Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ADL119W7.195ON1851858071e-111
Ecym_43817.195ON1201141852e-17
ZYRO0D15818g7.195ON1181031582e-13
TDEL0H025207.195ON1191121546e-13
SAKL0F07480g7.195ON113991538e-13
CAGL0D05148g7.195ON1081071511e-12
Kwal_55.20373singletonOFF1151051512e-12
Kwal_YGOB_ADL119W7.195ON1151051512e-12
KLTH0E04576g7.195ON1151221381e-10
Kpol_1063.107.195ON1221021372e-10
TPHA0C045207.195ON1351141372e-10
NCAS0E018207.195ON114921056e-06
KAFR0G029907.195ON110811049e-06
KLLA0D16192g7.195ON121961031e-05
NDAI0G019907.195ON10177870.001
TBLA0J015107.195ON107111810.012
NDAI0B056705.434ON31858740.33
Scer_YGOB_ADL119W (ADL119W)7.195ON9624690.40
Skud_6.1257.195ON22553653.3
NOTE: 2 genes in the same pillar as ADL119W were not hit in these BLAST results
LIST: Suva_6.114 KNAG0L01230

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADL119W
         (185 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADL119W Chr4 (478065..478622) [558 bp, 185 aa] {ON} NOHBY409; No...   315   e-111
Ecym_4381 Chr4 complement(802807..803169) [363 bp, 120 aa] {ON} ...    76   2e-17
ZYRO0D15818g Chr4 (1321075..1321431) [357 bp, 118 aa] {ON} conse...    65   2e-13
TDEL0H02520 Chr8 complement(424797..425156) [360 bp, 119 aa] {ON...    64   6e-13
SAKL0F07480g Chr6 (571315..571656) [342 bp, 113 aa] {ON} conserv...    64   8e-13
CAGL0D05148g Chr4 complement(492687..493013) [327 bp, 108 aa] {O...    63   1e-12
Kwal_55.20373 s55 complement(377983..378330) [348 bp, 115 aa] {O...    63   2e-12
Kwal_YGOB_ADL119W s55 complement(377983..378330) [348 bp, 115 aa...    63   2e-12
KLTH0E04576g Chr5 complement(414398..414745) [348 bp, 115 aa] {O...    58   1e-10
Kpol_1063.10 s1063 complement(28076..28444) [369 bp, 122 aa] {ON...    57   2e-10
TPHA0C04520 Chr3 (975080..975487) [408 bp, 135 aa] {ON} Anc_7.19...    57   2e-10
NCAS0E01820 Chr5 complement(355133..355477) [345 bp, 114 aa] {ON...    45   6e-06
KAFR0G02990 Chr7 (619397..619729) [333 bp, 110 aa] {ON} Anc_7.19...    45   9e-06
KLLA0D16192g Chr4 (1364216..1364581) [366 bp, 121 aa] {ON} conse...    44   1e-05
NDAI0G01990 Chr7 complement(449171..449476) [306 bp, 101 aa] {ON...    38   0.001
TBLA0J01510 Chr10 complement(344073..344396) [324 bp, 107 aa] {O...    36   0.012
NDAI0B05670 Chr2 (1383187..1384143) [957 bp, 318 aa] {ON} Anc_5....    33   0.33 
Scer_YGOB_ADL119W Chr6 (226260..226550) [291 bp, 96 aa] {ON} ANN...    31   0.40 
Skud_6.125 Chr6 (221029..221706) [678 bp, 225 aa] {ON}  (REAL)         30   3.3  

>ADL119W Chr4 (478065..478622) [558 bp, 185 aa] {ON} NOHBY409; No
           homolog in Saccharomyces cerevisiae
          Length = 185

 Score =  315 bits (807), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 161/185 (87%), Positives = 161/185 (87%)

Query: 1   MTTARSGRSWQRHSACRRLCSTRPAAAAGGCVVRGSLRCGLAQWPSWHAHRGCVFVKAKA 60
           MTTARSGRSWQRHSACRRLCSTRPAAAAGGCVVRGSLRCGLAQWPSWHAHRGCVFVKAKA
Sbjct: 1   MTTARSGRSWQRHSACRRLCSTRPAAAAGGCVVRGSLRCGLAQWPSWHAHRGCVFVKAKA 60

Query: 61  SAGMLPLSHEQAIAMERKAITIPDVRFEQTFRAALAKESARQRQLRAQKXXXXXXXXXXX 120
           SAGMLPLSHEQAIAMERKAITIPDVRFEQTFRAALAKESARQRQLRAQK           
Sbjct: 61  SAGMLPLSHEQAIAMERKAITIPDVRFEQTFRAALAKESARQRQLRAQKEGEAAADGEAG 120

