Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ADL019W7.125ON52552524640.0
Ecym_83527.125ON57950615170.0
SAKL0F05390g7.125ON59550214540.0
Kwal_55.208327.125ON57546714320.0
KLLA0D14355g7.125ON58851714320.0
KLTH0F12540g7.125ON59545514290.0
TDEL0H028707.125ON58747313820.0
ZYRO0C05192g7.125ON58847813760.0
NCAS0E021307.125ON52646013690.0
Smik_6.4677.125ON54846913480.0
Skud_16.187.125ON55046913450.0
NDAI0E036707.125ON52246813380.0
YPL260W7.125ON55146713231e-178
Suva_16.447.125ON54947013151e-177
CAGL0H09108g7.125ON53245013131e-177
KNAG0L009407.125ON54947712821e-172
Kpol_322.77.125ON53444312341e-165
TBLA0A009307.125ON58646012261e-163
KAFR0L004607.125ON51145012011e-160
TPHA0C016107.125ON55145411871e-157
Kpol_1062.587.125ON4914233531e-35
Suva_9.1437.246ON636128780.62
TPHA0G014108.727ON75052732.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADL019W
         (525 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADL019W Chr4 (675941..677518) [1578 bp, 525 aa] {ON} Syntenic ho...   953   0.0  
Ecym_8352 Chr8 complement(703563..705302) [1740 bp, 579 aa] {ON}...   588   0.0  
SAKL0F05390g Chr6 complement(416314..418101) [1788 bp, 595 aa] {...   564   0.0  
Kwal_55.20832 s55 (577146..578873) [1728 bp, 575 aa] {ON} YPL260...   556   0.0  
KLLA0D14355g Chr4 complement(1219658..1221424) [1767 bp, 588 aa]...   556   0.0  
KLTH0F12540g Chr6 (1050879..1052666) [1788 bp, 595 aa] {ON} simi...   555   0.0  
TDEL0H02870 Chr8 (477363..479126) [1764 bp, 587 aa] {ON} Anc_7.1...   536   0.0  
ZYRO0C05192g Chr3 (405401..407167) [1767 bp, 588 aa] {ON} simila...   534   0.0  
NCAS0E02130 Chr5 (408158..409738) [1581 bp, 526 aa] {ON} Anc_7.1...   531   0.0  
Smik_6.467 Chr6 complement(770217..771863) [1647 bp, 548 aa] {ON...   523   0.0  
Skud_16.18 Chr16 (28372..30024) [1653 bp, 550 aa] {ON} YPL260W (...   522   0.0  
NDAI0E03670 Chr5 (792667..794235) [1569 bp, 522 aa] {ON} Anc_7.1...   520   0.0  
YPL260W Chr16 (49303..50958) [1656 bp, 551 aa] {ON} Putative sub...   514   e-178
Suva_16.44 Chr16 (64828..66477) [1650 bp, 549 aa] {ON} YPL260W (...   511   e-177
CAGL0H09108g Chr8 (889038..890636) [1599 bp, 532 aa] {ON} highly...   510   e-177
KNAG0L00940 Chr12 (172417..174066) [1650 bp, 549 aa] {ON} Anc_7....   498   e-172
Kpol_322.7 s322 (16650..18254) [1605 bp, 534 aa] {ON} (16650..18...   479   e-165
TBLA0A00930 Chr1 (206453..208213) [1761 bp, 586 aa] {ON} Anc_7.1...   476   e-163
KAFR0L00460 Chr12 (84023..85558) [1536 bp, 511 aa] {ON} Anc_7.12...   467   e-160
TPHA0C01610 Chr3 (373462..375117) [1656 bp, 551 aa] {ON} Anc_7.1...   461   e-157
Kpol_1062.58 s1062 complement(129362..129739,129741..130838) [14...   140   1e-35
Suva_9.143 Chr9 (238577..240487) [1911 bp, 636 aa] {ON} YIL056W ...    35   0.62 
TPHA0G01410 Chr7 (286508..288760) [2253 bp, 750 aa] {ON} Anc_8.7...    33   2.5  

>ADL019W Chr4 (675941..677518) [1578 bp, 525 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL260W
          Length = 525

 Score =  953 bits (2464), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/525 (90%), Positives = 473/525 (90%)

Query: 1   MATYQAVLTKVRLLDQVRKQRHGAEDTTGGFTLIHSAALHNRVDSVLDDVFQLLSLSFLT 60
           MATYQAVLTKVRLLDQVRKQRHGAEDTTGGFTLIHSAALHNRVDSVLDDVFQLLSLSFLT
Sbjct: 1   MATYQAVLTKVRLLDQVRKQRHGAEDTTGGFTLIHSAALHNRVDSVLDDVFQLLSLSFLT 60

Query: 61  VGLKNTAPATYASLSTVQRLLEHMEEANVYTYSDLRPIKERLDEIGEIVEKNSYMSMVXX 120
           VGLKNTAPATYASLSTVQRLLEHMEEANVYTYSDLRPIKERLDEIGEIVEKNSYMSMV  
Sbjct: 61  VGLKNTAPATYASLSTVQRLLEHMEEANVYTYSDLRPIKERLDEIGEIVEKNSYMSMVED 120

Query: 121 XXXXXXXXXXKRLNKLEEDLLVRAKLQHCVDSYQKVKSKPATIPPELQPLSDKLFHIRRE 180
                     KRLNKLEEDLLVRAKLQHCVDSYQKVKSKPATIPPELQPLSDKLFHIRRE
Sbjct: 121 EAPLDELAEEKRLNKLEEDLLVRAKLQHCVDSYQKVKSKPATIPPELQPLSDKLFHIRRE 180

Query: 181 LLSLAASAKTDRAAGEGSTERSTTPASPNTLASRLKDLESMILEVESHRDDSGKFISPDD 240
           LLSLAASAKTDRAAGEGSTERSTTPASPNTLASRLKDLESMILEVESHRDDSGKFISPDD
Sbjct: 181 LLSLAASAKTDRAAGEGSTERSTTPASPNTLASRLKDLESMILEVESHRDDSGKFISPDD 240

Query: 241 PDTVPQKGQSALNGLLDDCRNLFGDLSHQTSGVLHLDPQLQPIYEELLEIKTTLENLLVT 300
           PDTVPQKGQSALNGLLDDCRNLFGDLSHQTSGVLHLDPQLQPIYEELLEIKTTLENLLVT
Sbjct: 241 PDTVPQKGQSALNGLLDDCRNLFGDLSHQTSGVLHLDPQLQPIYEELLEIKTTLENLLVT 300

Query: 301 RRWTLRETDLFAYQKRLAELDNLRVNRKXXXXXXXXKGQALILYLLRRCYATIYKXXXXX 360
           RRWTLRETDLFAYQKRLAELDNLRVNRK        KGQALILYLLRRCYATIYK     
Sbjct: 301 RRWTLRETDLFAYQKRLAELDNLRVNRKSPSSSSASKGQALILYLLRRCYATIYKLLESS 360

Query: 361 XXXXXXXQKIHNQLSTVRRCLFELKRMGGVDSERDLYPYQMKLASLDNMRVDGKFYDADG 420
                  QKIHNQLSTVRRCLFELKRMGGVDSERDLYPYQMKLASLDNMRVDGKFYDADG
Sbjct: 361 EPVSESLQKIHNQLSTVRRCLFELKRMGGVDSERDLYPYQMKLASLDNMRVDGKFYDADG 420

