Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ADL120C7.194ON31129815960.0
Ecym_43827.194ON31131114730.0
KLLA0D16170g7.194ON30729913280.0
SAKL0F07458g7.194ON31530413220.0
Kwal_55.203807.194ON32327913160.0
KLTH0E04598g7.194ON32829113120.0
TDEL0H025307.194ON31130912581e-175
YIL021W (RPB3)7.194ON31830812501e-174
Skud_9.1487.194ON31830812491e-174
ZYRO0D15796g7.194ON30830012451e-173
KAFR0A026507.194ON31229512421e-173
Smik_9.1697.194ON31830812401e-172
TBLA0J015207.194ON33529412371e-172
Suva_9.1787.194ON31930812351e-172
CAGL0J02420g7.194ON31228712291e-171
NDAI0G020007.194ON31130312271e-171
NCAS0E018307.194ON31827812141e-168
Kpol_1063.117.194ON31630011941e-165
TPHA0C045107.194ON31026911851e-164
KNAG0H027007.194ON32627311671e-161
Kpol_1018.1393.428ON3352892612e-25
TBLA0F017003.428ON3332892438e-23
ZYRO0C12364g3.428ON3352912402e-22
KAFR0A055203.428ON3342032376e-22
Kpol_473.33.428ON3202912366e-22
KNAG0A076003.428ON3342872332e-21
Smik_16.3533.428ON3352892332e-21
TDEL0F031003.428ON3351962323e-21
YPR110C (RPC40)3.428ON3352912313e-21
TPHA0D039203.428ON3351972314e-21
ADR031C3.428ON3641962324e-21
Skud_16.3973.428ON3352862306e-21
Suva_16.4383.428ON3352912297e-21
KLTH0F12056g3.428ON3502822262e-20
KLLA0D14861g3.428ON3342872252e-20
NCAS0A115203.428ON3351992252e-20
SAKL0F06028g3.428ON3341952253e-20
Kwal_23.39983.428ON3341952234e-20
Ecym_44503.428ON3341952235e-20
NDAI0A047703.428ON3352902165e-19
CAGL0B04125g3.428ON3342872093e-18
KAFR0A019902.542ON56080668.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADL120C
         (311 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADL120C Chr4 complement(477033..477968) [936 bp, 311 aa] {ON} Sy...   619   0.0  
Ecym_4382 Chr4 (803602..804537) [936 bp, 311 aa] {ON} similar to...   572   0.0  
KLLA0D16170g Chr4 complement(1362809..1363732) [924 bp, 307 aa] ...   516   0.0  
SAKL0F07458g Chr6 complement(570134..571081) [948 bp, 315 aa] {O...   513   0.0  
Kwal_55.20380 s55 (379749..380720) [972 bp, 323 aa] {ON} YIL021W...   511   0.0  
KLTH0E04598g Chr5 (415348..416334) [987 bp, 328 aa] {ON} similar...   509   0.0  
TDEL0H02530 Chr8 (425329..426264) [936 bp, 311 aa] {ON} Anc_7.19...   489   e-175
YIL021W Chr9 (312905..313861) [957 bp, 318 aa] {ON}  RPB3RNA pol...   486   e-174
Skud_9.148 Chr9 (282540..283496) [957 bp, 318 aa] {ON} YIL021W (...   485   e-174
ZYRO0D15796g Chr4 complement(1319952..1320878) [927 bp, 308 aa] ...   484   e-173
KAFR0A02650 Chr1 (548878..549816) [939 bp, 312 aa] {ON} Anc_7.19...   483   e-173
Smik_9.169 Chr9 (287469..288425) [957 bp, 318 aa] {ON} YIL021W (...   482   e-172
TBLA0J01520 Chr10 (344746..345753) [1008 bp, 335 aa] {ON} Anc_7....   481   e-172
Suva_9.178 Chr9 (300119..301078) [960 bp, 319 aa] {ON} YIL021W (...   480   e-172
CAGL0J02420g Chr10 complement(234977..235915) [939 bp, 312 aa] {...   478   e-171
NDAI0G02000 Chr7 (449842..450777) [936 bp, 311 aa] {ON} Anc_7.19...   477   e-171
NCAS0E01830 Chr5 (355752..356708) [957 bp, 318 aa] {ON} Anc_7.19...   472   e-168
Kpol_1063.11 s1063 (29092..29787,29789..30043) [951 bp, 316 aa] ...   464   e-165
TPHA0C04510 Chr3 complement(973590..974522) [933 bp, 310 aa] {ON...   461   e-164
KNAG0H02700 Chr8 (498753..499733) [981 bp, 326 aa] {ON} Anc_7.19...   454   e-161
Kpol_1018.139 s1018 (370051..371058) [1008 bp, 335 aa] {ON} (370...   105   2e-25
TBLA0F01700 Chr6 (423582..424583) [1002 bp, 333 aa] {ON} Anc_3.4...    98   8e-23
ZYRO0C12364g Chr3 complement(976920..977927) [1008 bp, 335 aa] {...    97   2e-22
KAFR0A05520 Chr1 (1101190..1102194) [1005 bp, 334 aa] {ON} Anc_3...    96   6e-22
Kpol_473.3 s473 complement(6708..7670) [963 bp, 320 aa] {ON} com...    96   6e-22
KNAG0A07600 Chr1 complement(1192867..1193871) [1005 bp, 334 aa] ...    94   2e-21
Smik_16.353 Chr16 complement(623974..624981) [1008 bp, 335 aa] {...    94   2e-21
TDEL0F03100 Chr6 complement(567682..568689) [1008 bp, 335 aa] {O...    94   3e-21
YPR110C Chr16 complement(745828..746835) [1008 bp, 335 aa] {ON} ...    94   3e-21
TPHA0D03920 Chr4 complement(821790..822797) [1008 bp, 335 aa] {O...    94   4e-21
ADR031C Chr4 complement(761933..763027) [1095 bp, 364 aa] {ON} S...    94   4e-21
Skud_16.397 Chr16 complement(710663..711670) [1008 bp, 335 aa] {...    93   6e-21
Suva_16.438 Chr16 complement(753618..754625) [1008 bp, 335 aa] {...    93   7e-21
KLTH0F12056g Chr6 (1016695..1017747) [1053 bp, 350 aa] {ON} high...    92   2e-20
KLLA0D14861g Chr4 complement(1253023..1254027) [1005 bp, 334 aa]...    91   2e-20
NCAS0A11520 Chr1 complement(2279808..2280815) [1008 bp, 335 aa] ...    91   2e-20
SAKL0F06028g Chr6 complement(453180..454184) [1005 bp, 334 aa] {...    91   3e-20
Kwal_23.3998 s23 (519065..520069) [1005 bp, 334 aa] {ON} YPR110C...    91   4e-20
Ecym_4450 Chr4 (921163..922167) [1005 bp, 334 aa] {ON} similar t...    91   5e-20
NDAI0A04770 Chr1 (1091856..1092863) [1008 bp, 335 aa] {ON} Anc_3...    88   5e-19
CAGL0B04125g Chr2 complement(401513..402517) [1005 bp, 334 aa] {...    85   3e-18
KAFR0A01990 Chr1 (418279..419961) [1683 bp, 560 aa] {ON} Anc_2.5...    30   8.6  

>ADL120C Chr4 complement(477033..477968) [936 bp, 311 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL021W
           (RPB3)
          Length = 311

 Score =  619 bits (1596), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/298 (100%), Positives = 298/298 (100%)

Query: 1   MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIESNTSVLAD 60
           MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIESNTSVLAD
Sbjct: 1   MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIESNTSVLAD 60

Query: 61  EFISHRLGLVPLQSKDIDQLVYCRDCFCEDHCDRCSVLLTLHAVGESESTTNVYAKDLQI 120
           EFISHRLGLVPLQSKDIDQLVYCRDCFCEDHCDRCSVLLTLHAVGESESTTNVYAKDLQI
Sbjct: 61  EFISHRLGLVPLQSKDIDQLVYCRDCFCEDHCDRCSVLLTLHAVGESESTTNVYAKDLQI 120

Query: 121 VSDLGGKNIGHPIIQDKEANGVLICKLRKGQELRLKCVAKKGIAKEHAKWSPAAAIEFEY 180
           VSDLGGKNIGHPIIQDKEANGVLICKLRKGQELRLKCVAKKGIAKEHAKWSPAAAIEFEY
Sbjct: 121 VSDLGGKNIGHPIIQDKEANGVLICKLRKGQELRLKCVAKKGIAKEHAKWSPAAAIEFEY 180

Query: 181 DPWNKLRHTDYWHEQDPEAEWPHSKNCEFEDPPNEDDQFDYSAKPNTFYMNVESVGSIPS 240
           DPWNKLRHTDYWHEQDPEAEWPHSKNCEFEDPPNEDDQFDYSAKPNTFYMNVESVGSIPS
Sbjct: 181 DPWNKLRHTDYWHEQDPEAEWPHSKNCEFEDPPNEDDQFDYSAKPNTFYMNVESVGSIPS 240

Query: 241 DQVVIRGIKTLQDKVADILFSLKKMDQDKVAFGGPTGDAAPMEVDQDPYSATSGRFNE 298
           DQVVIRGIKTLQDKVADILFSLKKMDQDKVAFGGPTGDAAPMEVDQDPYSATSGRFNE
Sbjct: 241 DQVVIRGIKTLQDKVADILFSLKKMDQDKVAFGGPTGDAAPMEVDQDPYSATSGRFNE 298

>Ecym_4382 Chr4 (803602..804537) [936 bp, 311 aa] {ON} similar to
           Ashbya gossypii ADL120C
          Length = 311

 Score =  572 bits (1473), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/311 (87%), Positives = 287/311 (92%)

Query: 1   MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIESNTSVLAD 60
           MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIE+NTSVLAD
Sbjct: 1   MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIETNTSVLAD 60

Query: 61  EFISHRLGLVPLQSKDIDQLVYCRDCFCEDHCDRCSVLLTLHAVGESESTTNVYAKDLQI 120
           EFISHRLGL+PLQSKDIDQLVYCRDC+CEDHCDRCSV+LTL AVGESESTTNVYAKDLQI
Sbjct: 61  EFISHRLGLIPLQSKDIDQLVYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLQI 120

Query: 121 VSDLGGKNIGHPIIQDKEANGVLICKLRKGQELRLKCVAKKGIAKEHAKWSPAAAIEFEY 180
           VSDLGGKNIGHPIIQDKEANG+L+CKLRKGQELRLKCVAKKGI+KEHAKWSPAAAIEFEY
Sbjct: 121 VSDLGGKNIGHPIIQDKEANGILVCKLRKGQELRLKCVAKKGISKEHAKWSPAAAIEFEY 180

Query: 181 DPWNKLRHTDYWHEQDPEAEWPHSKNCEFEDPPNEDDQFDYSAKPNTFYMNVESVGSIPS 240
           DPWNKL+HTDYW EQD  +EWPHSKNCEFEDP N+DD FDYSAKPN FY+NVESVGSI S
Sbjct: 181 DPWNKLKHTDYWFEQDATSEWPHSKNCEFEDPLNDDDVFDYSAKPNIFYINVESVGSITS 240

Query: 241 DQVVIRGIKTLQDKVADILFSLKKMDQDKVAFGGPTGDAAPMEVDQDPYSATSGRFNEXX 300
           DQVVIRGIKTLQDKVADILFSLKKMDQDKVAFGGPT + APMEVD DPYS T+G++NE  
Sbjct: 241 DQVVIRGIKTLQDKVADILFSLKKMDQDKVAFGGPTSENAPMEVDHDPYSGTNGQYNEYN 300