Query: 121 ISAXXXXXXXXXXXXXMPLVQGALWTGLLITMKPCLPLCMLGGRRADQAFYRALVGDVRP 180
           ISA             MPLVQGALWTGLLITMKPCLPLCMLGGRRADQAFYRALVGDVRP
Sbjct: 121 ISALVVAKVVVRDVLLMPLVQGALWTGLLITMKPCLPLCMLGGRRADQAFYRALVGDVRP 180

Query: 181 RMRAA 185
           RMRAA
Sbjct: 181 RMRAA 185

>Ecym_4381 Chr4 complement(802807..803169) [363 bp, 120 aa] {ON}
           similar to Ashbya gossypii ADL119W
          Length = 120

 Score = 75.9 bits (185), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 42/114 (36%), Positives = 54/114 (47%), Gaps = 7/114 (6%)

Query: 75  MERKAITIPDVRFEQTFRAALAKESARQRQLR------AQKXXXXXXXXXXXISAXXXXX 128
           M+ K + IPD+RFEQTF  AL KE+ +Q Q +      +Q            I+      
Sbjct: 1   MDAKPLAIPDIRFEQTFMVALKKEALKQHQYKIRKLKGSQDIVVSEDFGEPTITTFVVAK 60

Query: 129 XXXXXXXXMPLVQGALWTGLLITMKPCLPLCMLGGRRADQAFYRALVG-DVRPR 181
                   +PLV G LWTG LI MKP L  C   GRR     Y  +VG +V P+
Sbjct: 61  VIVRDVVLLPLVHGMLWTGFLIMMKPWLKACTQNGRRLGAGIYNVIVGRNVYPK 114

>ZYRO0D15818g Chr4 (1321075..1321431) [357 bp, 118 aa] {ON}
           conserved hypothetical protein
          Length = 118

 Score = 65.5 bits (158), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 38/103 (36%), Positives = 50/103 (48%), Gaps = 8/103 (7%)

Query: 82  IPDVRFEQTFRAALAKESARQRQLRAQKX--------XXXXXXXXXXISAXXXXXXXXXX 133
           IPD RFE TF+ AL +E+ +QR L+ +K                   I++          
Sbjct: 7   IPDTRFESTFKRALNREAEKQRTLQWKKMGVEDPLVINQLQKNQPVKINSYVVCKVVARD 66

Query: 134 XXXMPLVQGALWTGLLITMKPCLPLCMLGGRRADQAFYRALVG 176
              MPLVQG LWT LLITMKP L   +  GR+     YR ++G
Sbjct: 67  VIFMPLVQGLLWTSLLITMKPWLRSVIQNGRKFGTFIYRTVLG 109

>TDEL0H02520 Chr8 complement(424797..425156) [360 bp, 119 aa] {ON}
           Anc_7.195 Scer_YGOB_ADL119W
          Length = 119

 Score = 63.9 bits (154), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 41/112 (36%), Positives = 54/112 (48%), Gaps = 10/112 (8%)

Query: 82  IPDVRFEQTFRAALAKESARQRQLRAQKXXXXXXXXXX--------XISAXXXXXXXXXX 133
           +PD RFEQTFR AL +E+ + R  + +K                   IS           
Sbjct: 7   VPDTRFEQTFRRALTREAEKHRAAQWRKMGVVDPVVINELQKAQPPSISKLVVCKVVLRD 66

Query: 134 XXXMPLVQGALWTGLLITMKPCLPLCMLGGRRADQAFYRALVGD--VRPRMR 183
              MPLVQG LWTG+LI MKP L   +  GRR   + YR ++G   V+P+ R
Sbjct: 67  VIFMPLVQGLLWTGVLIAMKPWLKNAVAHGRRLGSSIYRLVLGTDLVKPKRR 118

>SAKL0F07480g Chr6 (571315..571656) [342 bp, 113 aa] {ON} conserved
           hypothetical protein
          Length = 113

 Score = 63.5 bits (153), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 49/99 (49%), Gaps = 3/99 (3%)

Query: 78  KAITIPDVRFEQTFRAALAKESARQRQLRAQKXXXXXXXXXXXISAXXXXXXXXXXXXXM 137
           + I +PD RFEQTF+ AL KE+ R   ++A +           ++              M
Sbjct: 10  QTIVVPDTRFEQTFKNALKKEAKR---MKAARLGITTLDDNAPVTPMVVAKVVVRDVLLM 66