Query: 421 NIPEGQGTLNALLAECFDILHEMKIEAEVREEQLPQVNEDDAGEYNSSPCIEMTKDPTDR 480
           NIPEGQGTLNALLAECFDILHEMKIEAEVREEQLPQVNEDDAGEYNSSPCIEMTKDPTDR
Sbjct: 421 NIPEGQGTLNALLAECFDILHEMKIEAEVREEQLPQVNEDDAGEYNSSPCIEMTKDPTDR 480

Query: 481 DVAADTSSTSRYLSVQXXXXXXXXXLSAXXXXXXXXXXXTRNTYD 525
           DVAADTSSTSRYLSVQ         LSA           TRNTYD
Sbjct: 481 DVAADTSSTSRYLSVQAADNDDNDDLSAHYSEHSYEEEETRNTYD 525

>Ecym_8352 Chr8 complement(703563..705302) [1740 bp, 579 aa] {ON}
           similar to Ashbya gossypii ADL019W
          Length = 579

 Score =  588 bits (1517), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/506 (61%), Positives = 371/506 (73%), Gaps = 16/506 (3%)

Query: 1   MATYQAVLTKVRLLDQVRKQRHGAEDTTGG-FTLIHSAALHNRVDSVLDDVFQLLSLSFL 59
           + TYQ VLTKVR LD++RK  H +    G   TLIHS  LHNRVDSV+DDVFQLLSL FL
Sbjct: 46  VMTYQEVLTKVRELDKIRKTTHESSPNLGPETTLIHSVDLHNRVDSVIDDVFQLLSLCFL 105

Query: 60  TVGLKNTAPATYASLSTVQRLLEHMEEANVYTYSDLRPIKERLDEIGEIVEKNSYMSMVX 119
           TVGLKN+APATYASLSTVQ LL+H+ E+NVYT++DL+PIKERLDEI EIVEKNSY ++  
Sbjct: 106 TVGLKNSAPATYASLSTVQSLLDHLNESNVYTHNDLKPIKERLDEISEIVEKNSYWNIPT 165

Query: 120 X----XXXXXXXXXXKRLNKLEEDLLVRAKLQHCVDSYQKVKSKPATIPPELQPLSDKLF 175
                          ++ N +EE+LL+RAKL++C+  Y ++++K   IP +LQP  ++LF
Sbjct: 166 DGGDGNAFADDLEDKRKENNIEENLLLRAKLEYCLKGYNQIEAKLEAIPEDLQPFMERLF 225

Query: 176 HIRRELLSLAASAKTDRAAGEGSTERSTTPA--SPNTLASRLKDLESMILEVESHRDDSG 233
            IRR LLSLAASAK+ R   E   E        S   +  RLK LE+ + +V SHR++SG
Sbjct: 226 QIRRGLLSLAASAKS-RVEQEEQDENDDELCILSHEKINERLKALETELADVRSHRNESG 284

Query: 234 KFISPDDPDTVPQKGQSALNGLLDDCRNLFGDLSHQTSGVLHLDPQLQPIYEELLEIKTT 293
           KF+S +DP+ VP+KGQ  LNGLLDDC +L  DLSHQTS  L LDP +QPIY++L+ IKT 
Sbjct: 285 KFVSVNDPNDVPEKGQFVLNGLLDDCHDLIRDLSHQTSAGLDLDPHIQPIYDDLVSIKTI 344

Query: 294 LENLLVTRRWTLRETDLFAYQKRLAELDNLRVNRKXXXXXXXXKGQALILYLLRRCYATI 353
           LENLLVTRRWTLRETDLF YQK+LAELD+LRVN K        KGQA++LYLLRRCYA I
Sbjct: 345 LENLLVTRRWTLRETDLFTYQKKLAELDSLRVNGKFPSESSDSKGQAILLYLLRRCYAII 404

Query: 354 YKXXXXXXXXXXXXQKIHNQLSTVRRCLFELKRMGGVDSERDLYPYQMKLASLDNMRVDG 413
           YK            ++IHNQLSTVR CL ELKRMGGVD+ER+LYPYQMKLASLDNMRVDG
Sbjct: 405 YKLLESSEPVSESLERIHNQLSTVRHCLLELKRMGGVDNERELYPYQMKLASLDNMRVDG 464

Query: 414 KFYDADGNIPEGQGTLNALLAECFDILHEMKIEAEVREEQLPQVNEDDAGEYN----SSP 469
           KFYD DGNIPEGQGTLNALLAECFDILHEMKIEAEVREE   Q NE  AGE      ++ 
Sbjct: 465 KFYDPDGNIPEGQGTLNALLAECFDILHEMKIEAEVREEA-AQSNE--AGEKPPNNINNQ 521

Query: 470 CIEMTKDPTDRDVAADTSSTSRYLSV 495
            I+MTKD T+RDV A+     RYL V
Sbjct: 522 TIQMTKDGTNRDV-AEVRPNIRYLDV 546

>SAKL0F05390g Chr6 complement(416314..418101) [1788 bp, 595 aa] {ON}
           highly similar to gnl|GLV|CAGL0H09108g Candida glabrata
           CAGL0H09108g and similar to Q08977 YPL260W
           uniprot|Q7LGU3 Saccharomyces cerevisiae Hypothetical ORF
          Length = 595

 Score =  564 bits (1454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/502 (61%), Positives = 359/502 (71%), Gaps = 27/502 (5%)

Query: 1   MATYQAVLTKVRLLDQVRKQRHGAEDTTGGFTLIHSAALHNRVDSVLDDVFQLLSLSFLT 60
           M TYQ VLTKVR LD  RK  H     +   TLIHS  LHNRVDSVLDDVFQLLSLSFLT
Sbjct: 44  METYQQVLTKVRELDDTRKSSHNTP-ASSATTLIHSVDLHNRVDSVLDDVFQLLSLSFLT 102

Query: 61  VGLKNTAPATYASLSTVQRLLEHMEEANVYTYSDLRPIKERLDEIGEIVEKNSYMSMVXX 120
           VGLKN+APATYASLSTVQRLLEH+ E+NV+T+ DLRPIKERLDE+ EIVEKNSY +    
Sbjct: 103 VGLKNSAPATYASLSTVQRLLEHLNESNVFTHHDLRPIKERLDEVSEIVEKNSYRNEPEN 162

Query: 121 XXXX---------------XXXXXXKRLNKLEEDLLVRAKLQHCVDSYQKVKSKPATIPP 165
                                    K  NK+EEDLL+RAKL+HC+  Y  ++SK   I P
Sbjct: 163 NKGKPQEPEAQEDEQDIELKKADIEKDKNKVEEDLLLRAKLKHCLQEYFNIESKLEEIDP 222

Query: 166 ELQPLSDKLFHIRRELLSLAASAKTDRAAGEG-STERSTTPASPNTLASRLKDLESMILE 224
            LQ + +KLF IRR LLSLAAS K +  + E    ++ T   SPN + S+L +L+  + E
Sbjct: 223 ALQSIMEKLFQIRRGLLSLAASTKRNARSKESLEDKKRTHTVSPNFVNSKLNELQVELSE 282

Query: 225 VESHRDDSGKFISPDDPDTVPQKGQSALNGLLDDCRNLFGDLSHQTSGVLHLDPQLQPIY 284
           +ESHRD SGKF S +  D V ++GQS LNGLLDDC +L  DLSHQTS  + LD +LQPIY
Sbjct: 283 LESHRDPSGKFKSLE-TDKVEERGQSVLNGLLDDCHDLINDLSHQTSRGISLDHKLQPIY 341

Query: 285 EELLEIKTTLENLLVTRRWTLRETDLFAYQKRLAELDNLRVNRKXXXXXXXXKGQALILY 344
           + L++IKTTLENLLVTRRWTLRETDLF YQKRL E+DNLRV+ K        KGQ+++LY
Sbjct: 342 DNLIDIKTTLENLLVTRRWTLRETDLFTYQKRLGEIDNLRVHGKFPTESGDSKGQSILLY 401

