Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ADL118C7.196ON41841821440.0
Ecym_43807.196ON41841817960.0
SAKL0F07502g7.196ON41241916830.0
KLLA0D16214g7.196ON41840216600.0
Kwal_55.203687.196ON41240216000.0
TDEL0H025107.196ON41840115870.0
KLTH0E04554g7.196ON47940215930.0
Smik_9.1687.196ON43139415870.0
Kpol_1063.97.196ON41739515790.0
Suva_9.1777.196ON43541015790.0
Skud_9.1477.196ON43141015780.0
YIL022W (TIM44)7.196ON43143115580.0
CAGL0J02442g7.196ON41240215500.0
TPHA0C045307.196ON41639415470.0
KNAG0H026907.196ON41942114960.0
ZYRO0D15840g7.196ON40738414940.0
NCAS0A125207.196ON43239814800.0
NDAI0B017807.196ON43439914750.0
KAFR0A026407.196ON42139413910.0
TBLA0J015007.196ON42142512991e-178
KAFR0L00170singletonON31485694.8
CAGL0K11363g8.450ON41469687.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADL118C
         (418 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADL118C Chr4 complement(478675..479931) [1257 bp, 418 aa] {ON} S...   830   0.0  
Ecym_4380 Chr4 (801356..802612) [1257 bp, 418 aa] {ON} similar t...   696   0.0  
SAKL0F07502g Chr6 complement(571758..572996) [1239 bp, 412 aa] {...   652   0.0  
KLLA0D16214g Chr4 complement(1364989..1366245) [1257 bp, 418 aa]...   644   0.0  
Kwal_55.20368 s55 (376673..377911) [1239 bp, 412 aa] {ON} YIL022...   620   0.0  
TDEL0H02510 Chr8 (423430..424686) [1257 bp, 418 aa] {ON} Anc_7.1...   615   0.0  
KLTH0E04554g Chr5 (412896..414335) [1440 bp, 479 aa] {ON} simila...   618   0.0  
Smik_9.168 Chr9 (285754..287049) [1296 bp, 431 aa] {ON} YIL022W ...   615   0.0  
Kpol_1063.9 s1063 (26537..27790) [1254 bp, 417 aa] {ON} (26537.....   612   0.0  
Suva_9.177 Chr9 (298403..299710) [1308 bp, 435 aa] {ON} YIL022W ...   612   0.0  
Skud_9.147 Chr9 (280791..282086) [1296 bp, 431 aa] {ON} YIL022W ...   612   0.0  
YIL022W Chr9 (311165..312460) [1296 bp, 431 aa] {ON}  TIM44Essen...   604   0.0  
CAGL0J02442g Chr10 complement(236641..237879) [1239 bp, 412 aa] ...   601   0.0  
TPHA0C04530 Chr3 complement(975677..976927) [1251 bp, 416 aa] {O...   600   0.0  
KNAG0H02690 Chr8 (497172..498431) [1260 bp, 419 aa] {ON} Anc_7.1...   580   0.0  
ZYRO0D15840g Chr4 complement(1321497..1322720) [1224 bp, 407 aa]...   580   0.0  
NCAS0A12520 Chr1 complement(2470598..2471896) [1299 bp, 432 aa] ...   574   0.0  
NDAI0B01780 Chr2 complement(423642..424946) [1305 bp, 434 aa] {O...   572   0.0  
KAFR0A02640 Chr1 (547285..548550) [1266 bp, 421 aa] {ON} Anc_7.1...   540   0.0  
TBLA0J01500 Chr10 (342554..343819) [1266 bp, 421 aa] {ON} Anc_7....   504   e-178
KAFR0L00170 Chr12 complement(19587..20531) [945 bp, 314 aa] {ON}       31   4.8  
CAGL0K11363g Chr11 complement(1100013..1101257) [1245 bp, 414 aa...    31   7.3  

>ADL118C Chr4 complement(478675..479931) [1257 bp, 418 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL022W
           (TIM44)
          Length = 418

 Score =  830 bits (2144), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/418 (97%), Positives = 407/418 (97%)

Query: 1   MHRYSAVKQAQKSQPQRVLAARGFSATRWAGNGPKSPLQVFRETFKEEWKKSQELQDNIK 60
           MHRYSAVKQAQKSQPQRVLAARGFSATRWAGNGPKSPLQVFRETFKEEWKKSQELQDNIK
Sbjct: 1   MHRYSAVKQAQKSQPQRVLAARGFSATRWAGNGPKSPLQVFRETFKEEWKKSQELQDNIK 60

Query: 61  ALQDAGGRLGESDAYKKAREAYLKAQKGSTIVGKTLKRTGETLEHITVQAWESEIGKTTR 120
           ALQDAGGRLGESDAYKKAREAYLKAQKGSTIVGKTLKRTGETLEHITVQAWESEIGKTTR
Sbjct: 61  ALQDAGGRLGESDAYKKAREAYLKAQKGSTIVGKTLKRTGETLEHITVQAWESEIGKTTR 120

Query: 121 KTVSKTAQKLDESFEPVRQTKVYKDMSEIIDDGESSRYGGFMXXXXXXXXXXXDLATGKR 180
           KTVSKTAQKLDESFEPVRQTKVYKDMSEIIDDGESSRYGGFM           DLATGKR
Sbjct: 121 KTVSKTAQKLDESFEPVRQTKVYKDMSEIIDDGESSRYGGFMEKERRREKRERDLATGKR 180

Query: 181 ATPVRSNEEAGSALVATDKEASESLGKKIQDFKEKTVVGRKLHEIKVRLWDENENPLIGL 240
           ATPVRSNEEAGSALVATDKEASESLGKKIQDFKEKTVVGRKLHEIKVRLWDENENPLIGL
Sbjct: 181 ATPVRSNEEAGSALVATDKEASESLGKKIQDFKEKTVVGRKLHEIKVRLWDENENPLIGL 240

Query: 241 LRTISNKVGGLFAETESARVFAQFKLLDPTFNTEEFTKHLREYIIPEVLEAYVKGDEQVL 300
           LRTISNKVGGLFAETESARVFAQFKLLDPTFNTEEFTKHLREYIIPEVLEAYVKGDEQVL
Sbjct: 241 LRTISNKVGGLFAETESARVFAQFKLLDPTFNTEEFTKHLREYIIPEVLEAYVKGDEQVL 300

Query: 301 KQWFSEAPYNVYSAQQKQIRQQELFADGRILDIRGVEIISAKLLPPQDVPAIVVGCRAQE 360
           KQWFSEAPYNVYSAQQKQIRQQELFADGRILDIRGVEIISAKLLPPQDVPAIVVGCRAQE
Sbjct: 301 KQWFSEAPYNVYSAQQKQIRQQELFADGRILDIRGVEIISAKLLPPQDVPAIVVGCRAQE 360

Query: 361 IHLFRKATTGEIAAGHESNIMLSSYAMVLTRDPEKVDDKETEGWKILEFVRGGSRSFT 418
           IHLFRKATTGEIAAGHESNIMLSSYAMVLTRDPEKVDDKETEGWKILEFVRGGSRSFT
Sbjct: 361 IHLFRKATTGEIAAGHESNIMLSSYAMVLTRDPEKVDDKETEGWKILEFVRGGSRSFT 418

>Ecym_4380 Chr4 (801356..802612) [1257 bp, 418 aa] {ON} similar to
           Ashbya gossypii ADL118C
          Length = 418

 Score =  696 bits (1796), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/418 (78%), Positives = 372/418 (88%)

Query: 1   MHRYSAVKQAQKSQPQRVLAARGFSATRWAGNGPKSPLQVFRETFKEEWKKSQELQDNIK 60
           M +Y+A+KQ++ S   + + AR FS T  + NG KSPLQ+FRETFK+EWKKSQELQDNIK
Sbjct: 1   MLKYAAIKQSRMSGIAKAVPARQFSTTGLSWNGQKSPLQIFRETFKDEWKKSQELQDNIK 60

Query: 61  ALQDAGGRLGESDAYKKAREAYLKAQKGSTIVGKTLKRTGETLEHITVQAWESEIGKTTR 120
           ALQDA GRLGESDAYKKAREAYLKAQ+GST+VGKTLK+TGET+E++TV+AW+S+IGK TR
Sbjct: 61  ALQDASGRLGESDAYKKAREAYLKAQRGSTVVGKTLKKTGETIENLTVKAWDSDIGKNTR 120

Query: 121 KTVSKTAQKLDESFEPVRQTKVYKDMSEIIDDGESSRYGGFMXXXXXXXXXXXDLATGKR 180
           + VSKTAQKLDESFEPVR T+VYKDMSE+IDDGESSRYGGF+           DLA+G+R
Sbjct: 121 EVVSKTAQKLDESFEPVRHTRVYKDMSELIDDGESSRYGGFIAKETRRQKREHDLASGRR 180

Query: 181 ATPVRSNEEAGSALVATDKEASESLGKKIQDFKEKTVVGRKLHEIKVRLWDENENPLIGL 240
              VRSN+EAG+A+VAT+KE  ES GKKIQDFKEKT +GRKLHE KV+LWDENENPLI +
Sbjct: 181 THAVRSNDEAGTAMVATNKEGKESFGKKIQDFKEKTFIGRKLHESKVKLWDENENPLISM 240