Query: 301 XXXXXXXXXXW 311
                     W
Sbjct: 301 DNTNTAYDDAW 311

>KLLA0D16170g Chr4 complement(1362809..1363732) [924 bp, 307 aa]
           {ON} highly similar to uniprot|P16370 Saccharomyces
           cerevisiae YIL021W
          Length = 307

 Score =  516 bits (1328), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 243/299 (81%), Positives = 267/299 (89%), Gaps = 5/299 (1%)

Query: 1   MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIESNTSVLAD 60
           MSEEGPQVKIREATKDNVDFILSNVDL+LANSLRR+MI+EIPTLAIDSVEIE+NT+VLAD
Sbjct: 1   MSEEGPQVKIREATKDNVDFILSNVDLALANSLRRVMISEIPTLAIDSVEIETNTTVLAD 60

Query: 61  EFISHRLGLVPLQSKDIDQLVYCRDCFCEDHCDRCSVLLTLHAVGESESTTNVYAKDLQI 120
           EFI+HRLGL+PLQS DIDQ+VYCRDC+CEDHCDRCSV L LHA+GESESTTNVYAKDLQI
Sbjct: 61  EFIAHRLGLIPLQSADIDQVVYCRDCYCEDHCDRCSVELILHAIGESESTTNVYAKDLQI 120

Query: 121 VSDLGGKNIGHPIIQDKEANGVLICKLRKGQELRLKCVAKKGIAKEHAKWSPAAAIEFEY 180
            SDL G+NIGHPIIQD+EANGVLICKLRKGQE+R+KC+AKKGI+KEHAKWSP+AAIEFEY
Sbjct: 121 TSDLKGRNIGHPIIQDREANGVLICKLRKGQEIRVKCIAKKGISKEHAKWSPSAAIEFEY 180

Query: 181 DPWNKLRHTDYWHEQDPEAEWPHSKNCEFEDPPNEDDQFDYSAKPNTFYMNVESVGSIPS 240
           DPWNKL+HTDYW+EQD   EWP SKNCEFEDPPNED+ FDY AKPNTFY+NVESVGSI S
Sbjct: 181 DPWNKLKHTDYWYEQDARDEWPQSKNCEFEDPPNEDEDFDYRAKPNTFYINVESVGSITS 240

Query: 241 DQVVIRGIKTLQDKVADILFSLKKMDQDKVAFGGP-----TGDAAPMEVDQDPYSATSG 294
           +QVV+RGIKTLQDKVADILFSLKKMDQ+KV F             PME D DPY    G
Sbjct: 241 EQVVVRGIKTLQDKVADILFSLKKMDQEKVNFAAGAVSTHVSQQVPMEEDMDPYGGPVG 299

>SAKL0F07458g Chr6 complement(570134..571081) [948 bp, 315 aa] {ON}
           highly similar to uniprot|P16370 Saccharomyces
           cerevisiae YIL021W
          Length = 315

 Score =  513 bits (1322), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 240/304 (78%), Positives = 275/304 (90%), Gaps = 7/304 (2%)

Query: 1   MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIESNTSVLAD 60
           M+EEGPQVKIREATKD+VDFILSNVD++LANS RR+MIAEIPTLAIDSVE+E+NT+VLAD
Sbjct: 1   MTEEGPQVKIREATKDSVDFILSNVDIALANSFRRVMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFISHRLGLVPLQSKDIDQLVYCRDCFCEDHCDRCSVLLTLHAVGESESTTNVYAKDLQI 120
           EFI+HRLGL+PLQS DI+ LVYCRDC+CEDHCDRCSV+LTL AVGESESTTNVYAKDL I
Sbjct: 61  EFIAHRLGLIPLQSADINDLVYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLVI 120

Query: 121 VSDLGGKNIGHPIIQDKEANGVLICKLRKGQELRLKCVAKKGIAKEHAKWSPAAAIEFEY 180
           VS+L G+NIGHPIIQDKE NGVLICKLRKGQEL+LKC+AKKGI+KEHAKWSPA+AIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLKCIAKKGISKEHAKWSPASAIEFEY 180

Query: 181 DPWNKLRHTDYWHEQDPEAEWPHSKNCEFEDPPNEDDQFDYSAKPNTFYMNVESVGSIPS 240
           DPWNKL+HTDYW+EQD  AEWP SKNCE+EDPPNEDD FDY+AKPNTFYM+VE+VGS+ S
Sbjct: 181 DPWNKLKHTDYWYEQDVAAEWPQSKNCEYEDPPNEDDVFDYNAKPNTFYMSVETVGSLTS 240

Query: 241 DQVVIRGIKTLQDKVADILFSLKKMDQDKVAFGGPTGDAAPMEVDQ-------DPYSATS 293
           DQVVIRGIKTLQDKVADILFSLKKMDQ++V FGG  G+A  ++V         DPY++  
Sbjct: 241 DQVVIRGIKTLQDKVADILFSLKKMDQERVNFGGAGGNADNVDVAMDGENEMSDPYTSNQ 300

Query: 294 GRFN 297
            ++N
Sbjct: 301 DQYN 304

>Kwal_55.20380 s55 (379749..380720) [972 bp, 323 aa] {ON} YIL021W
           (RPB3) - 45 kDa subunit of RNA polymerase II [contig
           149] FULL
          Length = 323

 Score =  511 bits (1316), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 240/279 (86%), Positives = 261/279 (93%)

Query: 1   MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIESNTSVLAD 60
           M+EEGPQVKIREATKDNVDFILSNVD+++ANSLRR+MIAEIPT+AIDSVE+E+NTSVLAD
Sbjct: 1   MAEEGPQVKIREATKDNVDFILSNVDMAMANSLRRVMIAEIPTIAIDSVEVETNTSVLAD 60

Query: 61  EFISHRLGLVPLQSKDIDQLVYCRDCFCEDHCDRCSVLLTLHAVGESESTTNVYAKDLQI 120
           EFISHRLGLVPLQS DI+ L+YCRDC+CED+CDRCSV+LTL AVGESESTTNVYAKDL I
Sbjct: 61  EFISHRLGLVPLQSSDINDLIYCRDCYCEDNCDRCSVVLTLQAVGESESTTNVYAKDLVI 120

Query: 121 VSDLGGKNIGHPIIQDKEANGVLICKLRKGQELRLKCVAKKGIAKEHAKWSPAAAIEFEY 180
           VS+L G+NIGHPIIQDK+ANGVLICKLRKGQEL+LKCVAKKGIAKEHAKWSPAAAIEFEY
Sbjct: 121 VSNLLGRNIGHPIIQDKDANGVLICKLRKGQELKLKCVAKKGIAKEHAKWSPAAAIEFEY 180

Query: 181 DPWNKLRHTDYWHEQDPEAEWPHSKNCEFEDPPNEDDQFDYSAKPNTFYMNVESVGSIPS 240
           DPWNKL+HTDYWHE D  AEWP SKNCE+EDPPNEDD FDY AKP TFYMNVESVGS+  
Sbjct: 181 DPWNKLKHTDYWHETDAAAEWPQSKNCEYEDPPNEDDAFDYRAKPTTFYMNVESVGSLTV 240

Query: 241 DQVVIRGIKTLQDKVADILFSLKKMDQDKVAFGGPTGDA 279
           DQVVIRG+KTLQDKVADILFSLKKMDQDKV FGG  G A
Sbjct: 241 DQVVIRGMKTLQDKVADILFSLKKMDQDKVNFGGAAGLA 279

>KLTH0E04598g Chr5 (415348..416334) [987 bp, 328 aa] {ON} similar to
           uniprot|P16370 Saccharomyces cerevisiae YIL021W
          Length = 328

 Score =  509 bits (1312), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 240/291 (82%), Positives = 265/291 (91%), Gaps = 4/291 (1%)

Query: 1   MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIESNTSVLAD 60
           M+EEGPQVKIREATKDNVDFILSNVD+++ANSLRR+MIAEIPTLAIDSVE+E+NTSVLAD
Sbjct: 1   MAEEGPQVKIREATKDNVDFILSNVDITMANSLRRVMIAEIPTLAIDSVEVETNTSVLAD 60

Query: 61  EFISHRLGLVPLQSKDIDQLVYCRDCFCEDHCDRCSVLLTLHAVGESESTTNVYAKDLQI 120
           EFISHRLGL+PLQS DI+ L+YCRDC+CEDHCDRCSV+LTL AVGESESTTNVYAKDL I
Sbjct: 61  EFISHRLGLIPLQSSDINDLIYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLVI 120

Query: 121 VSDLGGKNIGHPIIQDKEANGVLICKLRKGQELRLKCVAKKGIAKEHAKWSPAAAIEFEY 180
           VS+L G+NIGHPIIQDK+ NGVLICKLRKGQEL+LKCVAKKGI+KEHAKWSPAAAIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKDGNGVLICKLRKGQELKLKCVAKKGISKEHAKWSPAAAIEFEY 180

Query: 181 DPWNKLRHTDYWHEQDPEAEWPHSKNCEFEDPPNEDDQFDYSAKPNTFYMNVESVGSIPS 240
           DPWNKL+HTDYWHE D  AEWP SKNCE+EDPPNED+ FDY+AKP TFYMNVE+VGS+  
Sbjct: 181 DPWNKLKHTDYWHETDAAAEWPQSKNCEYEDPPNEDEAFDYNAKPTTFYMNVETVGSLTV 240

Query: 241 DQVVIRGIKTLQDKVADILFSLKKMDQDKVAFGGPTG----DAAPMEVDQD 287
           DQVVIRG+KTLQDKVADILFSLKKMDQDKV FGG  G    D   M V+ D
Sbjct: 241 DQVVIRGMKTLQDKVADILFSLKKMDQDKVNFGGTAGMVDQDGGAMPVEPD 291

>TDEL0H02530 Chr8 (425329..426264) [936 bp, 311 aa] {ON} Anc_7.194
           YIL021W
          Length = 311

 Score =  489 bits (1258), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 233/309 (75%), Positives = 264/309 (85%), Gaps = 11/309 (3%)

Query: 1   MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIESNTSVLAD 60
           MSE GPQVKIREATKDNVDFILS VDL++ANSLRRIM+AEIPTLAIDSVEIE+NT+VLAD
Sbjct: 1   MSETGPQVKIREATKDNVDFILSQVDLAMANSLRRIMMAEIPTLAIDSVEIETNTTVLAD 60

Query: 61  EFISHRLGLVPLQSKDIDQLVYCRDCFCEDHCDRCSVLLTLHAVGESESTTNVYAKDLQI 120
           EFI+HRLGL+PLQS DI+QL YCRDCFCEDHCD+CSV+LTL A+GESESTTNVYAKDL I
Sbjct: 61  EFIAHRLGLIPLQSTDIEQLEYCRDCFCEDHCDKCSVVLTLQAIGESESTTNVYAKDLVI 120

Query: 121 VSDLGGKNIGHPIIQDKEANGVLICKLRKGQELRLKCVAKKGIAKEHAKWSPAAAIEFEY 180
           VS+L G+NIGHPIIQDKE NGVLICKLRKGQEL +KCVAKKGI+KEHAKW PAAAIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELSMKCVAKKGISKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLRHTDYWHEQDPEAEWPHSKNCEFEDPPNEDDQFDYSAKPNTFYMNVESVGSIPS 240
           DPWNKL+HTDYW+EQD   EWP SKN E+EDPPN+DD FDY AK NTFYMNVE+VGSI +
Sbjct: 181 DPWNKLKHTDYWYEQDISKEWPLSKNSEYEDPPNKDDAFDYKAKANTFYMNVETVGSIAT 240