Query: 345 LLRRCYATIYKXXXXXXXXXXXXQKIHNQLSTVRRCLFELKRMGGVDSERDLYPYQMKLA 404
           LLRRCYA IYK            Q+IHNQLSTVRRCL ELKRMGGV+++R+LYPYQMKLA
Sbjct: 402 LLRRCYAIIYKLLESSEPVSEALQRIHNQLSTVRRCLLELKRMGGVNNDRELYPYQMKLA 461

Query: 405 SLDNMRVDGKFYDADGNIPEGQGTLNALLAECFDILHEMKIEAEVREEQLPQVNEDDAGE 464
           SLDNMRVDGKFYDADGNIPEGQGTLNALLAECFDILHE+KIEAE REE+        +G+
Sbjct: 462 SLDNMRVDGKFYDADGNIPEGQGTLNALLAECFDILHELKIEAEEREEE--------SGD 513

Query: 465 YN-SSPCIEMTKDPTDRDVAAD 485
            N +S  +E+TKDP  RD   D
Sbjct: 514 NNATSDELELTKDPESRDEFED 535

>Kwal_55.20832 s55 (577146..578873) [1728 bp, 575 aa] {ON} YPL260W -
           Hypothetical ORF [contig 138] FULL
          Length = 575

 Score =  556 bits (1432), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/467 (61%), Positives = 344/467 (73%), Gaps = 7/467 (1%)

Query: 1   MATYQAVLTKVRLLDQVRKQRHGAEDTTGGFTLIHSAALHNRVDSVLDDVFQLLSLSFLT 60
           M+ YQ VLTKVR LD++RK+ H A   +   TLIH+  LHNRVDSVLDDVFQLLSLSFLT
Sbjct: 43  MSAYQQVLTKVRELDEIRKRSHSAPRNSAT-TLIHNVELHNRVDSVLDDVFQLLSLSFLT 101

Query: 61  VGLKNTAPATYASLSTVQRLLEHMEEANVYTYSDLRPIKERLDEIGEIVEKNSYMS---- 116
           VGLKN+APATYASLSTVQRLLEH++E+NV+T+ DLRPIKERLDEI EIV ++S+      
Sbjct: 102 VGLKNSAPATYASLSTVQRLLEHLDESNVFTHHDLRPIKERLDEISEIVTQSSFFKEGGE 161

Query: 117 MVXXXXXXXXXXXXKRLNKLEEDLLVRAKLQHCVDSYQKVKSKPATIPPELQPLSDKLFH 176
           +             K  NK+EEDLL+RAKL+HC+  Y  ++SK   I P LQ   +KLF 
Sbjct: 162 INNGSIDFTKISDEKDRNKIEEDLLLRAKLKHCLQEYAHIESKLEEIDPRLQKTMEKLFE 221

Query: 177 IRRELLSLAASAKTDRAAGEGSTERSTTPASPNTLASRLKDLESMILEVESHRDDSGKFI 236
           +RR LLSLAAS K +    +G  +   +P S  ++  +L  LE+ + ++ES R+ SG F+
Sbjct: 222 LRRGLLSLAASTKRNAMLKDGH-KAPESPLSQESVKEKLHSLEAKLTQIESQRNASGYFV 280

Query: 237 SPDDPDTVPQKGQSALNGLLDDCRNLFGDLSHQTSGVLHLDPQLQPIYEELLEIKTTLEN 296
           S D  + V ++GQS LNGLLDDC +L  DLSH  + V+ LD +LQPIY+ L+EIKTTLEN
Sbjct: 281 SADTGEIV-ERGQSVLNGLLDDCHDLINDLSHHANNVVTLDSKLQPIYDNLIEIKTTLEN 339

Query: 297 LLVTRRWTLRETDLFAYQKRLAELDNLRVNRKXXXXXXXXKGQALILYLLRRCYATIYKX 356
           LLVTRRWTLRETDLFAYQKRL+E+D LRV  K        KGQA++LYLLRRCYA IYK 
Sbjct: 340 LLVTRRWTLRETDLFAYQKRLSEIDKLRVGGKFPTESGDAKGQAILLYLLRRCYAIIYKL 399

Query: 357 XXXXXXXXXXXQKIHNQLSTVRRCLFELKRMGGVDSERDLYPYQMKLASLDNMRVDGKFY 416
                      QKIHNQLSTVRRCL ELKRMGGV+++R+LYPYQMKLASLDN+RVDGKFY
Sbjct: 400 LECSEPVSEALQKIHNQLSTVRRCLLELKRMGGVENDRELYPYQMKLASLDNVRVDGKFY 459

Query: 417 DADGNIPEGQGTLNALLAECFDILHEMKIEAEVREEQLPQVNEDDAG 463
           D DGNIPEGQGTLNALLAECFDILHE+KIEAE R+    +  E DAG
Sbjct: 460 DEDGNIPEGQGTLNALLAECFDILHELKIEAEYRDGSGAEDAESDAG 506

>KLLA0D14355g Chr4 complement(1219658..1221424) [1767 bp, 588 aa]
           {ON} similar to uniprot|Q08977 YPL260W Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 588

 Score =  556 bits (1432), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/517 (58%), Positives = 363/517 (70%), Gaps = 34/517 (6%)

Query: 1   MATYQAVLTKVRLLDQVRKQRHGAEDTTGGFTLIHSAALHNRVDSVLDDVFQLLSLSFLT 60
           M TYQ VLTKVR LD++RK  H A  +    TLIHS+ LHNRVDSV+DDVFQLLSLSFLT
Sbjct: 45  MDTYQKVLTKVRELDELRKNSH-ATPSNSATTLIHSSELHNRVDSVIDDVFQLLSLSFLT 103

Query: 61  VGLKNTAPATYASLSTVQRLLEHMEEANVYTYSDLRPIKERLDEIGEIVEKNSYMSMVXX 120
           VGLKN+APATYASLSTVQ LLEH+ E+NVYT+ DLRPIKERL+E+  IVE+N Y+S    
Sbjct: 104 VGLKNSAPATYASLSTVQSLLEHLNESNVYTHHDLRPIKERLNEVSAIVEQNKYVSNSDT 163

Query: 121 XXXXXXXXXXKRL----------NKLEEDLLVRAKLQHCVDSYQKVKSKPATIPPELQPL 170
                                  NK+EEDLL+RAKL+HC+D Y  ++SK   I P+LQ  
Sbjct: 164 QSVNADADDIGEFALQKDEELNKNKIEEDLLLRAKLKHCIDEYNAIESKLEEIHPDLQST 223

Query: 171 SDKLFHIRRELLSLAASAK--------TDRAA----GEGSTERSTTPASPNTLASRLKDL 218
            + LF IRR LLSLA+S K         D A      E S +++  P     +  +LK L
Sbjct: 224 MEALFQIRRGLLSLASSTKRPHQKQLVPDPAVLSVESEASEKKNVLP--DQVIDEKLKQL 281

Query: 219 ESMILEVESHRDDSGKFISPDDPDTVPQKGQSALNGLLDDCRNLFGDLSHQTSGVLHLDP 278
           +  + ++ESHRD +GKF S +  D V +KGQ+ LNGLLDDC +L  DLSHQ  G + LD 
Sbjct: 282 QEQLEKLESHRDINGKFKSLE-TDKVEEKGQNVLNGLLDDCHDLVNDLSHQKDGGISLDT 340