Query: 241 LRTISNKVGGLFAETESARVFAQFKLLDPTFNTEEFTKHLREYIIPEVLEAYVKGDEQVL 300
           LRTISNK+GGLFAETESARVFAQFKLLDPTFN+EEFTKHLREYIIPEVLEAYVKGDE VL
Sbjct: 241 LRTISNKIGGLFAETESARVFAQFKLLDPTFNSEEFTKHLREYIIPEVLEAYVKGDEVVL 300

Query: 301 KQWFSEAPYNVYSAQQKQIRQQELFADGRILDIRGVEIISAKLLPPQDVPAIVVGCRAQE 360
           KQW SEAPYNVY+AQQKQ R+QELF DGR+LDIRGVEI+SAKLLPPQDVPA+VVGCR QE
Sbjct: 301 KQWLSEAPYNVYAAQQKQFREQELFPDGRVLDIRGVEIVSAKLLPPQDVPALVVGCRVQE 360

Query: 361 IHLFRKATTGEIAAGHESNIMLSSYAMVLTRDPEKVDDKETEGWKILEFVRGGSRSFT 418
           IHL+RKA TGEIAAGHESNIM+SSYAMVLTRDPE V DKETEGWK+LEF+RGGSR FT
Sbjct: 361 IHLYRKAKTGEIAAGHESNIMMSSYAMVLTRDPENVTDKETEGWKVLEFIRGGSRQFT 418

>SAKL0F07502g Chr6 complement(571758..572996) [1239 bp, 412 aa] {ON}
           highly similar to uniprot|Q01852 Saccharomyces
           cerevisiae YIL022W TIM44 48.8 kDa protein involved in
           mitochondrial protein import
          Length = 412

 Score =  652 bits (1683), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/419 (75%), Positives = 358/419 (85%), Gaps = 8/419 (1%)

Query: 1   MHRYSAVKQAQKSQPQRVLAAR-GFSATRWAGNGPKSPLQVFRETFKEEWKKSQELQDNI 59
           M+R+S        +PQ VLA+R   S+T     G +SPLQ+FRETFK+EW+KS+ELQDNI
Sbjct: 1   MYRHSI-------KPQLVLASRRTISSTVRLPQGQRSPLQIFRETFKQEWEKSKELQDNI 53

Query: 60  KALQDAGGRLGESDAYKKAREAYLKAQKGSTIVGKTLKRTGETLEHITVQAWESEIGKTT 119
           K LQDA G+LGESDAYKKAREAYL+AQKGSTIVGKTLK+TGET+E I V+AWESE+GKTT
Sbjct: 54  KTLQDASGKLGESDAYKKAREAYLRAQKGSTIVGKTLKKTGETVEDIAVKAWESELGKTT 113

Query: 120 RKTVSKTAQKLDESFEPVRQTKVYKDMSEIIDDGESSRYGGFMXXXXXXXXXXXDLATGK 179
           RK ++ TAQK+DESFEPVRQTKVYKD+SE+IDDGESSRYGGF+           DLA+GK
Sbjct: 114 RKAMNATAQKIDESFEPVRQTKVYKDVSEVIDDGESSRYGGFITKEQRRLKKEQDLASGK 173

Query: 180 RATPVRSNEEAGSALVATDKEASESLGKKIQDFKEKTVVGRKLHEIKVRLWDENENPLIG 239
           R   V+SN+EAG+ALVAT+ EA ES  KKI+DFKEKT  GRK+HE+KVRLWDE+ENPLI 
Sbjct: 174 RPKAVKSNDEAGTALVATNIEAKESFSKKIEDFKEKTPTGRKIHEMKVRLWDESENPLIV 233

Query: 240 LLRTISNKVGGLFAETESARVFAQFKLLDPTFNTEEFTKHLREYIIPEVLEAYVKGDEQV 299
           LLRTI NKVGG+FAETESARV  QFK+LDP FNTE FTKHLREYIIPE+LEAYVKGDE V
Sbjct: 234 LLRTIGNKVGGIFAETESARVMGQFKMLDPNFNTESFTKHLREYIIPEILEAYVKGDEAV 293

Query: 300 LKQWFSEAPYNVYSAQQKQIRQQELFADGRILDIRGVEIISAKLLPPQDVPAIVVGCRAQ 359
           LKQWFSEAPYNVY+AQQK  R QELFADGRILDIRGVEI+SAKLL PQD+P +VVGCRAQ
Sbjct: 294 LKQWFSEAPYNVYAAQQKAFRDQELFADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQ 353

Query: 360 EIHLFRKATTGEIAAGHESNIMLSSYAMVLTRDPEKVDDKETEGWKILEFVRGGSRSFT 418
           EIHL+RKA TGEIAAG ESNI+LSSYAMV TRDPE VDDKETEGW+ILEFVRGGSR FT
Sbjct: 354 EIHLYRKAKTGEIAAGTESNILLSSYAMVFTRDPENVDDKETEGWRILEFVRGGSRQFT 412

>KLLA0D16214g Chr4 complement(1364989..1366245) [1257 bp, 418 aa]
           {ON} highly similar to uniprot|Q01852 Saccharomyces
           cerevisiae YIL022W TIM44 48.8 kDa protein involved in
           mitochondrial protein import
          Length = 418

 Score =  644 bits (1660), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/402 (74%), Positives = 354/402 (88%)

Query: 17  RVLAARGFSATRWAGNGPKSPLQVFRETFKEEWKKSQELQDNIKALQDAGGRLGESDAYK 76
           R    R F+ +  A + P+SPLQ+FRETFK+EW+KS+ELQDNIKALQDA G+LGES+AYK
Sbjct: 17  RASTVRTFTVSAKAMSNPRSPLQIFRETFKQEWEKSKELQDNIKALQDASGKLGESEAYK 76

Query: 77  KAREAYLKAQKGSTIVGKTLKRTGETLEHITVQAWESEIGKTTRKTVSKTAQKLDESFEP 136
           KAREAY+KAQKGSTIVGKTLK+TGET+E I  +AW+SEI K+TRK V+KTA KLDESFEP
Sbjct: 77  KAREAYVKAQKGSTIVGKTLKKTGETVETIASKAWDSEIAKSTRKVVNKTADKLDESFEP 136

Query: 137 VRQTKVYKDMSEIIDDGESSRYGGFMXXXXXXXXXXXDLATGKRATPVRSNEEAGSALVA 196
           VR+TKVYKD+SE+IDDG+SSRYGGF+            +A+GKR+  V+SN+ AG+ALVA
Sbjct: 137 VRKTKVYKDVSEVIDDGDSSRYGGFITKEQRRLMKEEAIASGKRSRAVKSNDAAGTALVA 196

Query: 197 TDKEASESLGKKIQDFKEKTVVGRKLHEIKVRLWDENENPLIGLLRTISNKVGGLFAETE 256
           T+ E+ ES GKKI+DFKEKT VGRKLHE K++LWDE+ENPL+ +LRT+S K+GGLFAETE
Sbjct: 197 TNIESKESFGKKIEDFKEKTPVGRKLHEYKIKLWDESENPLVVMLRTVSGKIGGLFAETE 256

Query: 257 SARVFAQFKLLDPTFNTEEFTKHLREYIIPEVLEAYVKGDEQVLKQWFSEAPYNVYSAQQ 316
           SARV+ QFK++DPTFNTE+FTKHLREYIIPE+LEAYVKGDE VLKQWFSEAPYNVY+AQQ
Sbjct: 257 SARVYGQFKMMDPTFNTEDFTKHLREYIIPEILEAYVKGDEAVLKQWFSEAPYNVYAAQQ 316

Query: 317 KQIRQQELFADGRILDIRGVEIISAKLLPPQDVPAIVVGCRAQEIHLFRKATTGEIAAGH 376
           KQ R+QELFADG+ILDIRGVEI+SAKLLPPQD+P +VVGCRAQEIHL+RKA TGEIAAG 
Sbjct: 317 KQFREQELFADGKILDIRGVEIVSAKLLPPQDIPVLVVGCRAQEIHLYRKAKTGEIAAGA 376

Query: 377 ESNIMLSSYAMVLTRDPEKVDDKETEGWKILEFVRGGSRSFT 418
           ES+I++SSYAMV TRDPE VDDKETEGWKILEFVRGGSR FT
Sbjct: 377 ESSILMSSYAMVFTRDPETVDDKETEGWKILEFVRGGSRQFT 418

>Kwal_55.20368 s55 (376673..377911) [1239 bp, 412 aa] {ON} YIL022W
           (TIM44) - 48.8 kDa protein involved in mitochondrial
           protein import [contig 149] FULL
          Length = 412

 Score =  620 bits (1600), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/402 (73%), Positives = 343/402 (85%), Gaps = 1/402 (0%)

Query: 18  VLAARGFSATRWAGNG-PKSPLQVFRETFKEEWKKSQELQDNIKALQDAGGRLGESDAYK 76
           V+ +R  S T  A  G P+SPLQ+FRETFK+EWKKSQELQDNIKALQDA G+LGESDAYK
Sbjct: 11  VVFSRKLSQTIRACQGNPRSPLQIFRETFKQEWKKSQELQDNIKALQDASGKLGESDAYK 70