Query: 241 DQVVIRGIKTLQDKVADILFSLKKMDQDKVAFG-----GPTGDAAPMEV------DQDPY 289
           DQVV+RGI TLQ KVA IL +L +MDQ++V FG     G   DA  ++V      DQ+PY
Sbjct: 241 DQVVLRGIDTLQKKVASILLALNQMDQERVNFGTANNTGAIQDAGNVDVAMDGVQDQNPY 300

Query: 290 SATSGRFNE 298
           S   G ++E
Sbjct: 301 SNGGGAYDE 309

>YIL021W Chr9 (312905..313861) [957 bp, 318 aa] {ON}  RPB3RNA
           polymerase II third largest subunit B44, part of central
           core; similar to prokaryotic alpha subunit
          Length = 318

 Score =  486 bits (1250), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 232/308 (75%), Positives = 257/308 (83%), Gaps = 11/308 (3%)

Query: 1   MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIESNTSVLAD 60
           MSEEGPQVKIREA+KDNVDFILSNVDL++ANSLRR+MIAEIPTLAIDSVE+E+NT+VLAD
Sbjct: 1   MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFISHRLGLVPLQSKDIDQLVYCRDCFCEDHCDRCSVLLTLHAVGESESTTNVYAKDLQI 120
           EFI+HRLGL+PLQS DI+QL Y RDCFCEDHCD+CSV+LTL A GESESTTNVY+KDL I
Sbjct: 61  EFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVI 120

Query: 121 VSDLGGKNIGHPIIQDKEANGVLICKLRKGQELRLKCVAKKGIAKEHAKWSPAAAIEFEY 180
           VS+L G+NIGHPIIQDKE NGVLICKLRKGQEL+L CVAKKGIAKEHAKW PAAAIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLRHTDYWHEQDPEAEWPHSKNCEFEDPPNEDDQFDYSAKPNTFYMNVESVGSIPS 240
           DPWNKL+HTDYW+EQD   EWP SKNCE+EDPPNE D FDY A+ +TFYMNVESVGSIP 
Sbjct: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV 240

Query: 241 DQVVIRGIKTLQDKVADILFSLKKMDQDKVAFG-----------GPTGDAAPMEVDQDPY 289
           DQVV+RGI TLQ KVA IL +L +MDQDKV F            G   D      +QDPY
Sbjct: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPY 300

Query: 290 SATSGRFN 297
           S  S   N
Sbjct: 301 SNASQMGN 308

>Skud_9.148 Chr9 (282540..283496) [957 bp, 318 aa] {ON} YIL021W
           (REAL)
          Length = 318

 Score =  485 bits (1249), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 232/308 (75%), Positives = 258/308 (83%), Gaps = 11/308 (3%)

Query: 1   MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIESNTSVLAD 60
           MSEEGPQVKIREA+KD VDFILSNVDL++ANSLRR+MIAEIPTLAIDSVE+E+NT+VLAD
Sbjct: 1   MSEEGPQVKIREASKDGVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFISHRLGLVPLQSKDIDQLVYCRDCFCEDHCDRCSVLLTLHAVGESESTTNVYAKDLQI 120
           EFI+HRLGL+PLQS DI+QL Y RDCFCEDHCD+CSV+LTL A GESESTTNVY+KDL I
Sbjct: 61  EFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVI 120

Query: 121 VSDLGGKNIGHPIIQDKEANGVLICKLRKGQELRLKCVAKKGIAKEHAKWSPAAAIEFEY 180
           VS+L G+NIGHPIIQDKE NGVLICKLRKGQEL+L CVAKKGIAKEHAKW PAAAIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLRHTDYWHEQDPEAEWPHSKNCEFEDPPNEDDQFDYSAKPNTFYMNVESVGSIPS 240
           DPWNKL+HTDYW+EQD   EWP SKNCE+EDPPNE D FDY A+ +TFYMNVESVGSIP 
Sbjct: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAEADTFYMNVESVGSIPV 240

Query: 241 DQVVIRGIKTLQDKVADILFSLKKMDQDKVAFGGPTGDAAP-----------MEVDQDPY 289
           DQVV+RGI TLQ KVA IL +L +MDQDKV F     +AAP              +QDPY
Sbjct: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNAAPNMLGTNEDVVMTGAEQDPY 300

Query: 290 SATSGRFN 297
           S  S   N
Sbjct: 301 SNASQMGN 308

>ZYRO0D15796g Chr4 complement(1319952..1320878) [927 bp, 308 aa]
           {ON} highly similar to uniprot|P16370 Saccharomyces
           cerevisiae YIL021W
          Length = 308

 Score =  484 bits (1245), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 230/300 (76%), Positives = 258/300 (86%), Gaps = 6/300 (2%)

Query: 1   MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIESNTSVLAD 60
           MSEEGPQVKIREAT++NVDFILS+V+L++ANSLRR+MIAEIPTLAIDSVE+E+NTSVLAD
Sbjct: 1   MSEEGPQVKIREATRENVDFILSHVELAMANSLRRVMIAEIPTLAIDSVEVETNTSVLAD 60

Query: 61  EFISHRLGLVPLQSKDIDQLVYCRDCFCEDHCDRCSVLLTLHAVGESESTTNVYAKDLQI 120
           EFI+HRLGL+PLQS DI+QL YCRDCFCEDHCD+CSV+LTL A+GESESTTNVYAKDL I
Sbjct: 61  EFIAHRLGLIPLQSTDIEQLEYCRDCFCEDHCDKCSVVLTLQAIGESESTTNVYAKDLVI 120

Query: 121 VSDLGGKNIGHPIIQDKEANGVLICKLRKGQELRLKCVAKKGIAKEHAKWSPAAAIEFEY 180
           VS+L G+N+GHPIIQDKE NGVLICKLRKGQEL LKCVAKKGIAKEHAKW P+AAIEFEY
Sbjct: 121 VSNLMGRNLGHPIIQDKEGNGVLICKLRKGQELTLKCVAKKGIAKEHAKWGPSAAIEFEY 180

Query: 181 DPWNKLRHTDYWHEQDPEAEWPHSKNCEFEDPPNEDDQFDYSAKPNTFYMNVESVGSIPS 240
           DPWNKL+HT+YWHEQDP  EWP SKN E+EDPPNE + FDY A  NTFYMNVESVGS+ +
Sbjct: 181 DPWNKLKHTEYWHEQDPAKEWPLSKNSEYEDPPNEGEPFDYRATANTFYMNVESVGSLST 240

Query: 241 DQVVIRGIKTLQDKVADILFSLKKMDQDKVAF--GGPTGDAAP----MEVDQDPYSATSG 294
           DQVV+RGI TLQ KVA IL +L +MDQDKV F  G P G        M  D  PY AT G
Sbjct: 241 DQVVLRGIDTLQKKVASILLALTQMDQDKVNFASGAPMGAVGDGDTMMNGDDYPYGATGG 300

>KAFR0A02650 Chr1 (548878..549816) [939 bp, 312 aa] {ON} Anc_7.194
           YIL021W
          Length = 312

 Score =  483 bits (1242), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 228/295 (77%), Positives = 260/295 (88%), Gaps = 6/295 (2%)

Query: 1   MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIESNTSVLAD 60
           MSEEGPQVKIREATKDNVDFILSNVDL++ANSLRR+MIAEIPTLAIDSVE+E+NT+VLAD
Sbjct: 1   MSEEGPQVKIREATKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFISHRLGLVPLQSKDIDQLVYCRDCFCEDHCDRCSVLLTLHAVGESESTTNVYAKDLQI 120
           EFI+HRLGL+PLQS DI+QL Y RDCFCEDHCD+CSV+LTL AVGESESTTNVYAKDL I
Sbjct: 61  EFIAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLTI 120

Query: 121 VSDLGGKNIGHPIIQDKEANGVLICKLRKGQELRLKCVAKKGIAKEHAKWSPAAAIEFEY 180
           VS+L G+NIGHPIIQDKE NGVLICKLRKGQEL+L C+AKKGI+KEHAKW PAAAIEFEY
Sbjct: 121 VSNLLGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGISKEHAKWCPAAAIEFEY 180

Query: 181 DPWNKLRHTDYWHEQDPEAEWPHSKNCEFEDPPNEDDQFDYSAKPNTFYMNVESVGSIPS 240
           DPWNKL+HT+YW+EQDPE EWP+SKNCE+EDPPNE+D FDY AK +TFYMNVE+VGSI  
Sbjct: 181 DPWNKLKHTNYWYEQDPEKEWPNSKNCEYEDPPNENDPFDYKAKADTFYMNVETVGSISV 240

Query: 241 DQVVIRGIKTLQDKVADILFSLKKMDQDKVAFG-GPT-----GDAAPMEVDQDPY 289
           DQVV+RG+ TLQ KVA IL +L +MDQ+KV +  G T     GD A    +QD +
Sbjct: 241 DQVVVRGVDTLQKKVASILLALNQMDQEKVNYASGATADMNQGDIAMGGAEQDAF 295

>Smik_9.169 Chr9 (287469..288425) [957 bp, 318 aa] {ON} YIL021W
           (REAL)
          Length = 318

 Score =  482 bits (1240), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 231/308 (75%), Positives = 256/308 (83%), Gaps = 11/308 (3%)

Query: 1   MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIESNTSVLAD 60
           MSEEGPQVKIREA+KDNVDFILSNVDL++ANSLRR+MIAEIPTLAIDSVE+E+NT+VLAD
Sbjct: 1   MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFISHRLGLVPLQSKDIDQLVYCRDCFCEDHCDRCSVLLTLHAVGESESTTNVYAKDLQI 120
           EFI+HRLGL+PLQS DI+QL Y RDCFCEDHCD+CSV+LTL A GESESTTNVY+KDL I
Sbjct: 61  EFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVI 120

Query: 121 VSDLGGKNIGHPIIQDKEANGVLICKLRKGQELRLKCVAKKGIAKEHAKWSPAAAIEFEY 180
           VS+L G+NIGHPIIQDKE NGVLICKLRKGQEL+L CVAKKGIAKEHAKW PAAAIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLRHTDYWHEQDPEAEWPHSKNCEFEDPPNEDDQFDYSAKPNTFYMNVESVGSIPS 240
           DPWNKL+HTDYW+EQD   EWP SKNCE+ED PNE D FDY A+ +TFYMNVESVGSIP 
Sbjct: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDAPNEGDPFDYKAEADTFYMNVESVGSIPV 240

Query: 241 DQVVIRGIKTLQDKVADILFSLKKMDQDKVAFG-----------GPTGDAAPMEVDQDPY 289
           DQVV+RGI TLQ KVA IL +L +MDQDKV F            G   D      +QDPY
Sbjct: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNPSSNILGTNEDVMMAGAEQDPY 300

Query: 290 SATSGRFN 297
           S  S   N
Sbjct: 301 SNASQMGN 308

>TBLA0J01520 Chr10 (344746..345753) [1008 bp, 335 aa] {ON} Anc_7.194
           YIL021W
          Length = 335

 Score =  481 bits (1237), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 223/294 (75%), Positives = 253/294 (86%)

Query: 1   MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIESNTSVLAD 60
           MSEEGPQ+KIREATKDNVDFILSN+D++LANSLRR+MIAEIPTLAIDSVE+E NT+VLAD
Sbjct: 1   MSEEGPQIKIREATKDNVDFILSNIDMALANSLRRVMIAEIPTLAIDSVEVEMNTTVLAD 60

Query: 61  EFISHRLGLVPLQSKDIDQLVYCRDCFCEDHCDRCSVLLTLHAVGESESTTNVYAKDLQI 120
           EFISHRLGL+PLQS DIDQL YCRDCFCEDHCD+CSV+LTL AVGESESTTNVYAKDL I
Sbjct: 61  EFISHRLGLIPLQSADIDQLEYCRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLVI 120