Query: 279 QLQPIYEELLEIKTTLENLLVTRRWTLRETDLFAYQKRLAELDNLRVNRKXXXXXXXXKG 338
           +LQPIY++L++IKTTLENLLVTRRWTLRETDLF YQK+L E+DNLRVN K        KG
Sbjct: 341 KLQPIYDQLVDIKTTLENLLVTRRWTLRETDLFTYQKKLGEIDNLRVNGKFPTDHPDSKG 400

Query: 339 QALILYLLRRCYATIYKXXXXXXXXXXXXQKIHNQLSTVRRCLFELKRMGGVDSERDLYP 398
           Q+++LYLLRRCYA IYK            Q++HNQLSTVRRCL ELKRMGGVD++R+LYP
Sbjct: 401 QSILLYLLRRCYAIIYKLLESSEPVSESLQRVHNQLSTVRRCLLELKRMGGVDNDRELYP 460

Query: 399 YQMKLASLDNMRVDGKFYDADGNIPEGQGTLNALLAECFDILHEMKIEAEVREEQLPQVN 458
           YQMKLASLDNMRVDGKFYD DGNIPEGQGTLNALLAECFDI+HE+KIEAE R E+   ++
Sbjct: 461 YQMKLASLDNMRVDGKFYDTDGNIPEGQGTLNALLAECFDIIHELKIEAEERVEERVDIH 520

Query: 459 EDDAGEYNSSPCIEMTKDPTDRDVAADTSSTSRYLSV 495
           +D  GE      +EMTKDPT RDV      T+RY+ V
Sbjct: 521 DD--GE----ESVEMTKDPTMRDVQE--RPTARYMDV 549

>KLTH0F12540g Chr6 (1050879..1052666) [1788 bp, 595 aa] {ON} similar
           to uniprot|Q08977 YPL260W Saccharomyces cerevisiae
           Hypothetical ORF
          Length = 595

 Score =  555 bits (1429), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/455 (62%), Positives = 338/455 (74%), Gaps = 8/455 (1%)

Query: 1   MATYQAVLTKVRLLDQVRKQRHGAEDTTGGFTLIHSAALHNRVDSVLDDVFQLLSLSFLT 60
           M+TYQ VLTKVR LD +RK  H         TLIH+  LHNRVDSVLDDVFQLLSLSFLT
Sbjct: 43  MSTYQQVLTKVRELDAIRKSSH-HRPANSATTLIHNVELHNRVDSVLDDVFQLLSLSFLT 101

Query: 61  VGLKNTAPATYASLSTVQRLLEHMEEANVYTYSDLRPIKERLDEIGEIVEKNSYM---SM 117
           VGLKN+APATYASLSTVQRLLEH++E+NV+T+ DLRPIKERLDEI EIV ++SY+    +
Sbjct: 102 VGLKNSAPATYASLSTVQRLLEHLDESNVFTHHDLRPIKERLDEISEIVSQSSYLDGTEI 161

Query: 118 VXXXXXXXXXXXXKRLNKLEEDLLVRAKLQHCVDSYQKVKSKPATIPPELQPLSDKLFHI 177
                        K  NK+EEDLL+RAKLQHC+  Y+ ++SK   I P LQ   +KLF +
Sbjct: 162 SDGRIDFAKIQDEKDRNKIEEDLLLRAKLQHCLQEYEHIESKLEEIDPRLQSTMEKLFQL 221

Query: 178 RRELLSLAASAKTDRAAGEG-STERSTTPASPNTLASRLKDLESMILEVESHRDDSGKFI 236
           RR LLSLAAS K +  + +G  T  S  P     +  RL +LE+ + E+ESHRD SGKF+
Sbjct: 222 RRGLLSLAASTKRNAMSKQGVKTPDSLLPQE--GIKQRLHELEAELTEIESHRDSSGKFV 279

Query: 237 SPDDPDTVPQKGQSALNGLLDDCRNLFGDLSHQTSGVLHLDPQLQPIYEELLEIKTTLEN 296
           S +  + +  KGQ+ LNGLLDDC +L  DLSH  +  + LD +LQPIY+ L++IKTTLEN
Sbjct: 280 SLETGE-IAGKGQNVLNGLLDDCHDLINDLSHHANNFVSLDSKLQPIYDNLIDIKTTLEN 338

Query: 297 LLVTRRWTLRETDLFAYQKRLAELDNLRVNRKXXXXXXXXKGQALILYLLRRCYATIYKX 356
           LLVTRRWTLRETDLF+YQKRL+E+D LRV  K        KGQA++LYLLRRCYA IYK 
Sbjct: 339 LLVTRRWTLRETDLFSYQKRLSEIDKLRVGGKFPTENADAKGQAILLYLLRRCYAIIYKL 398

Query: 357 XXXXXXXXXXXQKIHNQLSTVRRCLFELKRMGGVDSERDLYPYQMKLASLDNMRVDGKFY 416
                      QKIHNQLSTVRRCL ELKRMGGV+++R+LYPYQMKLASLDN+RVDGKFY
Sbjct: 399 LECSEPVSEALQKIHNQLSTVRRCLLELKRMGGVENDRELYPYQMKLASLDNVRVDGKFY 458

Query: 417 DADGNIPEGQGTLNALLAECFDILHEMKIEAEVRE 451
           D DGNIPEGQGTLNALLAECFDILHE+KIEAE RE
Sbjct: 459 DEDGNIPEGQGTLNALLAECFDILHELKIEAEERE 493

>TDEL0H02870 Chr8 (477363..479126) [1764 bp, 587 aa] {ON} Anc_7.125
           YPL260W
          Length = 587

 Score =  536 bits (1382), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/473 (59%), Positives = 339/473 (71%), Gaps = 22/473 (4%)

Query: 4   YQAVLTKVRLLDQVRKQRHGAEDTTGGFTLIHSAALHNRVDSVLDDVFQLLSLSFLTVGL 63
           YQ VLTKVR LDQ+RK  H    +    TLIHS  LHNRVDSVLDDVFQLLSL FLTVGL
Sbjct: 56  YQQVLTKVRELDQIRKSNHDTP-SNSATTLIHSTELHNRVDSVLDDVFQLLSLCFLTVGL 114

Query: 64  KNTAPATYASLSTVQRLLEHMEEANVYTYSDLRPIKERLDEIGEIVEKNSYMSMVXXX-- 121
           KN+APATYASLSTVQRLLEH+ E+NV+T  DLRPI+ERL EI +IVE +SY + V     
Sbjct: 115 KNSAPATYASLSTVQRLLEHLNESNVFTQHDLRPIRERLLEISKIVENSSYKNEVSGDNL 174

Query: 122 --------XXXXXXXXXKRLNKLEEDLLVRAKLQHCVDSYQKVKSKPATIPPELQPLSDK 173
                            +  NK+EEDLL+RAKLQHC+D Y   +SK   I P L  + +K
Sbjct: 175 EDIDEKLPEADRKFYEERNKNKIEEDLLLRAKLQHCLDEYHSTESKVEEIDPHLTTIMEK 234

Query: 174 LFHIRRELLSLAASAKTDRAAGEGSTERSTTPASPNTLASRLKDLESMILEVESHRDDSG 233
           LF IRR LLSLAAS+K    + E S      P S   +  +++ LES + E+ESHRD++G
Sbjct: 235 LFEIRRGLLSLAASSKRSNPSLEKS------PLSQEHVHEQVEKLESQLTELESHRDENG 288

Query: 234 KFISPDDPDTVPQKGQSALNGLLDDCRNLFGDLSHQTSGVLHLDPQLQPIYEELLEIKTT 293
           KF S +  D V  KGQ+ LNGLLDDC +L  DLSHQ +G + LD +LQPIYE+L++IKT+
Sbjct: 289 KFKSLE-TDKVEDKGQNVLNGLLDDCHDLISDLSHQKNGGIELDAKLQPIYEQLIDIKTS 347