Query: 77  KAREAYLKAQKGSTIVGKTLKRTGETLEHITVQAWESEIGKTTRKTVSKTAQKLDESFEP 136
           KAREAYLKAQKGSTIVGKT+K+TG+++E I  +AWESEI K+TRK V+KTA KLDESFEP
Sbjct: 71  KAREAYLKAQKGSTIVGKTMKKTGDSVERIAAKAWESEISKSTRKAVNKTAAKLDESFEP 130

Query: 137 VRQTKVYKDMSEIIDDGESSRYGGFMXXXXXXXXXXXDLATGKRATPVRSNEEAGSALVA 196
           VR T+VYKD+SE+++ G SSRYGGF+           D+A+GKR   VRSN+EAG+ALVA
Sbjct: 131 VRHTRVYKDVSEVMESGNSSRYGGFITKEQRRLKLEQDIASGKRPKAVRSNDEAGTALVA 190

Query: 197 TDKEASESLGKKIQDFKEKTVVGRKLHEIKVRLWDENENPLIGLLRTISNKVGGLFAETE 256
           T+ EA ES GKK+ DFKEKTVVGRKLH+ KV+LWDE+ENPLI LLRTI NK+GGLFAETE
Sbjct: 191 TNIEAKESFGKKVDDFKEKTVVGRKLHDFKVKLWDESENPLIVLLRTIGNKIGGLFAETE 250

Query: 257 SARVFAQFKLLDPTFNTEEFTKHLREYIIPEVLEAYVKGDEQVLKQWFSEAPYNVYSAQQ 316
           SARV  QFK++D  FN+E F  HLREYIIPEVLEAYVKGDE+VLKQWFSEAPYNVY+AQQ
Sbjct: 251 SARVMGQFKMMDGNFNSESFLSHLREYIIPEVLEAYVKGDEKVLKQWFSEAPYNVYAAQQ 310

Query: 317 KQIRQQELFADGRILDIRGVEIISAKLLPPQDVPAIVVGCRAQEIHLFRKATTGEIAAGH 376
           K  R+Q LFADGRILDIRGV+I+SAKLL PQD+P +VVGCRAQEIHL+R   TGE+AAG 
Sbjct: 311 KVFREQGLFADGRILDIRGVDIVSAKLLAPQDLPVLVVGCRAQEIHLYRDVKTGEVAAGT 370

Query: 377 ESNIMLSSYAMVLTRDPEKVDDKETEGWKILEFVRGGSRSFT 418
           +SNI++SSYAMV TRDPE +D+KETEGWKILEFVRGGSR FT
Sbjct: 371 QSNILMSSYAMVFTRDPEDIDNKETEGWKILEFVRGGSRQFT 412

>TDEL0H02510 Chr8 (423430..424686) [1257 bp, 418 aa] {ON} Anc_7.196
           YIL022W
          Length = 418

 Score =  615 bits (1587), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/401 (70%), Positives = 343/401 (85%), Gaps = 1/401 (0%)

Query: 19  LAARG-FSATRWAGNGPKSPLQVFRETFKEEWKKSQELQDNIKALQDAGGRLGESDAYKK 77
           LA R  FS +  +   P+SP+Q+FR+TFK+EWKKSQELQDNIK LQDA GRLGES+AYK+
Sbjct: 18  LAGRALFSTSSGSLQNPRSPVQIFRDTFKKEWKKSQELQDNIKTLQDASGRLGESEAYKR 77

Query: 78  AREAYLKAQKGSTIVGKTLKRTGETLEHITVQAWESEIGKTTRKTVSKTAQKLDESFEPV 137
           AREAY++AQKGSTIVGKTLK+TGET+E+I  +AW+SEI + TR+  SKTA+K+DE FEPV
Sbjct: 78  AREAYVRAQKGSTIVGKTLKKTGETVENIASKAWDSEIARNTREAASKTAKKIDEGFEPV 137

Query: 138 RQTKVYKDMSEIIDDGESSRYGGFMXXXXXXXXXXXDLATGKRATPVRSNEEAGSALVAT 197
           RQTK+YKD+SE++DDG SSRYGGF+           D+ +GKRA  V+ NE+AG+ALVAT
Sbjct: 138 RQTKIYKDVSEVMDDGNSSRYGGFITKEQRRLKREQDMLSGKRAKAVKGNEDAGTALVAT 197

Query: 198 DKEASESLGKKIQDFKEKTVVGRKLHEIKVRLWDENENPLIGLLRTISNKVGGLFAETES 257
           D EA +S GKK++DFKEKTV+GR LH +K  LWDE+ NPLI  LR I+ K+GG FAETE+
Sbjct: 198 DIEAKQSFGKKVEDFKEKTVLGRTLHRLKNSLWDESVNPLIVFLRKITRKIGGFFAETEA 257

Query: 258 ARVFAQFKLLDPTFNTEEFTKHLREYIIPEVLEAYVKGDEQVLKQWFSEAPYNVYSAQQK 317
           ARV  QFK++DPTF  E FT+HLREY+IPE+LEAYVKGDE+VLK+WFSEAPYNVY+AQQK
Sbjct: 258 ARVLGQFKMMDPTFTNESFTRHLREYVIPEILEAYVKGDEKVLKKWFSEAPYNVYAAQQK 317

Query: 318 QIRQQELFADGRILDIRGVEIISAKLLPPQDVPAIVVGCRAQEIHLFRKATTGEIAAGHE 377
             R+Q+LFADG+ILDIRGVEI+SAK+LPPQD+P +VVGCRAQEIHL+RKA TGE+AAGHE
Sbjct: 318 AFREQQLFADGKILDIRGVEIVSAKMLPPQDIPVLVVGCRAQEIHLYRKAKTGEVAAGHE 377

Query: 378 SNIMLSSYAMVLTRDPEKVDDKETEGWKILEFVRGGSRSFT 418
           SNIM+SSYAMV TRDPE++DD+ETEGW+ILEFVRGGSR FT
Sbjct: 378 SNIMMSSYAMVFTRDPEQIDDEETEGWRILEFVRGGSRQFT 418

>KLTH0E04554g Chr5 (412896..414335) [1440 bp, 479 aa] {ON} similar
           to uniprot|Q01852 Saccharomyces cerevisiae YIL022W TIM44
           48.8 kDa protein involved in mitochondrial protein
           import
          Length = 479

 Score =  618 bits (1593), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/402 (72%), Positives = 341/402 (84%), Gaps = 1/402 (0%)

Query: 18  VLAARGFSATRWAGNG-PKSPLQVFRETFKEEWKKSQELQDNIKALQDAGGRLGESDAYK 76
           V+  R  + T  A  G P+SPLQ+FRETFK+EWKKSQELQDNIKALQDA G++GES+AYK
Sbjct: 78  VVIRRNLAQTFKACQGNPRSPLQIFRETFKQEWKKSQELQDNIKALQDASGKIGESEAYK 137

Query: 77  KAREAYLKAQKGSTIVGKTLKRTGETLEHITVQAWESEIGKTTRKTVSKTAQKLDESFEP 136
           KAREAYL AQKGSTIVGKTLK+TG+++E I  +AWESEIGK+TR+ V+KTA KLDESFEP
Sbjct: 138 KAREAYLSAQKGSTIVGKTLKKTGDSVEKIAAKAWESEIGKSTRQAVNKTAAKLDESFEP 197

Query: 137 VRQTKVYKDMSEIIDDGESSRYGGFMXXXXXXXXXXXDLATGKRATPVRSNEEAGSALVA 196
           VR T+VYKD+SE++D   SSRYGGF+           D+A+GKR   V+SNEEAG+ALVA
Sbjct: 198 VRHTRVYKDVSEVMDSSNSSRYGGFISKEQRRLKLEQDIASGKRPKAVKSNEEAGTALVA 257

Query: 197 TDKEASESLGKKIQDFKEKTVVGRKLHEIKVRLWDENENPLIGLLRTISNKVGGLFAETE 256
           T+ EA ES GKK+ DFKEKTVVGRKL ++K +LWDE+ENPLI L+RTI NKVGGLFAETE
Sbjct: 258 TEIEAKESFGKKVDDFKEKTVVGRKLQDVKQKLWDESENPLIVLMRTIGNKVGGLFAETE 317

Query: 257 SARVFAQFKLLDPTFNTEEFTKHLREYIIPEVLEAYVKGDEQVLKQWFSEAPYNVYSAQQ 316
           SARV  QFK++D  FN+E F  HLREYIIPEVLEAYVKG+EQVLKQWFSEAPYNVY+AQQ
Sbjct: 318 SARVMGQFKMMDGNFNSESFLSHLREYIIPEVLEAYVKGEEQVLKQWFSEAPYNVYAAQQ 377

Query: 317 KQIRQQELFADGRILDIRGVEIISAKLLPPQDVPAIVVGCRAQEIHLFRKATTGEIAAGH 376
           K  R+Q LFADGRILDIRGV+I+SAKLLPPQD+P +VVGCRAQEIHL+R   TGE+AAG 
Sbjct: 378 KVFREQGLFADGRILDIRGVDIVSAKLLPPQDLPVLVVGCRAQEIHLYRDVKTGEVAAGT 437