Query: 121 VSDLGGKNIGHPIIQDKEANGVLICKLRKGQELRLKCVAKKGIAKEHAKWSPAAAIEFEY 180
           VS+L G+NIGHPIIQDKE NGVLICKLRKGQEL++ CVAKKGIAKEHAKW   AAIE+EY
Sbjct: 121 VSNLLGRNIGHPIIQDKEGNGVLICKLRKGQELKMTCVAKKGIAKEHAKWGATAAIEYEY 180

Query: 181 DPWNKLRHTDYWHEQDPEAEWPHSKNCEFEDPPNEDDQFDYSAKPNTFYMNVESVGSIPS 240
           DPWNKL+HTDYW+E DP  EWPHSKNC++EDPP E + FDY AK NTFYMNVE+VGSI +
Sbjct: 181 DPWNKLKHTDYWYENDPLKEWPHSKNCQYEDPPTEGELFDYKAKANTFYMNVEAVGSITT 240

Query: 241 DQVVIRGIKTLQDKVADILFSLKKMDQDKVAFGGPTGDAAPMEVDQDPYSATSG 294
           DQV+IRGI TLQ K A IL +L +M+Q+KV FG  T D   +    D    ++G
Sbjct: 241 DQVIIRGIDTLQKKTAGILLALSQMEQEKVNFGTGTQDNNDLHQQDDHMGMSNG 294

>Suva_9.178 Chr9 (300119..301078) [960 bp, 319 aa] {ON} YIL021W
           (REAL)
          Length = 319

 Score =  480 bits (1235), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 229/308 (74%), Positives = 256/308 (83%), Gaps = 11/308 (3%)

Query: 1   MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIESNTSVLAD 60
           MSEEGPQVKIREA+KDNVDFIL++VDL++ANSLRRIMIAEIPTLAIDSVE+E+NT+VLAD
Sbjct: 1   MSEEGPQVKIREASKDNVDFILTSVDLAMANSLRRIMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFISHRLGLVPLQSKDIDQLVYCRDCFCEDHCDRCSVLLTLHAVGESESTTNVYAKDLQI 120
           EFI+HRLGL+PLQS DI+QL Y RDCFCEDHCD+CSV+LTL A GESESTTNVYAKDL I
Sbjct: 61  EFIAHRLGLIPLQSLDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120

Query: 121 VSDLGGKNIGHPIIQDKEANGVLICKLRKGQELRLKCVAKKGIAKEHAKWSPAAAIEFEY 180
           VS+L G+NIGHP+IQDKE NGVLICKLRKGQEL+L CVAKKGIAKEHAKW PAAAIEFEY
Sbjct: 121 VSNLLGRNIGHPVIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLRHTDYWHEQDPEAEWPHSKNCEFEDPPNEDDQFDYSAKPNTFYMNVESVGSIPS 240
           DPWNKL+HTDYW+EQD   EWP SKNCE+EDPPNE D FDY A+ +TFYMNVESVGSI  
Sbjct: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDAFDYKAEADTFYMNVESVGSITV 240

Query: 241 DQVVIRGIKTLQDKVADILFSLKKMDQDKVAFG-----------GPTGDAAPMEVDQDPY 289
           DQVV+RGI TLQ KVA IL +L +MDQDKV F            G   D      +QDPY
Sbjct: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNVASNMLGTNEDVMMTGAEQDPY 300

Query: 290 SATSGRFN 297
           +  S   N
Sbjct: 301 ANASQMGN 308

>CAGL0J02420g Chr10 complement(234977..235915) [939 bp, 312 aa] {ON}
           highly similar to uniprot|P16370 Saccharomyces
           cerevisiae YIL021w RPB3
          Length = 312

 Score =  478 bits (1229), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 224/287 (78%), Positives = 256/287 (89%), Gaps = 2/287 (0%)

Query: 1   MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIESNTSVLAD 60
           MSEEGPQVKIREAT+DNVDFILSNVDL+LANSLRR+MIAEIPTLAIDSVE+E+NT+VLAD
Sbjct: 1   MSEEGPQVKIREATRDNVDFILSNVDLALANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFISHRLGLVPLQSKDIDQLVYCRDCFCEDHCDRCSVLLTLHAVGESESTTNVYAKDLQI 120
           EF++HRLGL+PLQS DI+QL Y RDCFCEDHCD+CSV+LTL AVGESESTTNVYAKDL I
Sbjct: 61  EFLAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLLI 120

Query: 121 VSDLGGKNIGHPIIQDKEANGVLICKLRKGQELRLKCVAKKGIAKEHAKWSPAAAIEFEY 180
           VS+L G+NIGHPIIQDKE NGVLICKLRKGQEL+L C+AKKGIAKEHAKW PAAAIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLRHTDYWHEQDPEAEWPHSKNCEFEDPPNEDDQFDYSAKPNTFYMNVESVGSIPS 240
           DPWNKL+HTDYW+E+D   EWP SKNCE+EDPPN+D+ FDY AK +TFYMNVE+VGSI  
Sbjct: 181 DPWNKLQHTDYWYEEDIRKEWPQSKNCEYEDPPNDDEPFDYKAKADTFYMNVEAVGSIAV 240

Query: 241 DQVVIRGIKTLQDKVADILFSLKKMDQDKVAFGGPTGDAAPMEVDQD 287
           DQVV+RGI TLQ KVA I+ +L +MDQ+KV F   TGDA    +++D
Sbjct: 241 DQVVLRGIDTLQKKVASIMLALNQMDQEKVNFA--TGDAKGNGIEED 285

>NDAI0G02000 Chr7 (449842..450777) [936 bp, 311 aa] {ON} Anc_7.194
           YIL021W
          Length = 311

 Score =  477 bits (1227), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 226/303 (74%), Positives = 258/303 (85%), Gaps = 5/303 (1%)

Query: 1   MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIESNTSVLAD 60
           MSEEGPQVKIREATKDNVDFILSN+DL+LANS RR+MIAEIPTLAIDSV+IE+NT+VLAD
Sbjct: 1   MSEEGPQVKIREATKDNVDFILSNIDLALANSFRRVMIAEIPTLAIDSVQIETNTTVLAD 60

Query: 61  EFISHRLGLVPLQSKDIDQLVYCRDCFCEDHCDRCSVLLTLHAVGESESTTNVYAKDLQI 120
           EFI+HRLGL+PLQS DI+QL Y RDCFCEDHCD+CSV+LTL A GESESTTNVYAKDL I
Sbjct: 61  EFIAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120

Query: 121 VSDLGGKNIGHPIIQDKEANGVLICKLRKGQELRLKCVAKKGIAKEHAKWSPAAAIEFEY 180
           VS+L G+NIGHPIIQDKE NGVLICKLRKGQEL+L CVAKKGIAKEHAKW PAAAIEFEY
Sbjct: 121 VSNLLGRNIGHPIIQDKENNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLRHTDYWHEQDPEAEWPHSKNCEFEDPPNEDDQFDYSAKPNTFYMNVESVGSIPS 240
           DPWNKL+HTDYW+EQDP+ EWP+SKNCE+EDPPNE + FDY AK  TFYMNVE+VGSI  
Sbjct: 181 DPWNKLKHTDYWYEQDPQKEWPNSKNCEYEDPPNEGEPFDYKAKAETFYMNVETVGSISV 240

Query: 241 DQVVIRGIKTLQDKVADILFSLKKMDQDKVAF-----GGPTGDAAPMEVDQDPYSATSGR 295
           DQVV+RGI TLQ KVA IL +L +MDQ+K+ +     G    +    +VD D  +  +G 
Sbjct: 241 DQVVVRGINTLQQKVASILLALTQMDQEKMQYATVTEGQQGNNMMNQDVDMDGDAYANGA 300

Query: 296 FNE 298
            N+
Sbjct: 301 NNQ 303

>NCAS0E01830 Chr5 (355752..356708) [957 bp, 318 aa] {ON} Anc_7.194
           YIL021W
          Length = 318

 Score =  472 bits (1214), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 220/278 (79%), Positives = 247/278 (88%), Gaps = 1/278 (0%)

Query: 1   MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIESNTSVLAD 60
           MSE GPQVKIREATKDNVDFILSNVDL+LANS RR+MIAEIPTLAIDSV+IE+NT+VLAD
Sbjct: 1   MSEAGPQVKIREATKDNVDFILSNVDLALANSFRRVMIAEIPTLAIDSVQIETNTTVLAD 60

Query: 61  EFISHRLGLVPLQSKDIDQLVYCRDCFCEDHCDRCSVLLTLHAVGESESTTNVYAKDLQI 120
           EFI+HRLGL+PLQS DI+QL Y RDCFCEDHCD+CSV+LTL A GESESTTNVYAKDL I
Sbjct: 61  EFIAHRLGLIPLQSLDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120

Query: 121 VSDLGGKNIGHPIIQDKEANGVLICKLRKGQELRLKCVAKKGIAKEHAKWSPAAAIEFEY 180
           VS+L G+NIGHPIIQD+E NGVLICKLRKGQEL++ C+AKKGIAKEHAKW PAAAIEFEY
Sbjct: 121 VSNLLGRNIGHPIIQDREGNGVLICKLRKGQELKITCIAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLRHTDYWHEQDPEAEWPHSKNCEFEDPPNEDDQFDYSAKPNTFYMNVESVGSIPS 240
           DPWNKL+HTDYW+EQD   EWP+SKNCE+EDPPNE + FDY AK  TFYMNVE+VGSIP 
Sbjct: 181 DPWNKLKHTDYWYEQDATKEWPNSKNCEYEDPPNEGELFDYKAKAETFYMNVETVGSIPV 240

Query: 241 DQVVIRGIKTLQDKVADILFSLKKMDQDKVAFG-GPTG 277
           DQVV+RG+ TLQ KVA IL +L +MDQ+KV F   P G
Sbjct: 241 DQVVVRGVDTLQKKVASILLALTQMDQEKVNFATNPNG 278

>Kpol_1063.11 s1063 (29092..29787,29789..30043) [951 bp, 316 aa]
           {ON} (29092..29787,29789..30043) [951 nt, 317 aa]
          Length = 316

 Score =  464 bits (1194), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 221/300 (73%), Positives = 251/300 (83%), Gaps = 10/300 (3%)

Query: 1   MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIESNTSVLAD 60
           MSEEGPQVKIREATKDNVDFILS+VD++LANSLRR+MIAEIPTLAIDSVE+ +NT+VLAD
Sbjct: 1   MSEEGPQVKIREATKDNVDFILSHVDMALANSLRRVMIAEIPTLAIDSVEVITNTTVLAD 60

Query: 61  EFISHRLGLVPLQSKDIDQLVYCRDCFCEDHCDRCSVLLTLHAVGESESTTNVYAKDLQI 120
           EFI+HRLGLVPLQS DI+QL YCRDCFCEDHCD+CSV+LTL AVGESESTTNVY+KDL I
Sbjct: 61  EFIAHRLGLVPLQSTDIEQLEYCRDCFCEDHCDKCSVVLTLQAVGESESTTNVYSKDLDI 120

Query: 121 VSDLGGKNIGHPIIQDKEANGVLICKLRKGQELRLKCVAKKGIAKEHAKWSPAAAIEFEY 180
           VS+L G+NIGHPIIQDKE NGVLICKLRKGQEL+L C+AKKGI+KEHAKW PAAAIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGISKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLRHTDYWHEQDPEAEWPHSKNCEFEDPPNEDDQFDYSAKPNTFYMNVESVGSIPS 240
           DPWNKL+HTD+W EQDP  EWP SKNCE+EDPP+E + FDY A+ + F    E+VG+I S
Sbjct: 181 DPWNKLKHTDFWFEQDPAKEWPQSKNCEYEDPPHEGEVFDYKAQADAFLYECETVGTISS 240