Query: 294 LENLLVTRRWTLRETDLFAYQKRLAELDNLRVNRKXXXXXXXXKGQALILYLLRRCYATI 353
           LENLLVTRRWTLRETDLF +QK+L+E+D+LRV+ K        KGQ+++LYLLRRC+A I
Sbjct: 348 LENLLVTRRWTLRETDLFTFQKQLSEIDSLRVHGKFPTDSGTSKGQSILLYLLRRCFAII 407

Query: 354 YKXXXXXXXXXXXXQKIHNQLSTVRRCLFELKRMGGVDSERDLYPYQMKLASLDNMRVDG 413
           YK            Q IHNQLSTVRRCL ELKRMGGV+++R+LYPYQMKLASLD++R DG
Sbjct: 408 YKLLESSEPVSESLQPIHNQLSTVRRCLLELKRMGGVNNDRELYPYQMKLASLDDLRTDG 467

Query: 414 KFYDADGNIPEGQGTLNALLAECFDILHEMKIEAEVREE----QLPQVNEDDA 462
           KFYD+DGNIPEGQGTLNALLAECFDI+HE+KIEA+ R E    Q  +  +DD 
Sbjct: 468 KFYDSDGNIPEGQGTLNALLAECFDIVHELKIEAQERAETESAQQSEAEQDDG 520

>ZYRO0C05192g Chr3 (405401..407167) [1767 bp, 588 aa] {ON} similar
           to Q08977 YPL260W uniprot|Q7LGU3 Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 588

 Score =  534 bits (1376), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/478 (58%), Positives = 337/478 (70%), Gaps = 18/478 (3%)

Query: 2   ATYQAVLTKVRLLDQVRKQRHGAEDTTGGFTLIHSAALHNRVDSVLDDVFQLLSLSFLTV 61
           ATY+ VLT+VR LD VRK  H    ++   TLIH+A LHNRVDSVLDDVFQLLSL FLTV
Sbjct: 55  ATYEQVLTRVRELDDVRKSNHETP-SSSATTLIHNAELHNRVDSVLDDVFQLLSLCFLTV 113

Query: 62  GLKNTAPATYASLSTVQRLLEHMEEANVYTYSDLRPIKERLDEIGEIVEKNSYMSMVXXX 121
           GLKN+APA Y+SLSTVQRLLEH+ E+NV+T  DLRPIKERL EI +IVEK+   +     
Sbjct: 114 GLKNSAPAAYSSLSTVQRLLEHLNESNVFTMHDLRPIKERLIEIKKIVEKSCEKNKEAAK 173

Query: 122 XXXX-------------XXXXXKRLNKLEEDLLVRAKLQHCVDSYQKVKSKPATIPPELQ 168
                                  R NK+EEDLL+RAKLQHC+D Y   ++K  T+ P L 
Sbjct: 174 EEEEYLKNAPDLDEADRNLSEETRRNKIEEDLLLRAKLQHCLDEYYSTEAKVETVDPSLS 233

Query: 169 PLSDKLFHIRRELLSLAASAK--TDRAAGEGSTERSTTPASPNTLASRLKDLESMILEVE 226
            + DKLF IRRELLSLAASAK  T  A+ E   E     A P ++ +R++ L+  + E+E
Sbjct: 234 NIMDKLFQIRRELLSLAASAKKTTSSASAEKELENKHVLA-PESVNTRVELLQKELNEIE 292

Query: 227 SHRDDSGKFISPDDPDTVPQKGQSALNGLLDDCRNLFGDLSHQTSGVLHLDPQLQPIYEE 286
           S+RD++GKF SP+   +  +KGQ+ LNGLL DC +L GDLSHQ +G + LDP+LQPIY +
Sbjct: 293 SYRDETGKFKSPESEQSA-EKGQNVLNGLLSDCYDLLGDLSHQKNGGIELDPRLQPIYAK 351

Query: 287 LLEIKTTLENLLVTRRWTLRETDLFAYQKRLAELDNLRVNRKXXXXXXXXKGQALILYLL 346
           L++IKTTLENLL+TRRWTLRETDLF YQK L E+D+LRVN K        KGQ ++LYLL
Sbjct: 352 LIDIKTTLENLLITRRWTLRETDLFTYQKELGEIDSLRVNSKFPTDSGDNKGQTILLYLL 411

Query: 347 RRCYATIYKXXXXXXXXXXXXQKIHNQLSTVRRCLFELKRMGGVDSERDLYPYQMKLASL 406
           RRCYA IYK            Q +HNQLSTVRRCL  L+RMGG+++ R+LYPYQMKLASL
Sbjct: 412 RRCYAIIYKLLESSEPVSESLQPLHNQLSTVRRCLLSLQRMGGINNSRELYPYQMKLASL 471

Query: 407 DNMRVDGKFYDADGNIPEGQGTLNALLAECFDILHEMKIEAEVREEQLPQVNEDDAGE 464
           D +RVDGKFYD DGNIPEGQ TLNALLAECFDI+HEMKIEAE + E   Q   +  G+
Sbjct: 472 DGLRVDGKFYDLDGNIPEGQATLNALLAECFDIIHEMKIEAEEKTESETQSEAEGDGD 529

>NCAS0E02130 Chr5 (408158..409738) [1581 bp, 526 aa] {ON} Anc_7.125
           YPL260W
          Length = 526

 Score =  531 bits (1369), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/460 (59%), Positives = 335/460 (72%), Gaps = 12/460 (2%)

Query: 3   TYQAVLTKVRLLDQVRKQRHGAEDTTGGFTLIHSAALHNRVDSVLDDVFQLLSLSFLTVG 62
           TYQ VLTKVR LD++RK  H    +    TLIHS  LHNRVDSVLDDVFQLLSL FLTVG
Sbjct: 51  TYQNVLTKVRELDEIRKNSHDTP-SKSATTLIHSNELHNRVDSVLDDVFQLLSLCFLTVG 109

Query: 63  LKNTAPATYASLSTVQRLLEHMEEANVYTYSDLRPIKERLDEIGEIVEKNSYMSMVXXXX 122
           LKN+APATYASLSTVQ LLEH+ E+N++T+ DL PIK+RL+EI +IVEK S   +     
Sbjct: 110 LKNSAPATYASLSTVQSLLEHLSESNIFTHHDLSPIKDRLNEISKIVEK-SCGKLPDEQL 168

Query: 123 XXXXXXXXKRL------NKLEEDLLVRAKLQHCVDSYQKVKSKPATIPPELQPLSDKLFH 176
                   K +      NK+E+DLL+RAKLQHC+D Y++++SK   I P L    +KLF 
Sbjct: 169 NDDEEQNLKDIDTERNKNKIEQDLLLRAKLQHCLDEYKQIESKLEEIDPSLTSTMEKLFQ 228

Query: 177 IRRELLSLAASAKTDRAAGEGSTERSTTP---ASPNTLASRLKDLESMILEVESHRDDSG 233
           IRR LLSLAAS K +   G  ++E+        S   +  +L  LE+ +  +E++RD+SG
Sbjct: 229 IRRGLLSLAASTKKNMNQGSLTSEKELENKHLVSQEYVNKKLHALEAEVQALEANRDESG 288

Query: 234 KFISPDDPDTVPQKGQSALNGLLDDCRNLFGDLSHQTSGVLHLDPQLQPIYEELLEIKTT 293
           KF S +  + V + GQ+ LNGLLDDC +L  DLSHQT+G L+LDP LQPIYE L++IKTT
Sbjct: 289 KFKSLE-TNEVAENGQNVLNGLLDDCLDLINDLSHQTNGHLNLDPTLQPIYEMLIDIKTT 347