Query: 377 ESNIMLSSYAMVLTRDPEKVDDKETEGWKILEFVRGGSRSFT 418
           +SNI++SSYAMV TRDPE +DDKETEGWKILEFVRGGSR FT
Sbjct: 438 QSNILMSSYAMVFTRDPENIDDKETEGWKILEFVRGGSRQFT 479

>Smik_9.168 Chr9 (285754..287049) [1296 bp, 431 aa] {ON} YIL022W
           (REAL)
          Length = 431

 Score =  615 bits (1587), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/394 (71%), Positives = 345/394 (87%)

Query: 25  SATRWAGNGPKSPLQVFRETFKEEWKKSQELQDNIKALQDAGGRLGESDAYKKAREAYLK 84
           SATR  G  P+SPLQ+FR+TFK+EW+KSQELQ+NIK LQDA G+LGES+AYKKAREAYLK
Sbjct: 38  SATRTQGGNPRSPLQIFRDTFKKEWEKSQELQENIKTLQDASGKLGESEAYKKAREAYLK 97

Query: 85  AQKGSTIVGKTLKRTGETLEHITVQAWESEIGKTTRKTVSKTAQKLDESFEPVRQTKVYK 144
           AQ+GSTIVGKTLK+TGET+EHI  +AWESE+GK TRK  S TA+KLDESFEPVRQTK+YK
Sbjct: 98  AQRGSTIVGKTLKKTGETMEHIATKAWESELGKNTRKAASATAKKLDESFEPVRQTKIYK 157

Query: 145 DMSEIIDDGESSRYGGFMXXXXXXXXXXXDLATGKRATPVRSNEEAGSALVATDKEASES 204
           ++SE+IDDGESSRYGGF+           DLA+GKR   V+SN+EAG+A+VAT+ E+ ES
Sbjct: 158 EVSEVIDDGESSRYGGFITKEQRRLKREKDLASGKRHRAVKSNDEAGTAVVATNIESKES 217

Query: 205 LGKKIQDFKEKTVVGRKLHEIKVRLWDENENPLIGLLRTISNKVGGLFAETESARVFAQF 264
            GKK++DFKEKTVVGR +  +K +LWDE+ENPLI ++R I+NKVGG FAETES+RV++QF
Sbjct: 218 FGKKVEDFKEKTVVGRSIQSLKNKLWDESENPLIVVMRKITNKVGGFFAETESSRVYSQF 277

Query: 265 KLLDPTFNTEEFTKHLREYIIPEVLEAYVKGDEQVLKQWFSEAPYNVYSAQQKQIRQQEL 324
           K++DPTF+ E FT+HLREYI+PE+LEAYVKGD +VLK+WFSEAP+NVY+AQQK  ++Q++
Sbjct: 278 KMMDPTFSNESFTRHLREYIVPEILEAYVKGDVKVLKKWFSEAPFNVYAAQQKIFKEQDV 337

Query: 325 FADGRILDIRGVEIISAKLLPPQDVPAIVVGCRAQEIHLFRKATTGEIAAGHESNIMLSS 384
           +ADGRILDIRGVE++SAKLL PQD+P +VVGCRAQEI+L+RK  TGEIAAG E+NI++SS
Sbjct: 338 YADGRILDIRGVEVVSAKLLAPQDIPVLVVGCRAQEINLYRKKKTGEIAAGDEANILMSS 397

Query: 385 YAMVLTRDPEKVDDKETEGWKILEFVRGGSRSFT 418
           YAMV TRDPE++DD ETEGWKILEFVRGGSR FT
Sbjct: 398 YAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT 431

>Kpol_1063.9 s1063 (26537..27790) [1254 bp, 417 aa] {ON}
           (26537..27790) [1254 nt, 418 aa]
          Length = 417

 Score =  612 bits (1579), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/395 (71%), Positives = 341/395 (86%)

Query: 24  FSATRWAGNGPKSPLQVFRETFKEEWKKSQELQDNIKALQDAGGRLGESDAYKKAREAYL 83
           FS +     GP++P+Q+FR+TFK+EW+KS++LQDNIKALQDA GRLGES+AYKKAREAYL
Sbjct: 23  FSTSSRVLQGPRTPIQIFRDTFKKEWEKSKDLQDNIKALQDASGRLGESEAYKKAREAYL 82

Query: 84  KAQKGSTIVGKTLKRTGETLEHITVQAWESEIGKTTRKTVSKTAQKLDESFEPVRQTKVY 143
           KAQKGSTIVGKTL++TGET+E I  +AW+SEIGK+TRK  S TA+K+DESFEPVR+T+VY
Sbjct: 83  KAQKGSTIVGKTLQKTGETVEDIASKAWDSEIGKSTRKAASATARKIDESFEPVRKTQVY 142

Query: 144 KDMSEIIDDGESSRYGGFMXXXXXXXXXXXDLATGKRATPVRSNEEAGSALVATDKEASE 203
           KD+S++IDDG+SSRYGGF+           DL +GKR   V+SN+EAG+++VAT+ EA E
Sbjct: 143 KDVSDVIDDGDSSRYGGFIGKEQRRLKRESDLVSGKRVRAVKSNDEAGTSIVATNIEAKE 202

Query: 204 SLGKKIQDFKEKTVVGRKLHEIKVRLWDENENPLIGLLRTISNKVGGLFAETESARVFAQ 263
           SLGKK++DFKE T  GR +H +KV+LWDENENPLI  LR +S K+GG FAETES+RV +Q
Sbjct: 203 SLGKKMEDFKENTTAGRTIHGVKVKLWDENENPLIVFLRKVSGKIGGFFAETESSRVLSQ 262

Query: 264 FKLLDPTFNTEEFTKHLREYIIPEVLEAYVKGDEQVLKQWFSEAPYNVYSAQQKQIRQQE 323
           FKL+DPTF+ + FTKHLREYIIPEVLEAYVKGDE VLK+WFSEAPYNVY+AQQK+ R+Q+
Sbjct: 263 FKLMDPTFSNDSFTKHLREYIIPEVLEAYVKGDEAVLKKWFSEAPYNVYAAQQKEFRKQQ 322

Query: 324 LFADGRILDIRGVEIISAKLLPPQDVPAIVVGCRAQEIHLFRKATTGEIAAGHESNIMLS 383
           LF DGRILDIRGVEI+SAKLL PQD+P +VVGCRAQEIHL+RK  TGEIAAG ESNI++S
Sbjct: 323 LFPDGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEIHLYRKVKTGEIAAGDESNILMS 382

Query: 384 SYAMVLTRDPEKVDDKETEGWKILEFVRGGSRSFT 418
           SYAMV TRDPE++DD ETEGWKILEFVRGGSR FT
Sbjct: 383 SYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT 417

>Suva_9.177 Chr9 (298403..299710) [1308 bp, 435 aa] {ON} YIL022W
           (REAL)
          Length = 435

 Score =  612 bits (1579), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/410 (69%), Positives = 349/410 (85%), Gaps = 3/410 (0%)

Query: 12  KSQPQRVLAARGF---SATRWAGNGPKSPLQVFRETFKEEWKKSQELQDNIKALQDAGGR 68
           + Q   +L AR     SATR  G  P+SPLQ+FR+TFK+EW KSQELQ+NIK LQDA G+
Sbjct: 26  RPQDAGLLIARALFSTSATRAQGGNPRSPLQIFRDTFKKEWDKSQELQENIKTLQDASGK 85

Query: 69  LGESDAYKKAREAYLKAQKGSTIVGKTLKRTGETLEHITVQAWESEIGKTTRKTVSKTAQ 128
           LGES+AYKKAREAYL+AQ+GSTIVGKTLK+TGET+EHI  +AW+SE+GK TRK  S TA+
Sbjct: 86  LGESEAYKKAREAYLRAQRGSTIVGKTLKKTGETVEHIATRAWDSELGKNTRKAASATAK 145

Query: 129 KLDESFEPVRQTKVYKDMSEIIDDGESSRYGGFMXXXXXXXXXXXDLATGKRATPVRSNE 188
           KLDESFEPVRQTK+YK++SE+IDDGESSRYGGF+           DLA+GKR   V+SN+
Sbjct: 146 KLDESFEPVRQTKIYKEVSEVIDDGESSRYGGFITKEQRRLKREKDLASGKRHRAVKSND 205

Query: 189 EAGSALVATDKEASESLGKKIQDFKEKTVVGRKLHEIKVRLWDENENPLIGLLRTISNKV 248
           EAG+A+VAT+ E+ ES GKK++DFKEKT VGR +  +K RLWDE+ENPLI ++R ++NKV
Sbjct: 206 EAGTAVVATNIESKESFGKKVEDFKEKTAVGRSIQSLKNRLWDESENPLIVIMRKVTNKV 265

Query: 249 GGLFAETESARVFAQFKLLDPTFNTEEFTKHLREYIIPEVLEAYVKGDEQVLKQWFSEAP 308
           GG FAETES+RV++QFK++DPTF+ E FT+HLREYI+PE+LEAYVKGD +VLK+WFSEAP
Sbjct: 266 GGFFAETESSRVYSQFKMMDPTFSNENFTRHLREYIVPEILEAYVKGDVKVLKKWFSEAP 325

