ------YPIWETLKTLTFSVPTSISELFHLTVRMAIDSVSPAIIINLCFRLMIFYSATRI 395

Query: 410 IPALQRATGGT--QSRKLMRIIYWYSPCIVIAMYTHMILRYSGELNNELCIWGCFPWLQS 467
           IPA+Q+ T     + R +M+ +YWYSPCI+IAMYTH+IL+YSGEL  +LC+WGC      
Sbjct: 396 IPAIQKRTRSETRKIRGIMKALYWYSPCILIAMYTHLILQYSGELKKDLCLWGCDSTWFG 455

Query: 468 EANRDRWVVDAWGFWNWCNLFFTLLIYAVELIGSR 502
           E +++R  VDAW FWNWCN+F+T++IY  ELIG +
Sbjct: 456 E-DQERINVDAWSFWNWCNIFWTIIIYGSELIGGK 489

>TPHA0C03440 Chr3 (752685..754424) [1740 bp, 579 aa] {ON} Anc_2.293
           YIL090W
          Length = 579

 Score =  428 bits (1100), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 228/546 (41%), Positives = 342/546 (62%), Gaps = 61/546 (11%)

Query: 1   MVPKGLLRSLRFALASFYLFLVLITVPISFQIGGLYCGLSFTVTLFILYFVTTTLKITAA 60
           ++P+G++ S    L +FYL  +++T+PISF+IGG+YCGLSFT TLF LYF++T++ I   
Sbjct: 50  LIPRGVINSGHAVLVAFYLLNIVVTIPISFKIGGIYCGLSFTGTLFGLYFISTSVTIITK 109

Query: 61  --TRGDEWKHIASTLYYLQHFLMPSILFLFLSGFNNDQLQKKLVGSDPK--GARGG---- 112
             T     + +AS+L+Y+Q+F++ S+L ++L GFNN  L   L   D      + G    
Sbjct: 110 RLTHNTTLRLLASSLFYIQNFIISSLLQIYLRGFNNKDLITALTFLDDYYYNEKNGTNTK 169

Query: 113 -------------------FIFDGNMNESL---LQLLGRSRDDRATMA----YLHYYRYV 146
                              F  D  +N+ L   L+  G S  D   +     + +YY   
Sbjct: 170 YQILFIIKDYFVNIMNLILFREDNGLNKMLQLALKSEGNSVPDPQKLNSWILFFYYYYIF 229

Query: 147 VRPWQYMLLHATPCFTLTEGFFTVLAIQVIGETGRWLRYKRNSTAWVISSLMVSGVVITT 206
           ++PW+++L+++TP FTL EGFFT+L IQ IGET  WL+ +++S+ WVI SL+ SG VIT 
Sbjct: 230 IKPWKFLLINSTPFFTLLEGFFTILGIQTIGETNIWLKQQKHSSFWVILSLLSSGGVITA 289

Query: 207 SMYYLYRIYVTPIWPLSVHTATLLGFTLSLVFGLGLYGIISGKGSAIESSLFFAYMVHCI 266
           ++YYL RIYVTP W L+V TA++LGFTLS+V GLG++GI+S  GSAIESSLFFAY+V CI
Sbjct: 290 TLYYLNRIYVTPFWDLTVSTASMLGFTLSIVGGLGVFGIVSKNGSAIESSLFFAYIVRCI 349

Query: 267 YEISPQLALTAMSEIFQVVHNTWQMQQGTLP-KNSLLAYYKNFILNAENLWDVLLKKAFL 325
           YE+SP+LA++A  E  +  +  WQM Q  +   +++L Y K +I++A + +  +    F 
Sbjct: 350 YEMSPELAISATDEFLEGFNEVWQMNQNRITVADNVLTYCKKYIMDAFSSFSSIEHHLF- 408

Query: 326 LHSVELDQAPSSVVVKDALVLVQQQWWNKSQQLWSFTKNFSAGIPRSIHEIFIVTLGLAR 385
             ++EL  + + +V                +Q W F KNF+  +P SI+++  +T  +A 
Sbjct: 409 PKTIELGISKNLIV----------------KQFWVFLKNFTINVPSSINDLIQITAQMAV 452

Query: 386 ESINAAVVSNLVFRVIVFYSATRIIPALQRAT--GGTQSRKLMRIIYWYSPCIVIAMYTH 443
           +SI+ A++ NL FR+++FYSATRIIPA+QR T          M  +YW+SPC++IAMYTH
Sbjct: 453 DSISPAIIINLSFRLMIFYSATRIIPAIQRRTKPDAHDLTGFMSAVYWFSPCMLIAMYTH 512