Query: 138 PLVQGALWTGLLITMKPCLPLCMLGGRRADQAFYRALVG 176
           PLVQG LWT  LI +KP L   +  GRR   + YR ++G
Sbjct: 67  PLVQGVLWTSFLIAIKPWLRNAVWQGRRFGMSVYRLVLG 105

>CAGL0D05148g Chr4 complement(492687..493013) [327 bp, 108 aa] {ON}
           some similarities with KLLA0D16192g Kluyveromyces lactis
           and DEHA0C08349g Debaryomyces hansenii
          Length = 108

 Score = 62.8 bits (151), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 49/107 (45%), Gaps = 4/107 (3%)

Query: 79  AITIPDVRFEQTFRAALAKESARQRQLRAQKXXXXXXXXXXXISAXXXXXXXXXXXXXMP 138
            I IPD RFEQTFR A+ +E A+Q  L  +             SA             MP
Sbjct: 4   VIKIPDTRFEQTFRRAIDREVAKQNALSGKSTDDKKSGP----SAYVICKVVVRDVLLMP 59

Query: 139 LVQGALWTGLLITMKPCLPLCMLGGRRADQAFYRALVGDVRPRMRAA 185
            +Q  LWTG L+ +KP L + +  GRR  +   RAL G   P  + A
Sbjct: 60  FIQSVLWTGFLLGLKPWLRMVVGFGRRTGEYLNRALYGGRLPGGKTA 106

>Kwal_55.20373 s55 complement(377983..378330) [348 bp, 115 aa] {OFF}
           [contig 149] FULL
          Length = 115

 Score = 62.8 bits (151), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 57/105 (54%), Gaps = 3/105 (2%)

Query: 78  KAITIPDVRFEQTFRAALAKESARQRQLRAQKXXXXXXXXXXXISAXXXXXXXXXXXXXM 137
           + ++IPD+RFEQTF+ AL +E+ + +Q +A+            +SA             +
Sbjct: 11  QKVSIPDLRFEQTFKNALKREALKNKQYKAKNGTDTDSESP--LSASIICKVVLRDVLLL 68

Query: 138 PLVQGALWTGLLITMKPCLPLCMLGGRRADQAFYRALVG-DVRPR 181
           P +QGALWTG+LI M+P L    + G +  +  Y  ++G D+ P+
Sbjct: 69  PFLQGALWTGVLIAMRPWLWHVKMQGLQLGRRIYNLVLGKDLVPK 113

>Kwal_YGOB_ADL119W s55 complement(377983..378330) [348 bp, 115 aa]
           {ON} ANNOTATED BY YGOB -
          Length = 115

 Score = 62.8 bits (151), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 57/105 (54%), Gaps = 3/105 (2%)

Query: 78  KAITIPDVRFEQTFRAALAKESARQRQLRAQKXXXXXXXXXXXISAXXXXXXXXXXXXXM 137
           + ++IPD+RFEQTF+ AL +E+ + +Q +A+            +SA             +
Sbjct: 11  QKVSIPDLRFEQTFKNALKREALKNKQYKAKNGTDTDSESP--LSASIICKVVLRDVLLL 68

Query: 138 PLVQGALWTGLLITMKPCLPLCMLGGRRADQAFYRALVG-DVRPR 181
           P +QGALWTG+LI M+P L    + G +  +  Y  ++G D+ P+
Sbjct: 69  PFLQGALWTGVLIAMRPWLWHVKMQGLQLGRRIYNLVLGKDLVPK 113

>KLTH0E04576g Chr5 complement(414398..414745) [348 bp, 115 aa] {ON}
           conserved hypothetical protein
          Length = 115

 Score = 57.8 bits (138), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 58/122 (47%), Gaps = 9/122 (7%)

Query: 63  GMLPLSHEQAIAMERKAITIPDVRFEQTFRAALAKESARQRQLRAQKXXXXXXXXXXXIS 122
           G+ P++  Q +A       +PD+RFEQTF+ AL +E+++ ++  +Q            IS
Sbjct: 3   GLKPMTGAQKVA-------VPDLRFEQTFQRALRREASKNQKATSQ--GHSTTDADATIS 53

Query: 123 AXXXXXXXXXXXXXMPLVQGALWTGLLITMKPCLPLCMLGGRRADQAFYRALVGDVRPRM 182
           A             MP +QG LWT  LI +KP L +  + G+      Y  ++G    R 
Sbjct: 54  ASVICKVVLRDVLLMPFLQGILWTSALIALKPWLHMVRIRGQLVGHRIYEMVLGKGLVRK 113