Query: 309 YNVYSAQQKQIRQQELFADGRILDIRGVEIISAKLLPPQDVPAIVVGCRAQEIHLFRKAT 368
           +NVY+AQQK  ++Q++FADGRILDIRGVEI+SAKLL PQD+P +VVGCRAQEI+L+RK  
Sbjct: 326 FNVYAAQQKIFKEQDVFADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYRKRK 385

Query: 369 TGEIAAGHESNIMLSSYAMVLTRDPEKVDDKETEGWKILEFVRGGSRSFT 418
           TGEIAAG E+NI++SSYAMV TRDPE++DD ETEGWKILEFVRGGSR FT
Sbjct: 386 TGEIAAGDEANILMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT 435

>Skud_9.147 Chr9 (280791..282086) [1296 bp, 431 aa] {ON} YIL022W
           (REAL)
          Length = 431

 Score =  612 bits (1578), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/410 (69%), Positives = 350/410 (85%), Gaps = 3/410 (0%)

Query: 12  KSQPQRVLAARGF---SATRWAGNGPKSPLQVFRETFKEEWKKSQELQDNIKALQDAGGR 68
           +SQ   +L AR     SATR  G  P+SPLQ+FR+TFK+EW+KSQELQ+NIK LQDA G+
Sbjct: 22  RSQDAGLLVARVLFSTSATRAQGGNPRSPLQIFRDTFKKEWEKSQELQENIKTLQDASGK 81

Query: 69  LGESDAYKKAREAYLKAQKGSTIVGKTLKRTGETLEHITVQAWESEIGKTTRKTVSKTAQ 128
           LGES+AYKKAREAYL+AQ+GSTIVGKTLK+TGET+EHI  +AWESE+GK TRK  S TA+
Sbjct: 82  LGESEAYKKAREAYLRAQRGSTIVGKTLKKTGETMEHIATKAWESELGKNTRKAASATAK 141

Query: 129 KLDESFEPVRQTKVYKDMSEIIDDGESSRYGGFMXXXXXXXXXXXDLATGKRATPVRSNE 188
           +LDESFEPVRQTK+YK++SE+IDDGESSRYGGF+           DLA+GKR   V+SN+
Sbjct: 142 RLDESFEPVRQTKIYKEVSEVIDDGESSRYGGFITKEQRRLKREKDLASGKRHRAVKSND 201

Query: 189 EAGSALVATDKEASESLGKKIQDFKEKTVVGRKLHEIKVRLWDENENPLIGLLRTISNKV 248
           EAG+A+VAT+ E+ ES GKK++DF+EKT +GR +  +K RLWDE+ENPLI ++R ++NKV
Sbjct: 202 EAGTAVVATNIESKESFGKKVEDFREKTAMGRSIQSLKNRLWDESENPLIVIMRKVTNKV 261

Query: 249 GGLFAETESARVFAQFKLLDPTFNTEEFTKHLREYIIPEVLEAYVKGDEQVLKQWFSEAP 308
           GG FAETES+RV +QFKL+DPTF+ E FT+HLR+YI+PE+LEAYVK D +VLK+WFSEAP
Sbjct: 262 GGFFAETESSRVHSQFKLMDPTFSNESFTRHLRDYIVPEILEAYVKADVKVLKKWFSEAP 321

Query: 309 YNVYSAQQKQIRQQELFADGRILDIRGVEIISAKLLPPQDVPAIVVGCRAQEIHLFRKAT 368
           YNVY+AQQK  R+Q+++ADGRILDIRGVEI+SAKLL PQD+P +VVGCRAQEI+L+RK  
Sbjct: 322 YNVYAAQQKIFREQDVYADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYRKRK 381

Query: 369 TGEIAAGHESNIMLSSYAMVLTRDPEKVDDKETEGWKILEFVRGGSRSFT 418
           TGEIAAG+E+NI++SSYAMV TRDPE++DD ETEGWKILEFVRGGSR FT
Sbjct: 382 TGEIAAGNEANILMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT 431

>YIL022W Chr9 (311165..312460) [1296 bp, 431 aa] {ON}
           TIM44Essential component of the Translocase of the Inner
           Mitochondrial membrane (TIM23 complex); tethers the
           import motor and regulatory factors (PAM complex) to the
           translocation channel (Tim23p-Tim17p core complex)
          Length = 431

 Score =  604 bits (1558), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/431 (67%), Positives = 358/431 (83%), Gaps = 13/431 (3%)

Query: 1   MHRYSAVKQA----------QKSQPQRVLAARGF---SATRWAGNGPKSPLQVFRETFKE 47
           MHR + ++ +           +SQ   +L AR     S TR  G  P+SPLQ+FR+TFK+
Sbjct: 1   MHRSTFIRTSGTSSRTLTARYRSQYTGLLVARVLFSTSTTRAQGGNPRSPLQIFRDTFKK 60

Query: 48  EWKKSQELQDNIKALQDAGGRLGESDAYKKAREAYLKAQKGSTIVGKTLKRTGETLEHIT 107
           EW+KSQELQ+NIK LQDA G+LGES+AYKKAREAYLKAQ+GSTIVGKTLK+TGET+EHI 
Sbjct: 61  EWEKSQELQENIKTLQDASGKLGESEAYKKAREAYLKAQRGSTIVGKTLKKTGETMEHIA 120

Query: 108 VQAWESEIGKTTRKTVSKTAQKLDESFEPVRQTKVYKDMSEIIDDGESSRYGGFMXXXXX 167
            +AWESE+GK TRK  + TA+KLDESFEPVRQTK+YK++SE+IDDGESSRYGGF+     
Sbjct: 121 TKAWESELGKNTRKAAAATAKKLDESFEPVRQTKIYKEVSEVIDDGESSRYGGFITKEQR 180

Query: 168 XXXXXXDLATGKRATPVRSNEEAGSALVATDKEASESLGKKIQDFKEKTVVGRKLHEIKV 227
                 DLA+GKR   V+SNE+AG+A+VAT+ E+ ES GKK++DFKEKTVVGR +  +K 
Sbjct: 181 RLKRERDLASGKRHRAVKSNEDAGTAVVATNIESKESFGKKVEDFKEKTVVGRSIQSLKN 240

Query: 228 RLWDENENPLIGLLRTISNKVGGLFAETESARVFAQFKLLDPTFNTEEFTKHLREYIIPE 287
           +LWDE+ENPLI ++R I+NKVGG FAETES+RV++QFKL+DPTF+ E FT+HLREYI+PE
Sbjct: 241 KLWDESENPLIVVMRKITNKVGGFFAETESSRVYSQFKLMDPTFSNESFTRHLREYIVPE 300

Query: 288 VLEAYVKGDEQVLKQWFSEAPYNVYSAQQKQIRQQELFADGRILDIRGVEIISAKLLPPQ 347
           +LEAYVKGD +VLK+WFSEAP+NVY+AQQK  ++Q+++ADGRILDIRGVEI+SAKLL PQ
Sbjct: 301 ILEAYVKGDVKVLKKWFSEAPFNVYAAQQKIFKEQDVYADGRILDIRGVEIVSAKLLAPQ 360

Query: 348 DVPAIVVGCRAQEIHLFRKATTGEIAAGHESNIMLSSYAMVLTRDPEKVDDKETEGWKIL 407
           D+P +VVGCRAQEI+L+RK  TGEIAAG E+NI++SSYAMV TRDPE++DD ETEGWKIL
Sbjct: 361 DIPVLVVGCRAQEINLYRKKKTGEIAAGDEANILMSSYAMVFTRDPEQIDDDETEGWKIL 420

Query: 408 EFVRGGSRSFT 418
           EFVRGGSR FT
Sbjct: 421 EFVRGGSRQFT 431

>CAGL0J02442g Chr10 complement(236641..237879) [1239 bp, 412 aa]
           {ON} highly similar to uniprot|Q01852 Saccharomyces
           cerevisiae YIL022w TIM44
          Length = 412

 Score =  601 bits (1550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/402 (71%), Positives = 338/402 (84%), Gaps = 1/402 (0%)

Query: 18  VLAARGFSATRWAGNGPKSPLQVFRETFKEEWKKSQELQDNIKALQDAGGRLGESDAYKK 77
           ++A R F       + P+SPLQ+FRETFK+EW+KSQELQDNIK LQDA GRLGES+AYKK
Sbjct: 11  LVARRCFGTRSVLLSNPRSPLQIFRETFKKEWEKSQELQDNIKTLQDASGRLGESEAYKK 70

Query: 78  AREAYLKAQKGS-TIVGKTLKRTGETLEHITVQAWESEIGKTTRKTVSKTAQKLDESFEP 136
           AREAYLKA KGS TIVGKTL++TGET+E +  +AW+S+I KTTR   SKTA+KLDESFEP
Sbjct: 71  AREAYLKASKGSQTIVGKTLQKTGETVEELATKAWDSDIAKTTRVVASKTAKKLDESFEP 130