Query: 241 DQVVIRGIKTLQDKVADILFSLKKMDQDKVAFGGPT----------GDAAPMEVDQDPYS 290
           DQVV+RGI TLQ KVA IL +L +MDQDKV + G T          GD        DPYS
Sbjct: 241 DQVVLRGIDTLQKKVASILLALTQMDQDKVKYAGNTNIGAGGMEGNGDINMGGTGNDPYS 300

>TPHA0C04510 Chr3 complement(973590..974522) [933 bp, 310 aa] {ON}
           Anc_7.194 YIL021W
          Length = 310

 Score =  461 bits (1185), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 210/269 (78%), Positives = 242/269 (89%)

Query: 1   MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIESNTSVLAD 60
           MS+EGPQVKIREATKDNVDFI+SNVDL++AN+ RR+MIAEIPTLAIDSVE+ SNT+VLAD
Sbjct: 1   MSDEGPQVKIREATKDNVDFIVSNVDLAMANAFRRVMIAEIPTLAIDSVEVISNTTVLAD 60

Query: 61  EFISHRLGLVPLQSKDIDQLVYCRDCFCEDHCDRCSVLLTLHAVGESESTTNVYAKDLQI 120
           EFI+HRLGLVPLQS DI+QL Y RDCFCEDHCD+CSV+LTL A+GESESTTNVY+KDL I
Sbjct: 61  EFIAHRLGLVPLQSADIEQLEYSRDCFCEDHCDKCSVVLTLQALGESESTTNVYSKDLVI 120

Query: 121 VSDLGGKNIGHPIIQDKEANGVLICKLRKGQELRLKCVAKKGIAKEHAKWSPAAAIEFEY 180
           VSDL G+NIGHPIIQDKE NGVLICKLRKGQEL+  C+AKKGIAKEHAKW PAAAIEFEY
Sbjct: 121 VSDLLGRNIGHPIIQDKEGNGVLICKLRKGQELKFTCIAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLRHTDYWHEQDPEAEWPHSKNCEFEDPPNEDDQFDYSAKPNTFYMNVESVGSIPS 240
           DPWNKL+HT+YW+EQD   EWP SKNCE+EDPPNE  +FDY AK +TFYMNVE++G++ S
Sbjct: 181 DPWNKLKHTEYWYEQDAAKEWPQSKNCEYEDPPNEGSEFDYKAKADTFYMNVETIGTVTS 240

Query: 241 DQVVIRGIKTLQDKVADILFSLKKMDQDK 269
           DQV++RGI  LQ KVA IL +L ++DQDK
Sbjct: 241 DQVIVRGIDILQKKVASILLALNRLDQDK 269

>KNAG0H02700 Chr8 (498753..499733) [981 bp, 326 aa] {ON} Anc_7.194
           YIL021W
          Length = 326

 Score =  454 bits (1167), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 206/273 (75%), Positives = 242/273 (88%)

Query: 1   MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIESNTSVLAD 60
           M+EEGPQVKIREA +DNVDFILSNV+L++ANSLRR+M+AEIPTLAIDSV++E+NT+VLAD
Sbjct: 1   MNEEGPQVKIREANRDNVDFILSNVELAMANSLRRVMVAEIPTLAIDSVQVETNTTVLAD 60

Query: 61  EFISHRLGLVPLQSKDIDQLVYCRDCFCEDHCDRCSVLLTLHAVGESESTTNVYAKDLQI 120
           EFI+HRLGL+PLQS DI++L YCRDCFCEDHCD+CSV+LTL AVGESESTTNVYAKDL I
Sbjct: 61  EFIAHRLGLIPLQSMDIERLEYCRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLTI 120

Query: 121 VSDLGGKNIGHPIIQDKEANGVLICKLRKGQELRLKCVAKKGIAKEHAKWSPAAAIEFEY 180
           VS+L G+NIGHPIIQDKE NGVLICKLRKGQEL++ C+AKKGIAKEHAKW P +AIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKENNGVLICKLRKGQELKMTCIAKKGIAKEHAKWGPTSAIEFEY 180

Query: 181 DPWNKLRHTDYWHEQDPEAEWPHSKNCEFEDPPNEDDQFDYSAKPNTFYMNVESVGSIPS 240
           DPWNKL+HT YW+E D   EWP+S+NCE+EDPP E + FDY +K  TFYMNVE++GSI  
Sbjct: 181 DPWNKLKHTSYWYEVDAAQEWPNSENCEYEDPPVEGEPFDYKSKAETFYMNVETIGSISV 240

Query: 241 DQVVIRGIKTLQDKVADILFSLKKMDQDKVAFG 273
           DQVV+RGI TLQ KVA IL SL +M+Q+K  F 
Sbjct: 241 DQVVVRGIDTLQKKVASILLSLTQMEQEKTNFA 273

>Kpol_1018.139 s1018 (370051..371058) [1008 bp, 335 aa] {ON}
           (370051..371058) [1008 nt, 336 aa]
          Length = 335

 Score =  105 bits (261), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 82/289 (28%), Positives = 140/289 (48%), Gaps = 47/289 (16%)

Query: 7   QVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIESNTSVLADEFISHR 66
           ++ I        +F L N+D S+AN+ RRIMI+E+P++A++ V   +NTSVL DE ++HR
Sbjct: 41  EINISSINSREANFDLINIDTSIANAFRRIMISEVPSVAVEYVYFLNNTSVLQDEVLAHR 100

Query: 67  LGLVPLQSKDIDQLVYCRDCFCEDH--CDRCSVLLTLHAVGESE--------------ST 110
           +GLVPL+  D D L +      E+    D  +++L+L+                      
Sbjct: 101 IGLVPLKV-DPDMLSWIDSELPEEEKFTDENTIVLSLNVKCTMNPDAPKDCTDPKILYKN 159

Query: 111 TNVYAKDLQIVSDLGGKNI----GHPIIQDKEAN-GVLICKLRKGQELRLKCVAKKGIAK 165
           +NVYA+DL+   +  GK +     +P++    AN  +L+CKLR GQE+ LK     GI  
Sbjct: 160 SNVYARDLKF--EPQGKQVESFANYPVVP---ANPDILLCKLRPGQEISLKAHCILGIGS 214

Query: 166 EHAKWSPAAAIEFEYDPWNKL----------RHTDYWH------EQDPEAEWPHSK---- 205
           +HAK+SP A   +   P   +          +   Y+         + EA    ++    
Sbjct: 215 DHAKFSPVATASYRLMPHINITQPITGEDAKKFQKYFMPGVIGINDNGEAYVKDARKDTV 274

Query: 206 NCEFEDPPNEDDQFDYSAKPNTFYMNVESVGSIPSDQVVIRGIKTLQDK 254
           + E    P  + +       N F +NVES G++  +++  + ++ L++K
Sbjct: 275 SREVFRHPEFEGKVKLGRVRNHFIVNVESTGAMTPEEIFFKSVRILRNK 323

>TBLA0F01700 Chr6 (423582..424583) [1002 bp, 333 aa] {ON} Anc_3.428
           YPR110C
          Length = 333

 Score = 98.2 bits (243), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 81/289 (28%), Positives = 135/289 (46%), Gaps = 50/289 (17%)

Query: 8   VKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIESNTSVLADEFISHRL 67
           +KI    + +  F L N+D S+AN+ RRIM+AE+P +A + V   +NTSV+ DE ++HR+
Sbjct: 42  IKISNLDERDATFDLINIDTSIANAFRRIMMAEVPAVAAEHVYFLNNTSVIQDEVLAHRI 101

Query: 68  GLVPLQSKDIDQLVYCRDCFCEDH--CDRCSVLLTLHAVGESE--------------STT 111
           GLVPL+  D D L +      E+    D  +++L+L+                    +  
Sbjct: 102 GLVPLKV-DPDMLTWVDQTLPEEERFTDENTIVLSLNVKCTKNDKAPKDCTDPKILYNNA 160

Query: 112 NVYAKDLQIVSDLGGKNI----GHPIIQDKEANGVLICKLRKGQELRLKCVAKKGIAKEH 167
           +VYA+DL+   +  GK +      P++       +L+ KLR GQE+ L+     GI  +H
Sbjct: 161 HVYARDLKF--EPQGKQVETFANCPVVPTDP--DILLAKLRPGQEISLRAHCILGIGSDH 216

Query: 168 AKWSPAAAIEFEYDP----WNKLRHTDYWHEQ-----------DPEAEWPHSKNCEFEDP 212
           AK+SP A   +   P       +R  D    Q           D EA   + K+   +  
Sbjct: 217 AKFSPVATASYRLLPHINITEPIRGKDAEKFQKCFTPGVIGIKDGEA---YVKDARMDTV 273

Query: 213 PNE-------DDQFDYSAKPNTFYMNVESVGSIPSDQVVIRGIKTLQDK 254
             E        D+       + F  NVES G++P +++  + ++ L++K
Sbjct: 274 SREVFRHQEFADKVKLGRVRDHFVFNVESTGAMPPEEIFFKSVRILKNK 322

>ZYRO0C12364g Chr3 complement(976920..977927) [1008 bp, 335 aa] {ON}
           highly similar to uniprot|P07703 Saccharomyces
           cerevisiae YPR110C RPC40 RNA polymerase subunit common
           to RNA polymerase I and III
          Length = 335

 Score = 97.1 bits (240), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 77/291 (26%), Positives = 134/291 (46%), Gaps = 52/291 (17%)

Query: 8   VKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIESNTSVLADEFISHRL 67
           V+I   T+   +F L +VD S+AN+ RRIMI+E+P++A + V   +NTSV+ DE ++HR+
Sbjct: 42  VRIGSLTEREANFDLVHVDTSIANAFRRIMISEVPSVATEYVYFLNNTSVIQDEVLAHRI 101

Query: 68  GLVPLQSKDIDQLVYCRDCFCEDH--CDRCSVLLTLHAVGESE--------------STT 111
           GLVPL+  D D L +      E+    D  ++++TL+                      +
Sbjct: 102 GLVPLKV-DPDMLTWVDHSLPEEEKFTDENTIVMTLNVKCTRNPDAPKDCTDPKILYRNS 160

Query: 112 NVYAKDLQIVSDLGGKNIGH----PIIQDKEANGVLICKLRKGQELRLKCVAKKGIAKEH 167
           ++YA+DL+   +  G  +      P+I       +L+ KLR GQE+ L+     G+  +H
Sbjct: 161 HIYARDLKF--EPQGSQVETFAKCPVIPTDP--DILLAKLRPGQEISLRAHCILGVGSDH 216

Query: 168 AKWSPAAAIEFEYDPWNKLRH------------------------TDYWHEQDPEAEWPH 203
           AK+SP A   +   P   +R                         TD  + QD   +   
Sbjct: 217 AKFSPVATASYRLLPHIDIREPIKGELAQKFQKCFPPGVIGINESTDEAYVQDARKDTVS 276

Query: 204 SKNCEFEDPPNEDDQFDYSAKPNTFYMNVESVGSIPSDQVVIRGIKTLQDK 254
            +    E+  N   +       + F  NVES G++  +++  + ++ L++K
Sbjct: 277 REVLRHEEFSN---KVKLGRVRDHFVFNVESTGAMTPEEIFFKSVRVLKNK 324

>KAFR0A05520 Chr1 (1101190..1102194) [1005 bp, 334 aa] {ON}
           Anc_3.428 YPR110C
          Length = 334

 Score = 95.9 bits (237), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 67/203 (33%), Positives = 102/203 (50%), Gaps = 33/203 (16%)

Query: 4   EGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIESNTSVLADEFI 63
           E   VKI    +   +F L ++D S+AN+ RRIMI+E+P +A++ V   +NTSV+ DE +
Sbjct: 38  ESFDVKISSMNEREANFDLVHIDTSVANAFRRIMISEVPAVAVEYVYFLNNTSVIQDEVL 97