Query: 183 RA 184
           RA
Sbjct: 114 RA 115

>Kpol_1063.10 s1063 complement(28076..28444) [369 bp, 122 aa] {ON}
           complement(28076..28444) [369 nt, 123 aa]
          Length = 122

 Score = 57.4 bits (137), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 47/102 (46%), Gaps = 7/102 (6%)

Query: 82  IPDVRFEQTFRAALAKESARQRQ-------LRAQKXXXXXXXXXXXISAXXXXXXXXXXX 134
           +PDVRFE+TF  A+ KE+ +QR+       L   +           ++            
Sbjct: 12  VPDVRFEETFNRAINKEAEKQREYSLKKKGLTTDEISKIKENEAPEVTTYIVWKVIVRDM 71

Query: 135 XXMPLVQGALWTGLLITMKPCLPLCMLGGRRADQAFYRALVG 176
             MP +QG +++GLLI +KP L   +  GRR     Y  ++G
Sbjct: 72  LIMPFIQGIMFSGLLIILKPWLRSVVGNGRRFGTFIYNTVLG 113

>TPHA0C04520 Chr3 (975080..975487) [408 bp, 135 aa] {ON} Anc_7.195
           Scer_YGOB_ADL119W
          Length = 135

 Score = 57.4 bits (137), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/114 (30%), Positives = 54/114 (47%), Gaps = 9/114 (7%)

Query: 77  RKAITIPDVRFEQTFRAALAKESARQRQ-------LRAQKXXXXXXXXXXXISAXXXXXX 129
           ++ + +PDVR EQ+F  AL KE+ +QR        L   K           ++       
Sbjct: 20  QETLKVPDVRLEQSFNNALQKEAEKQRVAKLKKEGLDDSKILQIQKNEPATVTKYIVWKV 79

Query: 130 XXXXXXXMPLVQGALWTGLLITMKPCLPLCMLGGRRADQAFYRALVGD--VRPR 181
                  MP +QGAL+TGLL+ +KP L   +  GRR     Y+ ++G   V+P+
Sbjct: 80  ILRDMILMPFIQGALFTGLLMAVKPWLRGVVGNGRRFGSYIYKLVLGKDLVKPK 133

>NCAS0E01820 Chr5 complement(355133..355477) [345 bp, 114 aa] {ON}
           Anc_7.195
          Length = 114

 Score = 45.1 bits (105), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 41/92 (44%), Gaps = 1/92 (1%)

Query: 75  MERKAITIPDVRFEQTFRAALAKESARQR-QLRAQKXXXXXXXXXXXISAXXXXXXXXXX 133
           M ++ + IPD+R EQTF+ A+AKE+     + +A               A          
Sbjct: 1   MGKEVLNIPDLRVEQTFKRAVAKETKEYIIKNKATFPRSTITELTRVEKAVICSKVILRD 60

Query: 134 XXXMPLVQGALWTGLLITMKPCLPLCMLGGRR 165
              MP +Q   WTG LI +KP L   +  GR+
Sbjct: 61  ILVMPFLQSVAWTGFLIVLKPWLRTTVTFGRK 92

>KAFR0G02990 Chr7 (619397..619729) [333 bp, 110 aa] {ON} Anc_7.195
           Scer_YGOB_ADL119W
          Length = 110

 Score = 44.7 bits (104), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 34/81 (41%), Gaps = 9/81 (11%)

Query: 77  RKAITIPDVRFEQTFRAALAKESARQ-RQLRAQKXXXXXXXXXXXISAXXXXXXXXXXXX 135
              + IPD RF   FR A+ KE  +Q ++  +             + A            
Sbjct: 9   NNNLAIPDTRFGYVFRKAVQKELRKQVKETDSDNKHINKNLIICKVIARDVIL------- 61

Query: 136 XMPLVQGALWTGLLITMKPCL 156
            MP +Q  LWTG LI+ KPCL
Sbjct: 62  -MPFIQSILWTGFLISFKPCL 81

>KLLA0D16192g Chr4 (1364216..1364581) [366 bp, 121 aa] {ON}
           conserved hypothetical protein
          Length = 121

 Score = 44.3 bits (103), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 40/96 (41%), Gaps = 2/96 (2%)