Query: 294 LENLLVTRRWTLRETDLFAYQKRLAELDNLRVNRKXXXXXXXXKGQALILYLLRRCYATI 353
           LENL++TRRWTLRETDLF YQK+L E+DN+RV  +        KGQ ++LYLLRRCYA I
Sbjct: 348 LENLMITRRWTLRETDLFTYQKQLGEIDNMRVEGRFPTKHIDSKGQFILLYLLRRCYAII 407

Query: 354 YKXXXXXXXXXXXXQKIHNQLSTVRRCLFELKRMGGVDSERDLYPYQMKLASLDNMRVDG 413
           YK            Q IHNQLSTVRRCL ELKRMGGVD++R+LYPYQMKLASLDN+RVDG
Sbjct: 408 YKLLESSEPVSESLQPIHNQLSTVRRCLMELKRMGGVDNDRELYPYQMKLASLDNLRVDG 467

Query: 414 KFYDADGNIPEGQGTLNALLAECFDILHEMKIEAEVREEQ 453
           KFYD++GNIPEGQGTLNALLA CFDI+HE+K+EAE REEQ
Sbjct: 468 KFYDSEGNIPEGQGTLNALLAACFDIMHELKVEAEEREEQ 507

>Smik_6.467 Chr6 complement(770217..771863) [1647 bp, 548 aa] {ON}
           YPL260W (REAL)
          Length = 548

 Score =  523 bits (1348), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/469 (58%), Positives = 329/469 (70%), Gaps = 22/469 (4%)

Query: 2   ATYQAVLTKVRLLDQVRKQRHGAEDTTGGFTLIHSAALHNRVDSVLDDVFQLLSLSFLTV 61
            TYQ VLTKVR LD +RK  H     +   TLIH+  LHNRVDSVLDDVFQLLSL FLTV
Sbjct: 49  TTYQHVLTKVRELDDIRKNSHETPAKSAA-TLIHNTELHNRVDSVLDDVFQLLSLCFLTV 107

Query: 62  GLKNTAPATYASLSTVQRLLEHMEEANVYTYSDLRPIKERLDEIGEIVEKNSYMSMVXXX 121
           GLKN+APATYASLSTV+ LLEH+ E+NV+T+ DL PIKERLDEI +IVE+ +  S     
Sbjct: 108 GLKNSAPATYASLSTVESLLEHLNESNVFTHHDLSPIKERLDEISKIVEQKNSSSTYNED 167

Query: 122 XX---XXXXXXXKRLNKLEEDLLVRAKLQHCVDSYQKVKSKPATIPPELQPLSDKLFHIR 178
                       ++ NK+EEDLL+RAKL+HC D Y  ++SK   I P L  + +KLF IR
Sbjct: 168 GNDDRLREIDNERKKNKIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSSVMEKLFRIR 227

Query: 179 RELLSLAASAKTDRAAGEGST-----ERSTTPASPNTLA------------SRLKDLESM 221
           R LLSL ASAK   +    +      E++ + A+ N L              +L  L+  
Sbjct: 228 RGLLSLVASAKKTMSKSSANINSLLREQNDSQANNNGLMDDKHLVSQEYVHEKLSVLKDE 287

Query: 222 ILEVESHRDDSGKFISPDDPDTVPQKGQSALNGLLDDCRNLFGDLSHQTSGVLHLDPQLQ 281
           + E+ES+RDDSGKF S +    V   GQS LNGLLDDC +L  DLSHQT+G L LDP LQ
Sbjct: 288 LNELESNRDDSGKFKSLE-THQVAVNGQSVLNGLLDDCHDLINDLSHQTNGGLSLDPYLQ 346

Query: 282 PIYEELLEIKTTLENLLVTRRWTLRETDLFAYQKRLAELDNLRVNRKXXXXXXXXKGQAL 341
           PIYE+L++IKTTLENL++TRRWTLRETDLF+YQK+L E+DN R+N K        KGQ++
Sbjct: 347 PIYEQLIDIKTTLENLMITRRWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSI 406

Query: 342 ILYLLRRCYATIYKXXXXXXXXXXXXQKIHNQLSTVRRCLFELKRMGGVDSERDLYPYQM 401
           +LYLLRRCYA IYK            Q IHNQLSTVRRCL ELKRMGGV++ER+LYPYQM
Sbjct: 407 LLYLLRRCYAIIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQM 466

Query: 402 KLASLDNMRVDGKFYDADGNIPEGQGTLNALLAECFDILHEMKIEAEVR 450
           KLASLDN+R DG FYD+DGNIPEGQG LNALLAECFDILHE+K+EAE R
Sbjct: 467 KLASLDNLRTDGIFYDSDGNIPEGQGILNALLAECFDILHELKVEAEER 515

>Skud_16.18 Chr16 (28372..30024) [1653 bp, 550 aa] {ON} YPL260W
           (REAL)
          Length = 550

 Score =  522 bits (1345), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/469 (58%), Positives = 330/469 (70%), Gaps = 22/469 (4%)

Query: 2   ATYQAVLTKVRLLDQVRKQRHGAEDTTGGFTLIHSAALHNRVDSVLDDVFQLLSLSFLTV 61
            TYQ VLTKVR LD +RK  H     +   TLIHS  LHNRVDSVLDDVFQLLSL FLTV
Sbjct: 48  TTYQHVLTKVRELDDIRKNSHDTPAKSAA-TLIHSTELHNRVDSVLDDVFQLLSLCFLTV 106

Query: 62  GLKNTAPATYASLSTVQRLLEHMEEANVYTYSDLRPIKERLDEIGEIVEKNSYMSMVXXX 121
           GLKN+APATYASLSTV+ LLEH+ E+NV+T+ DL PIKERLDEI +IVE+ +   M    
Sbjct: 107 GLKNSAPATYASLSTVESLLEHLNESNVFTHHDLSPIKERLDEISKIVEQKNSSPMYEED 166

Query: 122 XXXX---XXXXXKRLNKLEEDLLVRAKLQHCVDSYQKVKSKPATIPPELQPLSDKLFHIR 178
                       ++ NK+EEDLL+RAKL+HC D Y  ++SK   I P L  + +KLF IR
Sbjct: 167 ANDARIREIDNERKQNKIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFRIR 226

Query: 179 RELLSLAASAKTDRAAGEGST-----ERSTTPASPNTLA------------SRLKDLESM 221
           R LLSL ASAK   +    +      E +   A+ N L              +L  L++ 
Sbjct: 227 RGLLSLVASAKKTMSKSSANINSLLQEHNDLQANDNDLMDDKHLVSQEYVHEKLSVLKNE 286

Query: 222 ILEVESHRDDSGKFISPDDPDTVPQKGQSALNGLLDDCRNLFGDLSHQTSGVLHLDPQLQ 281
           + E+ES+RDDSGKF S +  + V +KGQS LNGLLDDC +L  DLSHQT+G L LDP LQ
Sbjct: 287 LSELESNRDDSGKFKSLETHE-VTEKGQSVLNGLLDDCHDLISDLSHQTNGGLALDPHLQ 345

Query: 282 PIYEELLEIKTTLENLLVTRRWTLRETDLFAYQKRLAELDNLRVNRKXXXXXXXXKGQAL 341
           P YE+L++IKTTLENL++TRRWTLRETDLF+YQK+L E+D+ R+N K        KGQ++
Sbjct: 346 PTYEQLIDIKTTLENLMITRRWTLRETDLFSYQKKLNEIDSKRINGKFPTKSQDSKGQSI 405