Query: 64  SHRLGLVPLQSKDIDQLVYCRDCFCEDH--CDRCSVLLTLHAVGESE------------- 108
           +HR+GLVPL+  D D L +      +D    D  +++LTL+                   
Sbjct: 98  AHRIGLVPLKV-DPDMLTWIDSSLPDDEKFTDENTIVLTLNVKCTRNPDAPRDCTDPNIL 156

Query: 109 -STTNVYAKDLQIVSDLGGKNIGHPIIQDKEANG--------VLICKLRKGQELRLKCVA 159
              +NVYA DL+   +  GK +      +  AN         +L+ KLR GQE+ L+   
Sbjct: 157 YRNSNVYASDLKF--EPQGKQV------ETFANNAVVPCDPKILLAKLRPGQEISLRAHC 208

Query: 160 KKGIAKEHAKWSPAAAIEFEYDP 182
             GI  +HAK+SP A   +   P
Sbjct: 209 ILGIGSDHAKFSPVATASYRLLP 231

>Kpol_473.3 s473 complement(6708..7670) [963 bp, 320 aa] {ON}
           complement(6708..7670) [963 nt, 321 aa]
          Length = 320

 Score = 95.5 bits (236), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 78/291 (26%), Positives = 138/291 (47%), Gaps = 45/291 (15%)

Query: 4   EGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIESNTSVLADEFI 63
           E  ++ I +  +   +  L NVD S+AN+LRRIMI+E+P++A + + I +NTSV+ DE I
Sbjct: 24  ENLEINISKVGERETNLDLINVDTSIANALRRIMISEVPSVAAEYIYILNNTSVIQDEVI 83

Query: 64  SHRLGLVPLQSKDIDQLVYCRDCFCEDH--CDRCSVLLTLHAVGESE------------- 108
           + R+GL+PL+  D D+L +  +   ED    D  +++L+L+                   
Sbjct: 84  AQRIGLIPLKV-DPDRLTWLNNDLPEDEKFTDENTIVLSLNVKCTRNLDAPKDCTDPSIL 142

Query: 109 -STTNVYAKDLQIVSDLGGKN----IGHPIIQDKEANGVLICKLRKGQELRLKCVAKKGI 163
               ++YA+DL+   +  GK        P++       +LI KLR GQE+ L+     GI
Sbjct: 143 YHNAHIYARDLKF--EPQGKQEETFADSPVVSADP--DILIAKLRPGQEISLRAHCILGI 198

Query: 164 AKEHAKWSPAAAIEFEYDP----WNKLRHTDYWHEQD---------PEAEWPHSKNCEFE 210
             +HAK+SP     +   P      K++       Q           E +  + K+   +
Sbjct: 199 GADHAKFSPVCTASYRLMPKIIITEKIKGESAKRFQKCFPPGVIDINENDEAYVKDARKD 258

Query: 211 DPPNE-------DDQFDYSAKPNTFYMNVESVGSIPSDQVVIRGIKTLQDK 254
               E        D+       N F  N+E+VG++ ++++ ++ +K L++K
Sbjct: 259 TMTREVLRHEEFQDKVKLDRVRNHFIFNIETVGAMSAEEIFLKSVKILKNK 309

>KNAG0A07600 Chr1 complement(1192867..1193871) [1005 bp, 334 aa]
           {ON} Anc_3.428 YPR110C
          Length = 334

 Score = 94.4 bits (233), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 76/287 (26%), Positives = 135/287 (47%), Gaps = 45/287 (15%)

Query: 8   VKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIESNTSVLADEFISHRL 67
           +KI   ++   +F L ++D S+AN+ RRIMI+E+P++A + V + +NTSV+ DE ++HR+
Sbjct: 42  IKISSMSEREANFDLVHIDTSVANAFRRIMISEVPSVAAEYVYVMNNTSVIQDEVLAHRI 101

Query: 68  GLVPLQSKDIDQLVYCRDCFCEDH--CDRCSVLLTLHAVGESE--------------STT 111
           G++PL+  D D L +      E+    D  +V+LTL+                      +
Sbjct: 102 GMIPLKV-DPDMLTWIDQSLSEEEKFTDENTVVLTLNVKCTRNLNAPKDCTDPKILYKNS 160

Query: 112 NVYAKDLQIVSDLGGKNIGH----PIIQDKEANGVLICKLRKGQELRLKCVAKKGIAKEH 167
           +VYA+DL+   +  GK +      P++       +L+ KLR  QE+ L+     GI  +H
Sbjct: 161 SVYARDLRF--EPQGKQLETFADCPVVPSDP--DILLAKLRPNQEISLRVHCILGIGSDH 216

Query: 168 AKWSPAAAIEFEYDP-WNKLRHTDYWHEQDPEAEWPHS------------KNCEFEDPPN 214
           AK+SP A   +   P  N L        +  +A +P              +N   +    
Sbjct: 217 AKFSPVATASYRLLPHINILEPITGESAKRFQACFPQGVIGIDSEGKAVVENARKDTVSR 276

Query: 215 E-------DDQFDYSAKPNTFYMNVESVGSIPSDQVVIRGIKTLQDK 254
           E        D+       + F  NVES G++  +++  + ++ L++K
Sbjct: 277 EVLRYEEFKDKVKLGRVRDHFIFNVESTGAMTPEEIFFKSVRILKNK 323

>Smik_16.353 Chr16 complement(623974..624981) [1008 bp, 335 aa] {ON}
           YPR110C (REAL)
          Length = 335

 Score = 94.4 bits (233), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 80/289 (27%), Positives = 136/289 (47%), Gaps = 46/289 (15%)

Query: 7   QVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIESNTSVLADEFISHR 66
           +V I        +F L N+D S+AN+ RRIMI+E+P++A + V   +NTSV+ DE ++HR
Sbjct: 41  EVNISSLDAREANFDLINIDTSIANAFRRIMISEVPSVAAEYVYFFNNTSVIQDEVLAHR 100

Query: 67  LGLVPLQSKDIDQLVYCRDCFCEDH--CDRCSVLLTLHAV--------------GESEST 110
           +GLVPL+  D D L +      +D    D  +++L+L+                 E  + 
Sbjct: 101 IGLVPLKV-DPDMLTWVDSNLPDDEKFTDENTIVLSLNVKCTRNPDAPKGSTDPKELYNN 159

Query: 111 TNVYAKDLQIVSDLGGKN----IGHPIIQDKEANGVLICKLRKGQELRLKCVAKKGIAKE 166
            +VYA+DL+   +  GK        P++       +L+ KLR GQE+ LK     GI  +
Sbjct: 160 AHVYARDLKF--EPQGKQSTTFADFPVVPADP--DILLAKLRPGQEISLKAHCILGIGGD 215

Query: 167 HAKWSPAAAIEFEYDPW-NKLRHTDYWHEQDPEAEWP-------------HSKNCEFEDP 212
           HAK+SP +   +   P  N L+       +  +  +P             + K+   +  
Sbjct: 216 HAKFSPVSTASYRLLPQINILQPIKGESARRFQKCFPPGVIGIDESSDEVYVKDARKDTV 275

Query: 213 PNEDDQFDYSAKP-------NTFYMNVESVGSIPSDQVVIRGIKTLQDK 254
             E  ++D  A         N F  NVES G++  +++  + ++ L++K
Sbjct: 276 SREVLRYDEFADKVKLGRVRNHFIFNVESAGAMTPEEIFFKSVRILKNK 324

>TDEL0F03100 Chr6 complement(567682..568689) [1008 bp, 335 aa] {ON}
           Anc_3.428 YPR110C
          Length = 335

 Score = 94.0 bits (232), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 65/196 (33%), Positives = 101/196 (51%), Gaps = 27/196 (13%)

Query: 8   VKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIESNTSVLADEFISHRL 67
           V+I   T+   +F L ++D S+AN+ RRIMI+E+P+LA + V   +NTSV+ DE ++HR+
Sbjct: 42  VQIESLTEREANFDLIHIDTSIANAFRRIMISEVPSLAPEHVYFLNNTSVIQDEVLAHRI 101

Query: 68  GLVPLQSKDIDQLVYCRDCFCEDH--CDRCSVLLTLHAVGESE--------------STT 111
           GLVPL+  D D L +      E+    D  +++LTL+                      +
Sbjct: 102 GLVPLKV-DPDMLTWVDSTLPEEERFTDENTIVLTLNVTCTRNPDAPKDCTDPKILYRNS 160

Query: 112 NVYAKDLQI-----VSDLGGKNIGHPIIQDKEANGVLICKLRKGQELRLKCVAKKGIAKE 166
           +VYA DL+       ++L  K    P   D     +L+ KLR GQE+ L+     G+  +
Sbjct: 161 SVYAHDLKFEPQGRQAELFAKCPVVPADPD-----ILLAKLRPGQEISLRAHCILGVGGD 215

Query: 167 HAKWSPAAAIEFEYDP 182
           HAK+SP A   +   P
Sbjct: 216 HAKFSPVATASYRLLP 231

>YPR110C Chr16 complement(745828..746835) [1008 bp, 335 aa] {ON}
           RPC40RNA polymerase subunit AC40, common to RNA
           polymerase I and III
          Length = 335

 Score = 93.6 bits (231), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 76/291 (26%), Positives = 133/291 (45%), Gaps = 50/291 (17%)

Query: 7   QVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIESNTSVLADEFISHR 66
           +V I        +F L N+D S+AN+ RRIMI+E+P++A + V   +NTSV+ DE ++HR
Sbjct: 41  EVNISSLDAREANFDLINIDTSIANAFRRIMISEVPSVAAEYVYFFNNTSVIQDEVLAHR 100

Query: 67  LGLVPLQSKDIDQLVYCRDCFCEDH--CDRCSVLLTLHAV--------------GESEST 110
           +GLVPL+  D D L +      +D    D  +++L+L+                 E  + 
Sbjct: 101 IGLVPLKV-DPDMLTWVDSNLPDDEKFTDENTIVLSLNVKCTRNPDAPKGSTDPKELYNN 159

Query: 111 TNVYAKDLQIVSDLGGKNIGH---PIIQDKEANGVLICKLRKGQELRLKCVAKKGIAKEH 167
            +VYA+DL+     G ++      P++       +L+ KLR GQE+ LK     GI  +H
Sbjct: 160 AHVYARDLKF-EPQGRQSTTFADCPVVPADP--DILLAKLRPGQEISLKAHCILGIGGDH 216

Query: 168 AKWSPAAAIEFEYDPWNKLRH------------------------TDYWHEQDPEAEWPH 203
           AK+SP +   +   P   +                          +D  + +D   +   
Sbjct: 217 AKFSPVSTASYRLLPQINILQPIKGESARRFQKCFPPGVIGIDEGSDEAYVKDARKDTVS 276

Query: 204 SKNCEFEDPPNEDDQFDYSAKPNTFYMNVESVGSIPSDQVVIRGIKTLQDK 254
            +   +E+     D+       N F  NVES G++  +++  + ++ L++K
Sbjct: 277 REVLRYEE---FADKVKLGRVRNHFIFNVESAGAMTPEEIFFKSVRILKNK 324

>TPHA0D03920 Chr4 complement(821790..822797) [1008 bp, 335 aa] {ON}
           Anc_3.428 YPR110C
          Length = 335

 Score = 93.6 bits (231), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 68/197 (34%), Positives = 104/197 (52%), Gaps = 21/197 (10%)

Query: 4   EGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIESNTSVLADEFI 63
           E   + I   T+   +F L ++D S+AN+ RRIMIAE+P++A + V   +NTSV+ DE +
Sbjct: 38  ESFDIHISSLTEKEANFDLVHIDTSIANAFRRIMIAEVPSVAAEYVYFMNNTSVIQDEVL 97