Query: 81  TIPDVRFEQTFRAALAKESARQRQLRAQKXXXXXXXXXXXISAXXXXXXXXXXXXXMPLV 140
           ++PD+RFEQTF+ +L KE+ +Q +L               I+               P +
Sbjct: 17  SLPDLRFEQTFKQSLRKEALKQNKLTLS--VADGSVVDPPITPYIVAKVVARDILISPFL 74

Query: 141 QGALWTGLLITMKPCLPLCMLGGRRADQAFYRALVG 176
           QG   +   I  KP L  C   GR   ++  R L G
Sbjct: 75  QGVFLSLFYIVAKPWLQYCRQAGRNIGRSIIRNLFG 110

>NDAI0G01990 Chr7 complement(449171..449476) [306 bp, 101 aa] {ON}
           Anc_7.195
          Length = 101

 Score = 38.1 bits (87), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 30/77 (38%), Gaps = 5/77 (6%)

Query: 78  KAITIPDVRFEQTFRAALAKESARQRQLRAQKXXXXXXXXXXXISAXXXXXXXXXXXXXM 137
           K I IPD RF+Q F+ AL +E  +      ++           I               +
Sbjct: 2   KTIVIPDTRFQQVFQNALERERNKLYPDTTKQNTGTLVTESLVI-----FKVILRDVILL 56

Query: 138 PLVQGALWTGLLITMKP 154
           P +Q  LWT  LI  KP
Sbjct: 57  PFIQSVLWTEFLIVCKP 73

>TBLA0J01510 Chr10 complement(344073..344396) [324 bp, 107 aa] {ON}
           Anc_7.195 Scer_YGOB_ADL119W
          Length = 107

 Score = 35.8 bits (81), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 38/111 (34%), Gaps = 7/111 (6%)

Query: 72  AIAMERKAITIPDVRFEQTFRAALAKESARQRQLRAQKXXXXXXXXXXXISAXX-XXXXX 130
           ++A  +  I IPD RFE TFR  L KE      L               +          
Sbjct: 2   SVAKPKLVIPIPDTRFESTFRRKLDKE------LNKNNVNSNSIIKDERVRKLLCLGKVI 55

Query: 131 XXXXXXMPLVQGALWTGLLITMKPCLPLCMLGGRRADQAFYRALVGDVRPR 181
                 MP VQG    G  I +KP L   +  G+   + F     G  R R
Sbjct: 56  CRDVIFMPFVQGMFMCGAFILIKPWLLKLLRNGKNIGRNFVELFGGQRRVR 106

>NDAI0B05670 Chr2 (1383187..1384143) [957 bp, 318 aa] {ON} Anc_5.434
          Length = 318

 Score = 33.1 bits (74), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 25/58 (43%), Gaps = 9/58 (15%)

Query: 46  SWHAHRGCVFVKAKASAGMLPLSHEQAIAMERKAITIPDVRFEQTFRAALAKESARQR 103
           SWH  RG   V  K+        HE+ I   RK +T+PD  F+      L KE    R
Sbjct: 257 SWHIQRGGYVVLPKSV-------HEERIIANRKVVTLPDEDFQAI--NNLVKEKGELR 305

>Scer_YGOB_ADL119W Chr6 (226260..226550) [291 bp, 96 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 96

 Score = 31.2 bits (69), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 17/24 (70%)

Query: 77  RKAITIPDVRFEQTFRAALAKESA 100
            K + IPD+RFE+ F+ AL +E A
Sbjct: 10  NKHLNIPDLRFEKVFKKALHRELA 33

>Skud_6.125 Chr6 (221029..221706) [678 bp, 225 aa] {ON}  (REAL)
          Length = 225

 Score = 29.6 bits (65), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 1/53 (1%)

Query: 48  HAHRGCVFVKAKASAGMLPLSHEQAIAMERKAITIPDVRFEQTFRAALAKESA 100
           H  +G     ++ + G L ++   A    R  + IPD+RFE+ F+ AL +E A
Sbjct: 111 HTRQGKARQDSRKNCGTLEMNVPLAPTPNRH-LNIPDLRFEKVFKKALHRELA 162

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.327    0.133    0.427 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 12,635,531
Number of extensions: 326130
Number of successful extensions: 661
Number of sequences better than 10.0: 19
Number of HSP's gapped: 657
Number of HSP's successfully gapped: 19
Length of query: 185
Length of database: 53,481,399
Length adjustment: 103
Effective length of query: 82
Effective length of database: 41,670,801
Effective search space: 3417005682
Effective search space used: 3417005682
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 62 (28.5 bits)