Query: 444 MILRYSGELNNELCIWGCFPWLQSEAN-------RDRWVVDAWGFWNWCNLFFTLLIYAV 496
           +IL++SGEL   +C+W C  WL S ++        +  +VD+W FWNWCN+F+T++IYA 
Sbjct: 513 LILQFSGELKKNICLWNCENWLSSSSDVKSTNLGDNSIIVDSWSFWNWCNIFWTIIIYAS 572

Query: 497 ELIGSR 502
           ELIG R
Sbjct: 573 ELIGGR 578

>TBLA0B05980 Chr2 (1412745..1414226) [1482 bp, 493 aa] {ON}
           Anc_2.293 YIL090W
          Length = 493

 Score =  385 bits (990), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 221/515 (42%), Positives = 317/515 (61%), Gaps = 40/515 (7%)

Query: 2   VPKGLLRSLRFALASFYLFLVLITVPISFQIGGLYCGLSFTVTLFILYFVTTTLKITAAT 61
           V K L  S RF  A  YL  VL+TVPI+FQ+GGL CGL+FT+TLF  YF+TTTL   A  
Sbjct: 4   VLKNLGESTRFFFAGIYLLSVLMTVPIAFQLGGLQCGLAFTLTLFSSYFITTTLN--AIA 61

Query: 62  RGDEWKHI---ASTLYYLQHFLMPSILFLFLSGFNNDQLQKKLVGSDPKGARGGFIFDGN 118
           R   W+      + LYY Q+F +  IL +FLS F++ +L   +   +P       I   N
Sbjct: 62  RKLRWQRFIAWTNFLYYFQNFNIIGILHIFLSLFSHTELSISMSDENPSMETITSILKNN 121

Query: 119 MNESLLQLLGRSRDDRATMAYLHYYRYVVRPWQYMLLHATPCFTLTEGFFTVLAIQVIGE 178
                            +  Y +++ Y +  W++ L ++TP F L EGFFT+LAIQVIGE
Sbjct: 122 ---------DTYPSKTISFIYKYFFYYAMPRWKFCLSYSTPLFALVEGFFTILAIQVIGE 172

Query: 179 TGRWLRYKRNSTAWVISSLMVSGVVITTSMYYLYRIYVTPIWPLSVHTATLLGFTLSLVF 238
           T  WL   +NS+ W+I SL++S  ++TTS+YY+Y+IYVTP+W LS   A+LL FT SLV 
Sbjct: 173 TNIWLTTVKNSSIWIILSLIMSSSMVTTSIYYIYKIYVTPLWHLSNQVASLLSFTFSLVG 232

Query: 239 GLGLYGIISGKGSAIESSLFFAYMVHCIYEISPQLALTAMSEIFQVVHNTWQMQQGT--L 296
           G+ +YGI+S +GS +ESSLFFAY+V CIYEISP +A TAM +IF  +  +WQ+ Q    +
Sbjct: 233 GVAIYGIVSHRGSVVESSLFFAYIVCCIYEISPIMATTAMDDIFDTLKESWQIHQRNFFI 292

Query: 297 PKNSLLAYYKNFILNAENLWDVLLKKAFLLHSVELDQAPSSVVVKDALVLVQQQWWNKS- 355
             N L+ YY + I N     D  +K    L  ++L    +     ++L+    +   KS 
Sbjct: 293 SDNLLIYYYNSLIKNV----DEFIK----LKIIKLTTKDNFSNKFNSLLFQCVKISKKSF 344

Query: 356 QQLWSFTKNFSAGIPRSIHEIFIVTLGLARESINAAVVSNLVFRVIVFYSATRIIPALQR 415
           + +   +K F+ GIP SI+E++ +TL +A ESI+  ++ NL +RV++FY+ATRIIPAL+ 
Sbjct: 345 KFILKLSKRFTLGIPSSIYELYSITLKMASESISPVILVNLCYRVLIFYAATRIIPALES 404

Query: 416 ATGG--------TQSRKLMRIIYWYSPCIVIAMYTHMILRYSGELNNELCIWGCFPWLQS 467
            + G          + K M+++YWYSPCI+IAMYT++IL+YSGEL +E  +W       +
Sbjct: 405 RSNGFSNNNIKTKSNSKFMKVLYWYSPCILIAMYTNLILQYSGELKSEFKLW-------N 457

Query: 468 EANRDRWVVDAWGFWNWCNLFFTLLIYAVELIGSR 502
            +N +  VVD+W FWNWCN+F+T+ +Y  ELIG R
Sbjct: 458 NSNNNEVVVDSWRFWNWCNIFWTITLYGSELIGGR 492