Query: 64  SHRLGLVPLQSKDIDQLVYCRDCFC--EDHCDRCSVLLTLHAV------GESEST----- 110
           +HR+GL+PL+  D D+L +        E   D  ++++TL A          ++T     
Sbjct: 98  AHRIGLIPLRV-DPDKLSWIDSELPDEEKFTDENTIVITLDAKCTRNPDAPKDATDPKVL 156

Query: 111 ---TNVYAKDLQIVSDLGGKNIGHPIIQDKEA--NGVLICKLRKGQELRLKCVAKKGIAK 165
               +VYA+DL+   +  GK       Q  EA    +LI KLR GQE+ L+     GI  
Sbjct: 157 YRNAHVYARDLKF--EPQGKQAELFADQPVEAIDPDILIAKLRPGQEISLRAHCILGIGG 214

Query: 166 EHAKWSPAAAIEFEYDP 182
           +HAK+SP A   +   P
Sbjct: 215 DHAKFSPVATASYRLLP 231

>ADR031C Chr4 complement(761933..763027) [1095 bp, 364 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR110C
           (RPC40)
          Length = 364

 Score = 94.0 bits (232), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 64/196 (32%), Positives = 102/196 (52%), Gaps = 25/196 (12%)

Query: 8   VKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIESNTSVLADEFISHRL 67
           V+I+   +   +F L  VD S+AN+ RRIMI+E+P++A + V   +NTSV+ DE ++HR+
Sbjct: 72  VQIKSLDEREANFDLLRVDTSIANAFRRIMISEVPSVAPEYVYFFNNTSVIQDEVLAHRI 131

Query: 68  GLVPLQSKDIDQLVYCRDCF--CEDHCDRCSVLLTLHA--------------VGESESTT 111
           GLVPL+  D D L +        E   D  +V+L+L+                 E     
Sbjct: 132 GLVPLKV-DPDMLTWVDKSLPEAERFTDENTVVLSLNVKCTHNPDAPKGSTDPKELYRNA 190

Query: 112 NVYAKDLQIVSDLGGKNIGH----PIIQDKEANGVLICKLRKGQELRLKCVAKKGIAKEH 167
           ++YA+DL+   +  GK +      P++       +L+ KLR GQE+ L+     GI  +H
Sbjct: 191 HIYARDLKF--EPQGKQLETFAKCPVVPADP--DILLAKLRPGQEISLRVHCILGIGSDH 246

Query: 168 AKWSPAAAIEFEYDPW 183
           AK+SP A   +   P+
Sbjct: 247 AKFSPVATASYRLMPY 262

>Skud_16.397 Chr16 complement(710663..711670) [1008 bp, 335 aa] {ON}
           YPR110C (REAL)
          Length = 335

 Score = 93.2 bits (230), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 78/286 (27%), Positives = 133/286 (46%), Gaps = 40/286 (13%)

Query: 7   QVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIESNTSVLADEFISHR 66
           +V I    +   +F L N+D S+AN+ RRIMI+E+P +A + V   +NTSV+ DE ++HR
Sbjct: 41  KVNISSLDEREANFDLINIDASIANAFRRIMISEVPCVAAEYVYFFNNTSVIQDEVLAHR 100

Query: 67  LGLVPLQSKDIDQLVYCRDCFCEDH--CDRCSVLLTLHAV--------------GESEST 110
           +GLVPL+  D D L +      +D    D  +++L+L+                 E  + 
Sbjct: 101 IGLVPLKV-DPDMLTWVDSSLPDDEKFTDENTIVLSLNVKCTRNPDAPKDCTDPKELYNN 159

Query: 111 TNVYAKDLQIVSDLGGKNIGHPIIQDKEAN-GVLICKLRKGQELRLKCVAKKGIAKEHAK 169
            +VYA+DL+     G ++          A+  +L+ KLR GQE+ LK     GI  +HAK
Sbjct: 160 AHVYARDLKF-EPQGRQSTTFAACSVVPADPDILLAKLRPGQEISLKAHCILGIGGDHAK 218

Query: 170 WSPAAAIEFEYDPW-NKLRHTDYWHEQDPEAEWP--------HSKNCEFEDPPNED---- 216
           +SP +   +   P  N L+       +  +  +P         S+    +D   +     
Sbjct: 219 FSPVSTASYRLLPQINILQSIKGESAKRFQKCFPPGVIGIDDTSREAYVKDARKDTVSRE 278

Query: 217 --------DQFDYSAKPNTFYMNVESVGSIPSDQVVIRGIKTLQDK 254
                   D+       N F  NVES G++  +++  + ++ L++K
Sbjct: 279 VLRYEEFADKVKLGRVRNHFIFNVESAGAMTPEEIFFKSVRILKNK 324

>Suva_16.438 Chr16 complement(753618..754625) [1008 bp, 335 aa] {ON}
           YPR110C (REAL)
          Length = 335

 Score = 92.8 bits (229), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 77/291 (26%), Positives = 134/291 (46%), Gaps = 50/291 (17%)

Query: 7   QVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIESNTSVLADEFISHR 66
           +V I      + +F L N+D S+AN+ RRIMI+E+P +A + V   +NTSV+ DE ++HR
Sbjct: 41  EVNISSLDARDANFDLINIDTSIANAFRRIMISEVPAVAAEYVYFFNNTSVIQDEVLAHR 100

Query: 67  LGLVPLQSKDIDQLVYCRDCFCEDH--CDRCSVLLTLHAV------GESEST-------- 110
           +GLVPL+  D D L +      +D    D  +V+L+L+           +ST        
Sbjct: 101 IGLVPLKV-DPDMLTWVDSSLPDDEKFTDENTVVLSLNVKCTRNLDAPKDSTDPKQLYNN 159

Query: 111 TNVYAKDLQIVSDLGGKNIGH---PIIQDKEANGVLICKLRKGQELRLKCVAKKGIAKEH 167
            +VYA+DL+     G ++      P++       +L+ KLR GQE+ LK     G+  +H
Sbjct: 160 AHVYARDLKF-EPQGRQSTTFANCPVLPADP--DILLAKLRPGQEISLKAHCILGVGGDH 216

Query: 168 AKWSPAAAIEFEYDPWNKL------------------------RHTDYWHEQDPEAEWPH 203
           AK+SP +   +   P   +                          +D  + +D   +   
Sbjct: 217 AKFSPVSTASYRLLPQIDILQPIKGESAKRFEKCFPPGVIGIDESSDEAYVKDARKDTVS 276

Query: 204 SKNCEFEDPPNEDDQFDYSAKPNTFYMNVESVGSIPSDQVVIRGIKTLQDK 254
            +   +E+     D+       N F  NVES G++  +++  + ++ L++K
Sbjct: 277 REVLRYEE---FTDKVKLGRVRNHFVFNVESAGAMTPEEIFFKSVRILKNK 324

>KLTH0F12056g Chr6 (1016695..1017747) [1053 bp, 350 aa] {ON} highly
           similar to uniprot|P07703 Saccharomyces cerevisiae
           YPR110C RPC40 RNA polymerase subunit common to RNA
           polymerase I and III
          Length = 350

 Score = 91.7 bits (226), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 80/282 (28%), Positives = 127/282 (45%), Gaps = 57/282 (20%)

Query: 19  DFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIESNTSVLADEFISHRLGLVPLQSKDID 78
           +F L NVD S+AN+ RRIMIAE+P++A + V   +NTSV+ DE ++HR+GL PL+  D D
Sbjct: 69  NFDLVNVDASIANAFRRIMIAEVPSVAAEYVYFFNNTSVIQDEVLAHRIGLTPLKV-DPD 127

Query: 79  QLVYCRDCF--CEDHCDRCSVLLTLHAVGESE--------------STTNVYAKDLQI-- 120
            L +        E   D  +++LTL+                       ++YA+DL+   
Sbjct: 128 MLSWVDTSVPEAERFTDENTIVLTLNVRCTRNPDAPKDCTDPKILYRNAHIYARDLKFEP 187

Query: 121 ---VSDLGGKNIGHPIIQDKEANGVLICKLRKGQELRLKCVAKKGIAKEHAKWSPAAAIE 177
                +   KN   P   D     +L+ KLR GQE+ L+     GI  +HAK+SP +   
Sbjct: 188 QGKQRETFAKNPVVPADPD-----ILLAKLRPGQEISLRAHCVLGIGSDHAKFSPVSTAS 242

Query: 178 FEYDPWNKLRHTDYWHEQDPEAEWPHSK-----------NCE-FEDPPNED--------- 216
           +   P     H +       E+    +K           N E F      D         
Sbjct: 243 YRLMP-----HINITQPITGESAQRFAKCFSPGVIGINDNGEAFVKDARHDTVSREVLRH 297

Query: 217 DQFDYSAK----PNTFYMNVESVGSIPSDQVVIRGIKTLQDK 254
           ++F+   K     N F  NVES G++  +++  + ++ L++K
Sbjct: 298 EEFEGKVKLGRVKNHFIFNVESAGAMTPEEIFFKSVRILKNK 339

>KLLA0D14861g Chr4 complement(1253023..1254027) [1005 bp, 334 aa]
           {ON} highly similar to uniprot|P07703 Saccharomyces
           cerevisiae YPR110C RPC40 RNA polymerase subunit common
           to RNA polymerase I and III
          Length = 334

 Score = 91.3 bits (225), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 79/287 (27%), Positives = 139/287 (48%), Gaps = 45/287 (15%)

Query: 8   VKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIESNTSVLADEFISHRL 67
           V+I    +  V+F L +VD S+AN+ RRIMI+E+P++A + V   +NTSVL DE ++HR+
Sbjct: 42  VQIESLDEREVNFDLVHVDTSIANAFRRIMISEVPSVAPEYVYFFNNTSVLQDEVLAHRI 101

Query: 68  GLVPLQSKDIDQLVYCRDCF--CEDHCDRCSVLLTLH--------AVGESE------STT 111
           GLVPL+  D D L +        E   D  +++++L+        A  + E         
Sbjct: 102 GLVPLKV-DPDMLSWVDTSLPESERFTDENTIVMSLNVKCTRNPDAPKDCEDPKVLYRNA 160

Query: 112 NVYAKDLQIVSDLGGKNIGH----PIIQDKEANGVLICKLRKGQELRLKCVAKKGIAKEH 167
           ++YA+DL+   +  GK +      P++       +L+ KLR GQE+ L+     GI  +H
Sbjct: 161 HIYARDLKF--EPQGKQVEQFAKCPVVAADP--DILLAKLRPGQEISLRAHCILGIGADH 216

Query: 168 AKWSPAAAIEFEYDPWNKLRHTDYWHEQDPEAE-WP------HSKNCEFEDPPNED---- 216
           AK+SP +   +   P  ++       +     + +P      + K   +   P +D    
Sbjct: 217 AKFSPVSTASYRLLPHIQITQPITGDDAKKFVKCFPKGVADVNEKGEAYIKDPRKDTVSR 276

Query: 217 -----DQFDYSAK----PNTFYMNVESVGSIPSDQVVIRGIKTLQDK 254
                D+F    K     + F  NVES G++  +++  + ++ L++K
Sbjct: 277 EVLRHDEFQGKVKLGRVRDHFIFNVESSGAMTPEEIFFKSVRILKNK 323

>NCAS0A11520 Chr1 complement(2279808..2280815) [1008 bp, 335 aa]
           {ON} Anc_3.428 YPR110C
          Length = 335

 Score = 91.3 bits (225), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 65/199 (32%), Positives = 103/199 (51%), Gaps = 31/199 (15%)