Query: 342 ILYLLRRCYATIYKXXXXXXXXXXXXQKIHNQLSTVRRCLFELKRMGGVDSERDLYPYQM 401
           +LYLLRRCYA IYK            Q IHNQLSTVRRCL ELKRMGGV++ER+LYPYQM
Sbjct: 406 LLYLLRRCYAIIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQM 465

Query: 402 KLASLDNMRVDGKFYDADGNIPEGQGTLNALLAECFDILHEMKIEAEVR 450
           KLASLDN+R +G FYD+DGNIPEGQG LNALLAECFDI+HE+K+EAE R
Sbjct: 466 KLASLDNLRTNGIFYDSDGNIPEGQGILNALLAECFDIMHELKVEAEER 514

>NDAI0E03670 Chr5 (792667..794235) [1569 bp, 522 aa] {ON} Anc_7.125
           YPL260W
          Length = 522

 Score =  520 bits (1338), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/468 (57%), Positives = 327/468 (69%), Gaps = 10/468 (2%)

Query: 3   TYQAVLTKVRLLDQVRKQRHGAEDTTGGFTLIHSAALHNRVDSVLDDVFQLLSLSFLTVG 62
           TYQ VLTKVR LD++RK  H A  +    TLIHS  LHNRVDSVLDDVFQLLSL FLTVG
Sbjct: 55  TYQEVLTKVRELDEIRKNNH-ATPSNSATTLIHSMELHNRVDSVLDDVFQLLSLCFLTVG 113

Query: 63  LKNTAPATYASLSTVQRLLEHMEEANVYTYSDLRPIKERLDEIGEIVEKNSYMSMV---- 118
           LKN+APATYASLSTVQ LLEH+ E+N++T+ DL PIKERLD+I +IVE++    +     
Sbjct: 114 LKNSAPATYASLSTVQSLLEHLNESNIFTHHDLGPIKERLDQISKIVEESCSQEIKLDNE 173

Query: 119 ---XXXXXXXXXXXXKRLNKLEEDLLVRAKLQHCVDSYQKVKSKPATIPPELQPLSDKLF 175
                          +  NK+E+DLL+RAKLQHC+D Y +++SK   I P L  + +KLF
Sbjct: 174 GDDQFNQYLDETELEQNQNKIEQDLLLRAKLQHCLDEYHEIESKLEEIDPSLNSILEKLF 233

Query: 176 HIRRELLSLAASAKTDRAAGEGSTERSTTPASPNTLASRLKDLESMILEVESHRDDSGKF 235
            IRR LLSL ASAK +    +   +      SP  L  +L +LE    ++ES+RD+ GKF
Sbjct: 234 QIRRGLLSLVASAKKNSLLSQKELDEKHL-ISPEYLNKKLLELEKEFKDLESNRDEFGKF 292

Query: 236 ISPDDPDTVPQKGQSALNGLLDDCRNLFGDLSHQTSGVLHLDPQLQPIYEELLEIKTTLE 295
            S +  + +P+ GQ+ L GL DDC +L  DLSHQT+G L LDP LQP+YE+L+EIKTTLE
Sbjct: 293 KSLETGE-IPENGQNVLKGLEDDCNDLINDLSHQTNGRLTLDPDLQPVYEQLIEIKTTLE 351

Query: 296 NLLVTRRWTLRETDLFAYQKRLAELDNLRVNRKXXXXXXXXKGQALILYLLRRCYATIYK 355
            L++TRRWTLRETDLF YQK+L E+DNLRV  K        KGQ +ILYLLRRCYA IYK
Sbjct: 352 KLMITRRWTLRETDLFTYQKKLGEIDNLRVKGKFPSKSSDSKGQFIILYLLRRCYAIIYK 411

Query: 356 XXXXXXXXXXXXQKIHNQLSTVRRCLFELKRMGGVDSERDLYPYQMKLASLDNMRVDGKF 415
                       Q IHNQLSTVRRCL ++KR+GGV +ER+LYPYQMKLASLDN+R DG F
Sbjct: 412 LLECSEPVSESLQPIHNQLSTVRRCLLDIKRLGGVSNERELYPYQMKLASLDNLRKDGIF 471

Query: 416 YDADGNIPEGQGTLNALLAECFDILHEMKIEAEVREEQLPQVNEDDAG 463
           YD+DGNIPEGQGTLNALLA CFDI+HEMK+EAE   +     + DD  
Sbjct: 472 YDSDGNIPEGQGTLNALLAACFDIVHEMKVEAEANNKSNDTSDNDDTN 519

>YPL260W Chr16 (49303..50958) [1656 bp, 551 aa] {ON} Putative
           substrate of cAMP-dependent protein kinase (PKA); green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm and nucleus; YPL260W is not an essential
           gene
          Length = 551

 Score =  514 bits (1323), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 273/467 (58%), Positives = 330/467 (70%), Gaps = 22/467 (4%)

Query: 2   ATYQAVLTKVRLLDQVRKQRHGAEDTTGGFTLIHSAALHNRVDSVLDDVFQLLSLSFLTV 61
            TYQ VLTKVR LD +RK  H     +   TLIHS  LHNRVDSVLDDVFQLLSL FLTV
Sbjct: 49  TTYQHVLTKVRELDDIRKNSHETPAKSAA-TLIHSTELHNRVDSVLDDVFQLLSLCFLTV 107

Query: 62  GLKNTAPATYASLSTVQRLLEHMEEANVYTYSDLRPIKERLDEIGEIVE-KNSYMSMVX- 119
           GLKN+APATYASLSTV+ LLEH+ E+NV+T+ DL PIKERL+EI +IVE KNS  +    
Sbjct: 108 GLKNSAPATYASLSTVESLLEHLNESNVFTHHDLSPIKERLEEISKIVEQKNSSPAYDED 167

Query: 120 -XXXXXXXXXXXKRLNKLEEDLLVRAKLQHCVDSYQKVKSKPATIPPELQPLSDKLFHIR 178
                       ++ NK+EEDLL+RAKL+HC D Y  ++ K   I P L  + +KLF IR
Sbjct: 168 GNDDRLREIDNERKKNKIEEDLLLRAKLKHCKDEYDILEGKLEEIDPSLSTVMEKLFRIR 227

Query: 179 RELLSLAASAKTDRAAGEGST-----ERSTTPASPNTLA------------SRLKDLESM 221
           R LLSL ASAK   +  + +T     E++    +  +L              +L  L++ 
Sbjct: 228 RGLLSLVASAKKTMSKSDINTNSLLQEQNDLQTNNESLTDDKHLVSQEYVHEKLSVLKNE 287

Query: 222 ILEVESHRDDSGKFISPDDPDTVPQKGQSALNGLLDDCRNLFGDLSHQTSGVLHLDPQLQ 281
           + E+ES+RDDSGKF S +    V +KGQS LNGLLDDC +L  DLSHQ +G L LDP LQ
Sbjct: 288 LSELESNRDDSGKFKSLE-SHQVAEKGQSVLNGLLDDCHDLVNDLSHQKNGGLTLDPYLQ 346

Query: 282 PIYEELLEIKTTLENLLVTRRWTLRETDLFAYQKRLAELDNLRVNRKXXXXXXXXKGQAL 341
           PIYE+L++IKTTLENL++TRRWTLRETDLF+YQK+L E+DN R+N K        KGQ++
Sbjct: 347 PIYEQLIDIKTTLENLMITRRWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSI 406

Query: 342 ILYLLRRCYATIYKXXXXXXXXXXXXQKIHNQLSTVRRCLFELKRMGGVDSERDLYPYQM 401
           +LYLLRRCYA IYK            Q IHNQLSTVRRCL ELKRMGGV++ER+LYPYQM
Sbjct: 407 LLYLLRRCYAIIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQM 466