>TBLA0B06990 Chr2 (1649581..1651191) [1611 bp, 536 aa] {ON} 
          Length = 536

 Score =  366 bits (940), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 210/546 (38%), Positives = 315/546 (57%), Gaps = 61/546 (11%)

Query: 2   VPKGLLRSLRFALASFYLFLVLITVPISFQIGGLYCGLSFTVTLFILYFVTTTLKITAAT 61
           V K + +S+R     FYL  VLIT+P +F+IGGLYCGLSFT+TLF LYF++TT+ + A  
Sbjct: 4   VVKSVKQSIRMLWGCFYLISVLITIPSAFKIGGLYCGLSFTMTLFHLYFLSTTMHLIAKR 63

Query: 62  RGDEWKHIASTL-YYLQHFLMPSILFLFLSGFNNDQLQKKLVGSDPKGARGGFIFDGNMN 120
             + +  + STL YYLQH ++ S+L++F++ F++  L +              I   N  
Sbjct: 64  TLNNFYILLSTLVYYLQHIVIASLLYIFITIFSDGNLNE--------------ILSNNKT 109

Query: 121 ESLLQLLGRSRDDRATMAYLHYYRY--------VVRPWQYMLLHATPCFTLTEGFFTVLA 172
           + L  LL   ++D +     +++           V+PW Y+L H+TP FTL EGFFT+L 
Sbjct: 110 DQLPSLLYYIKNDTSKSVSQNFHYLLFYYYYYYAVQPWNYLLSHSTPFFTLLEGFFTILG 169

Query: 173 IQVIGETGRWLRYKRNSTAWVISSLMVSGVVITTSMYYLYRIYVTPIWPLSVHTATLLGF 232
           IQ IGET  WL  K+    + + + ++S  VI T++++LY+IY   +W LS+ TA+LLG 
Sbjct: 170 IQAIGETYCWLLLKKQKKIFKLLTWLISVGVIFTAIHFLYKIYEFQVWELSIQTASLLGV 229

Query: 233 TLSLVFGLGLYGIISGKGSAIESSLFFAYMVHCIYEISPQLALTAMSEIFQVVHNTWQMQ 292
           T+SLV  +G++GI S  GS IESSLF  Y++ C YEISP+L+ +A +EI   +   WQ  
Sbjct: 230 TMSLVLTVGIFGIFSTNGSLIESSLFLGYIIRCFYEISPELSTSATTEILDNIKEAWQNH 289

Query: 293 QGTLP-KNSLLAYYKNFIL-------------------NAENLWDVLLKKAFLLHSVELD 332
           QG++     +L YY N +L                   +A+N     ++++   +++   
Sbjct: 290 QGSITVTEHILFYYNNVLLKNINSSYLFNSNFSKSNDTSAKNRTLAEIQRSTNNYTLTDI 349

Query: 333 QAPSSVVVKDALVLVQQQWWNKSQQLWSFTKNFSAGIPRSIHEIFIVTLGLARESINAAV 392
             PS ++       + Q W   +  ++   K+F   IP S+  +  VT  LA +S++ ++
Sbjct: 350 TKPSDLIHLIGFKSIYQNWLIYATPIYELLKDFVLNIPTSLANLSQVTYKLAYDSVSPSI 409

Query: 393 VSNLVFRVIVFYSATRIIPALQRAT--GGTQSRKLMRIIYWYSPCIVIAMYTHMILRYSG 450
           V NL FRV++FYSATRIIPA+QR       +SR  ++  Y +SPCIVIAMYT++IL+YSG
Sbjct: 410 VINLCFRVLIFYSATRIIPAVQRKNHLETKRSRNFLKAFYLFSPCIVIAMYTNLILQYSG 469

Query: 451 ELNNELCIWGC------FPWLQSEANRD----------RWVVDAWGFWNWCNLFFTLLIY 494
           EL N+LCIWGC           S  N D           ++V++WGFWNWCN+F T+ IY
Sbjct: 470 ELKNDLCIWGCDIISKSISQRMSTINMDVGSDDTYPNREFIVNSWGFWNWCNIFCTIFIY 529

Query: 495 AVELIG 500
             EL+G
Sbjct: 530 GCELMG 535

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.328    0.140    0.446 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 49,116,560
Number of extensions: 2015160
Number of successful extensions: 6267
Number of sequences better than 10.0: 35
Number of HSP's gapped: 6289
Number of HSP's successfully gapped: 36
Length of query: 502
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 388
Effective length of database: 40,409,475
Effective search space: 15678876300
Effective search space used: 15678876300
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 68 (30.8 bits)