Query: 7   QVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIESNTSVLADEFISHR 66
           +V+I    +   +F L N+D S+AN+ RRIMI+E+P +A + V   +NTSV+ DE ++HR
Sbjct: 41  KVEISSLNEREANFDLINIDTSIANAFRRIMISEVPAVAAEYVYFLNNTSVIQDEVLAHR 100

Query: 67  LGLVPLQSKDIDQLVYCRDCFC--EDHCDRCSVLLTLHAVGESE--------------ST 110
           +GL+PL+  D D L +  +     E   D  +++LTL+                      
Sbjct: 101 IGLIPLKV-DPDLLTWVDNELPDEEKFNDTNTIVLTLNVKCTRNPDAPKDATDPKILYRN 159

Query: 111 TNVYAKDLQIVSDLGGKNI----GHPII---QDKEANGVLICKLRKGQELRLKCVAKKGI 163
           ++VYA DL+   +  GK I    G P++   QD     +L+ KLR GQE+ L+     G 
Sbjct: 160 SSVYASDLKF--EPQGKQIETFAGTPVVPCDQD-----ILLAKLRPGQEISLRAHCILGT 212

Query: 164 AKEHAKWSPAAAIEFEYDP 182
             +HAK+SP +   +   P
Sbjct: 213 GGDHAKFSPVSTASYRLLP 231

>SAKL0F06028g Chr6 complement(453180..454184) [1005 bp, 334 aa] {ON}
           highly similar to uniprot|P07703 Saccharomyces
           cerevisiae YPR110C RPC40 RNA polymerase subunit common
           to RNA polymerase I and III
          Length = 334

 Score = 91.3 bits (225), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 62/195 (31%), Positives = 101/195 (51%), Gaps = 25/195 (12%)

Query: 8   VKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIESNTSVLADEFISHRL 67
           VKI    +   +F L ++D S+AN+ RRIMI+E+P++A + V   +NTSV+ DE ++HR+
Sbjct: 42  VKISSLDEREANFDLIHIDTSIANAFRRIMISEVPSVAPEYVYFFNNTSVIQDEVLAHRI 101

Query: 68  GLVPLQSKDIDQLVYCRDCFCEDH--CDRCSVLLTLHAVGESE--------------STT 111
           GLVPL+  D D L +  +   E+    D  +++LTL+                      +
Sbjct: 102 GLVPLKV-DPDMLSWIDNSLTEEEKFTDENTIVLTLNVKCTRNPDAPKDCTDPKVLYRNS 160

Query: 112 NVYAKDLQIVSDLGGKNI----GHPIIQDKEANGVLICKLRKGQELRLKCVAKKGIAKEH 167
           N+YA+ L+   +  GK +      P++       +L+ KLR GQE+ L+     GI  +H
Sbjct: 161 NIYARHLKF--EPQGKQLETFAKSPVVPADP--DILLAKLRPGQEISLRAHCILGIGSDH 216

Query: 168 AKWSPAAAIEFEYDP 182
           AK+SP     +   P
Sbjct: 217 AKFSPVCTASYRLMP 231

>Kwal_23.3998 s23 (519065..520069) [1005 bp, 334 aa] {ON} YPR110C
           (RPC40) - RNA polymerase III (C) subunit [contig 255]
           FULL
          Length = 334

 Score = 90.5 bits (223), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 63/195 (32%), Positives = 99/195 (50%), Gaps = 25/195 (12%)

Query: 8   VKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIESNTSVLADEFISHRL 67
           V+I    +   +F L NVD S+AN+ RRIMI+E+P++A + V   +NTSV+ DE ++HR+
Sbjct: 42  VRISSLDEREANFDLVNVDASIANAFRRIMISEVPSVAPEYVYFFNNTSVIQDEVLAHRI 101

Query: 68  GLVPLQSKDIDQLVYCRDCF--CEDHCDRCSVLLTLHAVGESE--------------STT 111
           GL PL+  D D L +        E   D  +++LTL+                       
Sbjct: 102 GLTPLKV-DPDMLSWVDSSVPEAERFTDENTIVLTLNVKCTRNPDAPKDCTDPKILYRNA 160

Query: 112 NVYAKDLQIVSDLGGKNI----GHPIIQDKEANGVLICKLRKGQELRLKCVAKKGIAKEH 167
           ++YA+DL+   +  GK +     +P++       VL+ KLR GQE+ L+     GI  +H
Sbjct: 161 HIYARDLKF--EPQGKQLETFAKNPVVPADP--DVLLAKLRPGQEISLRAHCILGIGSDH 216

Query: 168 AKWSPAAAIEFEYDP 182
           AK+SP     +   P
Sbjct: 217 AKFSPVCTASYRLMP 231

>Ecym_4450 Chr4 (921163..922167) [1005 bp, 334 aa] {ON} similar to
           Ashbya gossypii ADR031C
          Length = 334

 Score = 90.5 bits (223), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 60/195 (30%), Positives = 101/195 (51%), Gaps = 25/195 (12%)

Query: 8   VKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIESNTSVLADEFISHRL 67
           V+I        +F L ++D S+AN+ RRIMI+E+P++A + V   +NTSV+ DE ++HR+
Sbjct: 42  VQISHLDDREANFDLIHIDASIANAFRRIMISEVPSVAAEYVYFFNNTSVIQDEVLAHRI 101

Query: 68  GLVPLQSKDIDQLVYCRDCF--CEDHCDRCSVLLTLHA--------------VGESESTT 111
           GLVPL+  D D L +        E   D  +V+++L+                 E  +  
Sbjct: 102 GLVPLKV-DPDMLTWVDKSLPEAERFTDENTVVMSLNVKCTANPDAPKGSTDPKELYNNA 160

Query: 112 NVYAKDLQIVSDLGGKNI----GHPIIQDKEANGVLICKLRKGQELRLKCVAKKGIAKEH 167
           ++Y++DL+   +  GK +     HP++       +L+ KLR GQE+ L+     G+  +H
Sbjct: 161 HIYSRDLKF--EPQGKQLDSFAKHPVLPTDP--DILLAKLRPGQEISLRVHCILGVGGDH 216

Query: 168 AKWSPAAAIEFEYDP 182
           AK+SP     +   P
Sbjct: 217 AKFSPVCTASYRLMP 231

>NDAI0A04770 Chr1 (1091856..1092863) [1008 bp, 335 aa] {ON}
           Anc_3.428 YPR110C
          Length = 335

 Score = 87.8 bits (216), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 74/290 (25%), Positives = 137/290 (47%), Gaps = 46/290 (15%)

Query: 8   VKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIESNTSVLADEFISHRL 67
           V+I   ++   +F L N+D S+AN+ RRIMI+E+P++A + V   +NTSV+ DE ++HR+
Sbjct: 42  VQITSLSEREANFDLINIDTSMANAFRRIMISEVPSVAAEYVYFLTNTSVIQDEVLAHRI 101

Query: 68  GLVPLQSKDIDQLVYCRDCFCEDH--CDRCSVLLTLHAVGESE--------------STT 111
           G++PL+  D D L +      E+    D  +V+++L+                      +
Sbjct: 102 GMIPLKV-DPDMLSWIDTSLSEEEKFTDDNTVVMSLNIKCTRNLNAPKDCTDPKILYHNS 160

Query: 112 NVYAKDLQIVSDLGGKNIGH----PIIQDKEANGVLICKLRKGQELRLKCVAKKGIAKEH 167
           +VYAKDL+   +  GK +      P++       +L+ KLR  QE+ L+     G+  +H
Sbjct: 161 SVYAKDLKF--EPQGKQVETFAKCPVVPSDP--DILLAKLRPDQEISLRVHCILGVGGDH 216

Query: 168 AKWSPAAAIEFEYDP-WNKLRHTD----------------YWHEQDPEAEWPHSKNCEFE 210
           AK+SP +   +   P  N L+                     +E+  EA    ++     
Sbjct: 217 AKFSPVSTASYRLLPHINILKPITGEQAIKFQKCFLPGVIGINEETGEAYVKDARKDTVS 276

Query: 211 DPPNEDDQFDYSAK----PNTFYMNVESVGSIPSDQVVIRGIKTLQDKVA 256
                 ++F+   K     + F  NVES G++  +++  + ++ L++K +
Sbjct: 277 REVLRHEEFNDKVKLGRIRDHFIFNVESTGAMTPEEIFFKSVRILKNKAS 326

>CAGL0B04125g Chr2 complement(401513..402517) [1005 bp, 334 aa] {ON}
           highly similar to uniprot|P07703 Saccharomyces
           cerevisiae YPR110c RPC40 DNA-directed RNA polymerase I
           III
          Length = 334

 Score = 85.1 bits (209), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 83/287 (28%), Positives = 138/287 (48%), Gaps = 45/287 (15%)

Query: 7   QVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIESNTSVLADEFISHR 66
           QV   E  + N D I   +D SLAN+ RRIMIAE+P +A + V I++NTSV+ DE ++HR
Sbjct: 43  QVSSHEERELNFDMI--GIDTSLANAFRRIMIAEVPAVAPEYVYIQNNTSVIQDEVLAHR 100

Query: 67  LGLVPLQ--SKDIDQLVYCRDCFCEDHCDRCSVLLTLHAVGESE--------------ST 110
           +GLVPL+   + +++L        E H D+ ++++TL+                    + 
Sbjct: 101 IGLVPLKVDPEKLERLDTSDPDNLEFH-DKNTIVMTLNVKCTRNPDAPKDCTDPTILYNN 159

Query: 111 TNVYAKDLQIV--SDLGGKNIGHPIIQ-DKEANGVLICKLRKGQELRLKCVAKKGIAKEH 167
            +VYA+DL+    S         P++  D +   +L+ KLR GQE+ L      G  K+H
Sbjct: 160 AHVYARDLKFEPHSSQVETFADCPVVPCDPD---ILLAKLRPGQEISLSTHCILGEGKDH 216

Query: 168 AKWSPAAAIEFEYDPWNKLRH------TDYWHEQDPEAEWPHSKNCE-FEDPPNED---- 216
           AK+SP A   +   P  ++           +    P+     ++N E +   P +D    
Sbjct: 217 AKFSPVATASYRLLPHIEILEPITGDSAKRFQACFPKGVIGINENGEAYVLDPRKDTVSR 276

Query: 217 -----DQFDYSAK----PNTFYMNVESVGSIPSDQVVIRGIKTLQDK 254
                ++F+   K     + F  NVES G++  + +V++ I  L+ K
Sbjct: 277 EVLRHEEFEGKVKLGRVRDHFVFNVESTGAMQPEDIVLKSIDILKKK 323

>KAFR0A01990 Chr1 (418279..419961) [1683 bp, 560 aa] {ON} Anc_2.542
           YHL010C
          Length = 560

 Score = 30.0 bits (66), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 37/80 (46%), Gaps = 11/80 (13%)

Query: 75  KDIDQLVYCRDCFCEDH------CDR--CSVLLTLHAVGESESTTNVYAKDL--QIVSDL 124
           K +    +C DC   D+      C    CS     HA+   E+T++ +A D+  Q V D 
Sbjct: 294 KQVGNSAHCEDCNSNDNLWICLICGNIGCSRYNLKHAISHYETTSHCFAMDMKTQRVWDY 353

Query: 125 GGKNIGHPIIQDKEANGVLI 144
              N  H ++Q+ E +G L+
Sbjct: 354 ASDNYVHRLVQN-EVDGKLV 372

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 32,990,787
Number of extensions: 1445274
Number of successful extensions: 3878
Number of sequences better than 10.0: 50
Number of HSP's gapped: 3977
Number of HSP's successfully gapped: 50
Length of query: 311
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 202
Effective length of database: 40,982,805
Effective search space: 8278526610
Effective search space used: 8278526610
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)