Query: 137 VRQTKVYKDMSEIIDDGESSRYGGFMXXXXXXXXXXXDLATGKRATPVRSNEEAGSALVA 196
           VRQTK+YKD+SE+IDDG+SS YGGF+           DLA+GKR   V+SN+EAGSALVA
Sbjct: 131 VRQTKIYKDVSEVIDDGDSSSYGGFITKEQRRLKREKDLASGKRVRAVKSNDEAGSALVA 190

Query: 197 TDKEASESLGKKIQDFKEKTVVGRKLHEIKVRLWDENENPLIGLLRTISNKVGGLFAETE 256
           TD EA ESLGKKI+DFKEKT VGR L  +KV LWDE+ENPLI  LR I+ K+GG FAETE
Sbjct: 191 TDIEAKESLGKKIEDFKEKTPVGRTLKSVKVSLWDESENPLIVFLRKITGKIGGFFAETE 250

Query: 257 SARVFAQFKLLDPTFNTEEFTKHLREYIIPEVLEAYVKGDEQVLKQWFSEAPYNVYSAQQ 316
           SARV+ QFK++DPTF    FTKHLR+YI+PEVLEAYVKGDE+VLK+WFSEAP+NVY+AQQ
Sbjct: 251 SARVYKQFKMVDPTFTNIGFTKHLRDYIVPEVLEAYVKGDEKVLKKWFSEAPFNVYNAQQ 310

Query: 317 KQIRQQELFADGRILDIRGVEIISAKLLPPQDVPAIVVGCRAQEIHLFRKATTGEIAAGH 376
           K  ++QELF+DG+ILDIRGVE++SAKLL PQD+P +VVGCRAQEIHL+RKA TGEIAAG 
Sbjct: 311 KIFKKQELFSDGKILDIRGVEVVSAKLLQPQDIPVLVVGCRAQEIHLYRKAKTGEIAAGD 370

Query: 377 ESNIMLSSYAMVLTRDPEKVDDKETEGWKILEFVRGGSRSFT 418
           ESNI++SSYAMV TRDPE++DD ETEGWKILEF+RG SR F 
Sbjct: 371 ESNILMSSYAMVFTRDPEQIDDDETEGWKILEFIRGSSRPFN 412

>TPHA0C04530 Chr3 complement(975677..976927) [1251 bp, 416 aa] {ON}
           Anc_7.196 YIL022W
          Length = 416

 Score =  600 bits (1547), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/394 (70%), Positives = 337/394 (85%)

Query: 25  SATRWAGNGPKSPLQVFRETFKEEWKKSQELQDNIKALQDAGGRLGESDAYKKAREAYLK 84
           ++T     G K+P+Q+FRETFK+EW+KSQELQDNIK LQDA GRLG+S+AYKKA+EAY+K
Sbjct: 23  TSTVLRNGGGKTPIQIFRETFKKEWEKSQELQDNIKTLQDASGRLGQSEAYKKAKEAYVK 82

Query: 85  AQKGSTIVGKTLKRTGETLEHITVQAWESEIGKTTRKTVSKTAQKLDESFEPVRQTKVYK 144
           AQ+ STIV KTLK+TGET+E +  + W+SEIGK+TRK VS+ A+K+DESFEPVRQT+VYK
Sbjct: 83  AQQSSTIVSKTLKKTGETVEDLAKKTWDSEIGKSTRKVVSQGAKKIDESFEPVRQTQVYK 142

Query: 145 DMSEIIDDGESSRYGGFMXXXXXXXXXXXDLATGKRATPVRSNEEAGSALVATDKEASES 204
           ++SE+IDDGESSRYGGF+           DLA+GKR    +SNEEAG+A+VAT+ E+ ES
Sbjct: 143 EVSEVIDDGESSRYGGFISKEQRRKKREADLASGKRVRATKSNEEAGTAIVATNVESKES 202

Query: 205 LGKKIQDFKEKTVVGRKLHEIKVRLWDENENPLIGLLRTISNKVGGLFAETESARVFAQF 264
            GKKI DFKEKTVVG+ +   KVR+WDENENPLI +LRTISNK+ G FAETES+RV++QF
Sbjct: 203 FGKKIDDFKEKTVVGKTMKSFKVRVWDENENPLIVVLRTISNKISGFFAETESSRVYSQF 262

Query: 265 KLLDPTFNTEEFTKHLREYIIPEVLEAYVKGDEQVLKQWFSEAPYNVYSAQQKQIRQQEL 324
           KL+DPTF+   FTKHLR+YIIPEVLEAYVKGDE VLK+WFSEAP+NVY+AQQK++R+Q+L
Sbjct: 263 KLMDPTFSNAAFTKHLRDYIIPEVLEAYVKGDEVVLKKWFSEAPFNVYAAQQKELRKQQL 322

Query: 325 FADGRILDIRGVEIISAKLLPPQDVPAIVVGCRAQEIHLFRKATTGEIAAGHESNIMLSS 384
           F DGRILDIRGV+I+SAKLL PQD+P +VVGCRAQE+HL+RK  TGE+ AG ESNIM+SS
Sbjct: 323 FTDGRILDIRGVDIVSAKLLAPQDIPVLVVGCRAQELHLYRKVKTGELGAGDESNIMMSS 382

Query: 385 YAMVLTRDPEKVDDKETEGWKILEFVRGGSRSFT 418
           YAMV TRDP+ +DD ETEGWKILEFVRGGSR FT
Sbjct: 383 YAMVFTRDPDNIDDDETEGWKILEFVRGGSRQFT 416

>KNAG0H02690 Chr8 (497172..498431) [1260 bp, 419 aa] {ON} Anc_7.196
           YIL022W
          Length = 419

 Score =  580 bits (1496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/421 (66%), Positives = 340/421 (80%), Gaps = 5/421 (1%)

Query: 1   MHRYSAVKQAQKSQPQRVLAARGFSATRWAGNG---PKSPLQVFRETFKEEWKKSQELQD 57
           M  Y  V+ A  S   RV+A       R   NG   P+SPL +FR+TFK+EW+KSQELQ+
Sbjct: 1   MLAYKTVRPA--SAGVRVVARAPLHTARVLLNGGRDPRSPLSIFRDTFKKEWEKSQELQE 58

Query: 58  NIKALQDAGGRLGESDAYKKAREAYLKAQKGSTIVGKTLKRTGETLEHITVQAWESEIGK 117
           NI+ LQDA G++GE++AY+KAREA+L+AQKGSTIVGKTLK+TGET+E I  +AW+SEI K
Sbjct: 59  NIRTLQDASGKIGETEAYRKAREAFLRAQKGSTIVGKTLKKTGETVEGIASKAWDSEIAK 118

Query: 118 TTRKTVSKTAQKLDESFEPVRQTKVYKDMSEIIDDGESSRYGGFMXXXXXXXXXXXDLAT 177
            +RK   KTAQKLDE FEPVRQT++YKD+SE+IDDG+S+ YGGF             LA+
Sbjct: 119 ASRKAAVKTAQKLDEGFEPVRQTQLYKDVSEVIDDGDSTSYGGFFTREERQRRREKALAS 178

Query: 178 GKRATPVRSNEEAGSALVATDKEASESLGKKIQDFKEKTVVGRKLHEIKVRLWDENENPL 237
           G+R   V+SN+EAG+ALVAT  E+ ESLGKK++DFKEKT VGR LH +K RLWDE+ENPL
Sbjct: 179 GERVRAVKSNDEAGTALVATGVESKESLGKKMEDFKEKTAVGRSLHGLKHRLWDESENPL 238

Query: 238 IGLLRTISNKVGGLFAETESARVFAQFKLLDPTFNTEEFTKHLREYIIPEVLEAYVKGDE 297
           I  +R +S KVG  FAETES RV+ QFKL+DP FN+  FTKHLREY++PE+LEAYV+GDE
Sbjct: 239 IVFMRKVSGKVGKFFAETESGRVYTQFKLMDPNFNSVTFTKHLREYVVPEILEAYVRGDE 298

Query: 298 QVLKQWFSEAPYNVYSAQQKQIRQQELFADGRILDIRGVEIISAKLLPPQDVPAIVVGCR 357
           +VLK+WFSEAPYNVY+AQQK  +++ LFADGRILDIRGVEI+SAKLL PQD+P +VVGCR
Sbjct: 299 KVLKKWFSEAPYNVYAAQQKMFKEKALFADGRILDIRGVEIVSAKLLQPQDLPVLVVGCR 358

Query: 358 AQEIHLFRKATTGEIAAGHESNIMLSSYAMVLTRDPEKVDDKETEGWKILEFVRGGSRSF 417
           AQEI+L++K  TGEIAAG ESNI++SSYAMV TRDPE+V D+ETEGWKILEFVRGGSR F
Sbjct: 359 AQEINLYKKVKTGEIAAGSESNILMSSYAMVFTRDPEQVTDEETEGWKILEFVRGGSRQF 418

Query: 418 T 418
           T
Sbjct: 419 T 419

>ZYRO0D15840g Chr4 complement(1321497..1322720) [1224 bp, 407 aa]
           {ON} highly similar to uniprot|Q01852 Saccharomyces
           cerevisiae YIL022W TIM44 48.8 kDa protein involved in
           mitochondrial protein import
          Length = 407

 Score =  580 bits (1494), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/384 (68%), Positives = 330/384 (85%)

Query: 35  KSPLQVFRETFKEEWKKSQELQDNIKALQDAGGRLGESDAYKKAREAYLKAQKGSTIVGK 94
           +SPLQ+FR+TFK+EW+KSQELQ+NIK LQDA GRLG+S+  K+AREAYL+AQKGSTIVGK
Sbjct: 24  RSPLQIFRDTFKKEWEKSQELQENIKTLQDASGRLGDSEGVKRAREAYLRAQKGSTIVGK 83

Query: 95  TLKRTGETLEHITVQAWESEIGKTTRKTVSKTAQKLDESFEPVRQTKVYKDMSEIIDDGE 154
           TL++TGET+E I  +AWESEI K+TR   S TA+KLD+SFEPVR TK+YKD+SE+++D +
Sbjct: 84  TLQKTGETVEGIASKAWESEIAKSTRSAASATAKKLDKSFEPVRNTKIYKDVSEVMEDAD 143

Query: 155 SSRYGGFMXXXXXXXXXXXDLATGKRATPVRSNEEAGSALVATDKEASESLGKKIQDFKE 214
           +SRYGGF+           ++A+GKRA  +RSNEEAG+ALVAT+ EA ESLGKK++DF+E
Sbjct: 144 TSRYGGFLTKEQRKIKREREIASGKRARAIRSNEEAGTALVATNIEAKESLGKKVEDFRE 203

Query: 215 KTVVGRKLHEIKVRLWDENENPLIGLLRTISNKVGGLFAETESARVFAQFKLLDPTFNTE 274
           KT +GR + ++KVRLW+ENENPLI +LR I+NKVGG FAETE+A+V  QFKLLDP+F +E
Sbjct: 204 KTFIGRAIQQLKVRLWNENENPLIVILRKITNKVGGFFAETETAKVIGQFKLLDPSFTSE 263

Query: 275 EFTKHLREYIIPEVLEAYVKGDEQVLKQWFSEAPYNVYSAQQKQIRQQELFADGRILDIR 334
            FT+ LR+Y+IPEVLEAY KGDE+ LK+WFSEAP+NVY+AQQK  R Q+LFAD RILDIR
Sbjct: 264 GFTRQLRDYVIPEVLEAYAKGDEKTLKKWFSEAPFNVYAAQQKFFRDQKLFADSRILDIR 323

Query: 335 GVEIISAKLLPPQDVPAIVVGCRAQEIHLFRKATTGEIAAGHESNIMLSSYAMVLTRDPE 394
           GV+I+SAKLLPPQD+P ++VGCRAQEI L+R   +GE+AAGHESNI++SSYAMV TRDPE
Sbjct: 324 GVDIVSAKLLPPQDIPVLIVGCRAQEIQLYRSIKSGEVAAGHESNILMSSYAMVFTRDPE 383

Query: 395 KVDDKETEGWKILEFVRGGSRSFT 418
            V+D+ETEGW+I+EFVRGGSR FT
Sbjct: 384 NVEDEETEGWRIIEFVRGGSRQFT 407

>NCAS0A12520 Chr1 complement(2470598..2471896) [1299 bp, 432 aa]
           {ON} Anc_7.196 YIL022W
          Length = 432

 Score =  574 bits (1480), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/398 (67%), Positives = 333/398 (83%), Gaps = 3/398 (0%)

Query: 24  FSAT--RWAGNGPKSPLQVFRETFKEEWKKSQELQDNIKALQDAGGRLGESDAYKKAREA 81
           FS T  R  G G ++P+Q+FR+TFK+EW KSQELQ+NIKAL DA G+L ES+ +K A++A
Sbjct: 35  FSTTTARSNGGGGRTPIQIFRDTFKKEWDKSQELQENIKALHDASGKLSESETFKMAKDA 94

Query: 82  YLKAQKGS-TIVGKTLKRTGETLEHITVQAWESEIGKTTRKTVSKTAQKLDESFEPVRQT 140
           YLKA KGS TI+ KT+++TGET+E++  +AW+SEI K+TR+   KTA  LD+SFEPVR+T
Sbjct: 95  YLKAHKGSSTILSKTMQKTGETVENMASKAWDSEIAKSTREAAKKTADTLDKSFEPVRKT 154

Query: 141 KVYKDMSEIIDDGESSRYGGFMXXXXXXXXXXXDLATGKRATPVRSNEEAGSALVATDKE 200
           +VYKD+SE+IDDG+SSRYGGF+           DLA+GKR   ++SNEEAG+ALVATD E
Sbjct: 155 QVYKDISEVIDDGDSSRYGGFITKEERRLKRESDLASGKRQRAIKSNEEAGTALVATDIE 214

Query: 201 ASESLGKKIQDFKEKTVVGRKLHEIKVRLWDENENPLIGLLRTISNKVGGLFAETESARV 260
           A +S GKK++DFKEKTVVG+ +  +KV+LWDE+ENPLI  LR I+NK+GG F ETESARV
Sbjct: 215 AKQSFGKKVEDFKEKTVVGKTMSSVKVKLWDESENPLIVFLRKITNKIGGFFDETESARV 274

Query: 261 FAQFKLLDPTFNTEEFTKHLREYIIPEVLEAYVKGDEQVLKQWFSEAPYNVYSAQQKQIR 320
           + QFK++D TF  E FT+HLREYI+PE+LEAY+KGDE+VLK+WFSEAP+NVYSAQQK  R
Sbjct: 275 YTQFKMMDATFTNEGFTRHLREYIVPELLEAYIKGDEKVLKKWFSEAPFNVYSAQQKVFR 334

Query: 321 QQELFADGRILDIRGVEIISAKLLPPQDVPAIVVGCRAQEIHLFRKATTGEIAAGHESNI 380
           +Q LF+DGRILDIRGVEI+SAKLL PQD+P +VVGCRAQEI+L+RK  TGEIAAG +SNI
Sbjct: 335 EQGLFSDGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYRKVKTGEIAAGDQSNI 394

Query: 381 MLSSYAMVLTRDPEKVDDKETEGWKILEFVRGGSRSFT 418
           ++SSYAMV TRDPE++DD ETEGWKILEFVRGGSR FT
Sbjct: 395 LMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT 432

>NDAI0B01780 Chr2 complement(423642..424946) [1305 bp, 434 aa] {ON}
           Anc_7.196 YIL022W
          Length = 434

 Score =  572 bits (1475), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/399 (66%), Positives = 332/399 (83%), Gaps = 4/399 (1%)

Query: 24  FSATRWA----GNGPKSPLQVFRETFKEEWKKSQELQDNIKALQDAGGRLGESDAYKKAR 79
           FS TR      G G ++P+Q+FR+TFK+EW+KSQELQDNIKAL DA G+L ES+ +K A+
Sbjct: 36  FSTTRTTLNNNGGGGRTPIQIFRDTFKKEWEKSQELQDNIKALHDASGKLSESETFKMAK 95

Query: 80  EAYLKAQKGSTIVGKTLKRTGETLEHITVQAWESEIGKTTRKTVSKTAQKLDESFEPVRQ 139
           +AYLKA KGSTIV KTLK+TGET+E +  +AW+SEIGK TR    KTA+ +D+SFEPVR+
Sbjct: 96  DAYLKAHKGSTIVSKTLKKTGETVETMASKAWDSEIGKNTRIAAKKTAETIDKSFEPVRK 155

Query: 140 TKVYKDMSEIIDDGESSRYGGFMXXXXXXXXXXXDLATGKRATPVRSNEEAGSALVATDK 199
           T++YKD+SE+IDDG+SSRYGGF+           DLA+GKR   V+SN+EAG+ALVAT+ 
Sbjct: 156 TQIYKDVSEVIDDGDSSRYGGFITKEERKLKRERDLASGKRQRAVKSNDEAGTALVATNI 215

Query: 200 EASESLGKKIQDFKEKTVVGRKLHEIKVRLWDENENPLIGLLRTISNKVGGLFAETESAR 259
           EA ES GKK++DFKEKTVVG+ +  +K++LWDE+ENPLI  LR ISNK+ G F ETESA+
Sbjct: 216 EAKESFGKKVEDFKEKTVVGKTMKTVKMKLWDESENPLIVTLRKISNKISGFFDETESAK 275

Query: 260 VFAQFKLLDPTFNTEEFTKHLREYIIPEVLEAYVKGDEQVLKQWFSEAPYNVYSAQQKQI 319
           V+ QFKL+D TF  + FT+HLR+YI+PE+LEAY+KGDE+VLK+WFSEAP+NVY+AQQK  
Sbjct: 276 VYTQFKLMDTTFTNDGFTRHLRDYIVPEILEAYIKGDEKVLKKWFSEAPFNVYAAQQKVF 335

Query: 320 RQQELFADGRILDIRGVEIISAKLLPPQDVPAIVVGCRAQEIHLFRKATTGEIAAGHESN 379
           R+Q LF+DGRILDIRGVEI+SAKLL PQD+P +VVGCRAQEI+L++KA +GEIAAG ESN
Sbjct: 336 REQGLFSDGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYKKAKSGEIAAGDESN 395

Query: 380 IMLSSYAMVLTRDPEKVDDKETEGWKILEFVRGGSRSFT 418
           I++SSYAMV TRDPE++DD ETEGWKILEFVRGGSR F 
Sbjct: 396 IVMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRPFN 434

>KAFR0A02640 Chr1 (547285..548550) [1266 bp, 421 aa] {ON} Anc_7.196
           YIL022W
          Length = 421

 Score =  540 bits (1391), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/394 (64%), Positives = 321/394 (81%), Gaps = 2/394 (0%)

Query: 27  TRWAGNGPKSPLQVFRETFKEEWKKSQELQDNIKALQDAGGRLGESDAYKKAREAYLKAQ 86
           +R  G   ++PLQ+FRETFK+EW+KS ELQ +IK LQDA G++ ES+AYKKAR+AYLKA 
Sbjct: 28  SRNLGQQQRTPLQIFRETFKKEWEKSAELQGSIKELQDASGKISESEAYKKARDAYLKAH 87

Query: 87  KGS-TIVGKTLKRTGETLEHITVQAWESEIGKTTRKTVSKTAQKLDESFEPVRQTKVYKD 145
           +GS TI+ KTLK+TG+TLE I  +AWESEI K TR+  S+TA+KLDESFEPVR TK+YKD
Sbjct: 88  RGSSTILDKTLKKTGDTLEDIATKAWESEISKNTRQMASETAKKLDESFEPVRNTKIYKD 147

Query: 146 MSEII-DDGESSRYGGFMXXXXXXXXXXXDLATGKRATPVRSNEEAGSALVATDKEASES 204
           +SE++ DDG+S RYGGF+            L +GKR   V+SN+EAG+ALVAT+ ++ ES
Sbjct: 148 VSEVLNDDGDSYRYGGFIQKDERRLKRENALKSGKRVRAVKSNDEAGTALVATNVQSHES 207

Query: 205 LGKKIQDFKEKTVVGRKLHEIKVRLWDENENPLIGLLRTISNKVGGLFAETESARVFAQF 264
           +G+K ++FKE+T+VG+ LH  KV  WDE+ENPLI LLR I+ K+ G F ETES+RV++QF
Sbjct: 208 IGQKYENFKERTMVGKILHNFKVNYWDESENPLIVLLRKITLKITGFFGETESSRVYSQF 267

Query: 265 KLLDPTFNTEEFTKHLREYIIPEVLEAYVKGDEQVLKQWFSEAPYNVYSAQQKQIRQQEL 324
           KL+D TFN E FT+HLREYI+PE+LEAY+KGDE+VLK WFSEAP+NVYSAQQK  RQQ L
Sbjct: 268 KLIDQTFNAESFTRHLREYIVPEILEAYIKGDEKVLKNWFSEAPFNVYSAQQKVFRQQNL 327

Query: 325 FADGRILDIRGVEIISAKLLPPQDVPAIVVGCRAQEIHLFRKATTGEIAAGHESNIMLSS 384
           F DG ILDIR VEI+SAKLL PQD+P +VV CRAQEI+++RK  TGE+AAG+ S+I++S+
Sbjct: 328 FPDGNILDIRNVEIVSAKLLQPQDIPVLVVSCRAQEINIYRKIKTGEVAAGNASDILMST 387

Query: 385 YAMVLTRDPEKVDDKETEGWKILEFVRGGSRSFT 418
           YAMV TRDPE++D+ ETEGW+ILEFVRG SR FT
Sbjct: 388 YAMVFTRDPEEIDNDETEGWRILEFVRGNSRQFT 421

>TBLA0J01500 Chr10 (342554..343819) [1266 bp, 421 aa] {ON} Anc_7.196
           YIL022W
          Length = 421

 Score =  504 bits (1299), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 231/425 (54%), Positives = 317/425 (74%), Gaps = 11/425 (2%)

Query: 1   MHRYSAVKQAQKSQPQRVLAA--RGFSATRWAGNGPKSPLQVFRETFKEEWKKSQELQDN 58
           M R  ++ Q     P ++L +    +     + +  K+P+Q+FRETFK+EW+KS  LQD 
Sbjct: 1   MLRSRSLIQRNALHPSKLLISSFHSYPVVLQSNDSNKTPIQIFRETFKQEWEKSATLQDQ 60

Query: 59  IKALQDAGGRLGESDAYKKAREAYLKAQKGSTIVGKTLKRTGETLEHITVQAWESEIGKT 118
           IK L DA  R+ +SDA+KKA++AY      +TI+ KT+ +TG  L    ++AW+S++ + 
Sbjct: 61  IKTLTDASDRINQSDAFKKAKDAYKNVSNQTTILSKTISKTGTKLNDAALKAWDSDLAQK 120

Query: 119 TRKTVSKTAQKLDESFEPVRQTKVYKDMSEIIDDGESS-RYGGFMXXXXXXXXXXXDLAT 177
           T+      A+KLD+SFEPVR TK+YKD+SE+IDD ++S +YGGF+           DL T
Sbjct: 121 TKLA----AKKLDDSFEPVRNTKIYKDVSEVIDDKDNSYKYGGFISKEERRSKRISDLQT 176

Query: 178 GKRATPVRSNEEAGSALVATDKEASESLGKKIQDFKEKTVVGRKLHEIKVRLWDENENPL 237
           GKR  P++SN+EAG+AL+ATD ++ ES+ +K+ DFKEKTVVG+ +  IK ++WDEN+NPL
Sbjct: 177 GKRMKPIKSNDEAGTALIATDLKSKESINEKLNDFKEKTVVGQTMTSIKTKVWDENDNPL 236

Query: 238 IGLLRTISNKVGGLFAETESARVFAQFKLLDPTFNTEEFTKHLREYIIPEVLEAYVKGDE 297
           I  +R ++      FAETES+RV  QFKL+DP FN E F + LREYIIPEVLEAY+KGDE
Sbjct: 237 IVGMRKVTGVFNRFFAETESSRVLTQFKLIDPNFNNESFLRSLREYIIPEVLEAYIKGDE 296

Query: 298 QVLKQWFSEAPYNVYSAQQKQIRQQELFADGRILDIRGVEIISAKLLPPQDVPAIVVGCR 357
           ++LK WFSEAPYNVYSAQQK++R+Q++F+DGR+LDIRGV+I++AK+LPPQD+P IVV CR
Sbjct: 297 KILKNWFSEAPYNVYSAQQKELRKQKIFSDGRVLDIRGVDIVTAKMLPPQDIPVIVVSCR 356

Query: 358 AQEIHLFRKAT----TGEIAAGHESNIMLSSYAMVLTRDPEKVDDKETEGWKILEFVRGG 413
           AQEI++++K      T +I AGH+SNI++S+YAMV TRDPE++D+ ETEGWKILEFVRGG
Sbjct: 357 AQEINIYKKFNVEKQTNDIVAGHDSNILMSTYAMVFTRDPEQLDNDETEGWKILEFVRGG 416

Query: 414 SRSFT 418
           SR FT
Sbjct: 417 SRKFT 421

>KAFR0L00170 Chr12 complement(19587..20531) [945 bp, 314 aa] {ON} 
          Length = 314

 Score = 31.2 bits (69), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 20/85 (23%), Positives = 35/85 (41%), Gaps = 1/85 (1%)

Query: 66  GGRLGESDAYKKAREAYLKAQKGSTIVGKTLKRTG-ETLEHITVQAWESEIGKTTRKTVS 124
           GG   +  A    R  YL+      I+G    +TG +  EH+   A   +IG   +K   
Sbjct: 223 GGDYAKPTALANVRAFYLRLNPSIKIIGTGGIKTGKDAFEHLLCGASMLQIGTALQKEGV 282

Query: 125 KTAQKLDESFEPVRQTKVYKDMSEI 149
              ++++   + +   K YK + E 
Sbjct: 283 SIFERIERELKEIMNAKGYKTIEEF 307

>CAGL0K11363g Chr11 complement(1100013..1101257) [1245 bp, 414 aa]
           {ON} similar to uniprot|Q04934 Saccharomyces cerevisiae
           YDR229w IVY1
          Length = 414

 Score = 30.8 bits (68), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 32/69 (46%), Gaps = 8/69 (11%)

Query: 29  WAGNGPKSPLQVFRETFKEEWKKSQELQDNIKALQ--------DAGGRLGESDAYKKARE 80
           WAG G  + LQV  + + ++  +++E QDN  A Q        D GGR   S +    R 
Sbjct: 275 WAGGGLDNLLQVSDDQYNKDTMETEEEQDNPTAAQPTLTKTQSDNGGRASLSPSQTGLRS 334

Query: 81  AYLKAQKGS 89
                Q+GS
Sbjct: 335 PIKAIQEGS 343

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.130    0.366 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 40,688,658
Number of extensions: 1681944
Number of successful extensions: 4468
Number of sequences better than 10.0: 36
Number of HSP's gapped: 4606
Number of HSP's successfully gapped: 36
Length of query: 418
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 306
Effective length of database: 40,638,807
Effective search space: 12435474942
Effective search space used: 12435474942
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 67 (30.4 bits)