Query: 402 KLASLDNMRVDGKFYDADGNIPEGQGTLNALLAECFDILHEMKIEAE 448
           KLASLDN+R +G FYD+DGNIPEGQG LNALLAECFDILHE+K+EAE
Sbjct: 467 KLASLDNLRTEGIFYDSDGNIPEGQGILNALLAECFDILHELKVEAE 513

>Suva_16.44 Chr16 (64828..66477) [1650 bp, 549 aa] {ON} YPL260W
           (REAL)
          Length = 549

 Score =  511 bits (1315), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 269/470 (57%), Positives = 328/470 (69%), Gaps = 25/470 (5%)

Query: 2   ATYQAVLTKVRLLDQVRKQRHGAEDTTGGFTLIHSAALHNRVDSVLDDVFQLLSLSFLTV 61
            TYQ VLTKVR LD +RK  H     +   TLIHS  LHNRVDSVLDDVFQL+SL FLTV
Sbjct: 49  TTYQHVLTKVRELDDIRKNSHDTPAKSAA-TLIHSTELHNRVDSVLDDVFQLISLCFLTV 107

Query: 62  GLKNTAPATYASLSTVQRLLEHMEEANVYTYSDLRPIKERLDEIGEIVEKNSYMSMVX-- 119
           GLKN+APATYASLSTV+ LLEH+ E+NV+T+ DL PIKERL+EI +IVEKN+  +     
Sbjct: 108 GLKNSAPATYASLSTVESLLEHLNESNVFTHHDLSPIKERLEEIRKIVEKNTGPNYDEDG 167

Query: 120 XXXXXXXXXXXKRLNKLEEDLLVRAKLQHCVDSYQKVKSKPATIPPELQPLSDKLFHIRR 179
                      +  N++EEDLL+RAKL+HC D Y  ++SK   I P L  + +KLF IRR
Sbjct: 168 NDDQLREIDNERNKNRIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFKIRR 227

Query: 180 ELLSLAASAKTDRAAGEGSTERSTTPASPNTLAS-------------------RLKDLES 220
            LLSL ASAK  +   + +   S+     N L +                   +L  L++
Sbjct: 228 GLLSLVASAK--KTMSQSNVNISSLLQKHNDLETNNNDLMDDKHLVSQEYVNEKLTALKN 285

Query: 221 MILEVESHRDDSGKFISPDDPDTVPQKGQSALNGLLDDCRNLFGDLSHQTSGVLHLDPQL 280
            + E+ES+RD+SGKF S +    V + GQS LNGLLDDC +L  DLSHQT+G L LDP L
Sbjct: 286 ELNELESNRDESGKFKSLE-SHKVAENGQSVLNGLLDDCHDLVNDLSHQTNGGLTLDPTL 344

Query: 281 QPIYEELLEIKTTLENLLVTRRWTLRETDLFAYQKRLAELDNLRVNRKXXXXXXXXKGQA 340
           QPIYE+L++IKTTLENL++TRRWTLRETDLF+YQK+L E+D+ RV  K        KGQ+
Sbjct: 345 QPIYEQLIDIKTTLENLMITRRWTLRETDLFSYQKKLNEIDSKRVKGKFPTKTQDSKGQS 404

Query: 341 LILYLLRRCYATIYKXXXXXXXXXXXXQKIHNQLSTVRRCLFELKRMGGVDSERDLYPYQ 400
           ++LYLLRRCYA IYK            Q +HNQLSTVRRCL ELKRMGGV++ER+LYPYQ
Sbjct: 405 ILLYLLRRCYAIIYKLLESSEPVSEALQPVHNQLSTVRRCLLELKRMGGVNNERELYPYQ 464

Query: 401 MKLASLDNMRVDGKFYDADGNIPEGQGTLNALLAECFDILHEMKIEAEVR 450
           MKLASLDN+R DG FYD+DGNIPEGQG LNALLAECFDI+HE+K+EAE R
Sbjct: 465 MKLASLDNLRTDGIFYDSDGNIPEGQGILNALLAECFDIMHELKVEAEER 514

>CAGL0H09108g Chr8 (889038..890636) [1599 bp, 532 aa] {ON} highly
           similar to uniprot|Q08977 Saccharomyces cerevisiae
           YPL260w
          Length = 532

 Score =  510 bits (1313), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 261/450 (58%), Positives = 324/450 (72%), Gaps = 6/450 (1%)

Query: 1   MATYQAVLTKVRLLDQVRKQRHGA-EDTTGGFTLIHSAALHNRVDSVLDDVFQLLSLSFL 59
           + TYQ VLT+VR LD +RK         T   TLIH   +HNRVDSVLDDVFQLLSL FL
Sbjct: 52  LNTYQEVLTRVRELDGIRKSSTDVTRRPTCATTLIHDTDMHNRVDSVLDDVFQLLSLCFL 111

Query: 60  TVGLKNTAPATYASLSTVQRLLEHMEEANVYTYSDLRPIKERLDEIGEIVEKNSYMSMVX 119
           TVGLKN+APATYASLSTVQ LLEH+ E+NV+T+ DLRPIKERLDEI +IVEK+       
Sbjct: 112 TVGLKNSAPATYASLSTVQCLLEHLCESNVFTHHDLRPIKERLDEISKIVEKSVESRPED 171

Query: 120 XXXXXXXXXXXKRLNKLEEDLLVRAKLQHCVDSYQKVKSKPATIPPELQPLSDKLFHIRR 179
                      +  N++E+DLL++AKLQHC+D Y K++SK   IPP+L  + ++LF +RR
Sbjct: 172 EVAEFKEIDTERNKNRIEQDLLLKAKLQHCIDEYNKLESKLEEIPPDLSDIMERLFKVRR 231

Query: 180 ELLSLAASAKTD----RAAGEGSTERSTTPASPNTLASRLKDLESMILEVESHRDDSGKF 235
            LLSLAAS+K +            + S    S   L++ L+  +  + ++E+ RD++G+F
Sbjct: 232 GLLSLAASSKKNIPDENYKEPAKLDDSKHVLSQEYLSNSLEKYKKEVAKMEAMRDENGQF 291

Query: 236 ISPDDPDTVPQKGQSALNGLLDDCRNLFGDLSHQTSGVLHLDPQLQPIYEELLEIKTTLE 295
           +S        Q+GQ+ LNGLLDDC +L  DLSHQT+G L LDP LQPIYE+L++IKTTLE
Sbjct: 292 VSKS-TGKAEQRGQNILNGLLDDCNDLINDLSHQTNGGLTLDPYLQPIYEKLIDIKTTLE 350

Query: 296 NLLVTRRWTLRETDLFAYQKRLAELDNLRVNRKXXXXXXXXKGQALILYLLRRCYATIYK 355
           NL++TRRWTLRETDLF YQK+L E+DN+RV+ K        KGQ++ILYLLRRCYA IYK
Sbjct: 351 NLMITRRWTLRETDLFTYQKQLTEIDNMRVHGKFPTKSPDSKGQSIILYLLRRCYAIIYK 410

Query: 356 XXXXXXXXXXXXQKIHNQLSTVRRCLFELKRMGGVDSERDLYPYQMKLASLDNMRVDGKF 415
                       Q +HNQLSTVRRCL ELKRMGGV++ER+LYPYQMKLASLDN+R DGKF
Sbjct: 411 LLESSEPVSESLQPVHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRKDGKF 470

Query: 416 YDADGNIPEGQGTLNALLAECFDILHEMKI 445
           YD+DGNIPEGQG LNALLA CFDILHE+K+
Sbjct: 471 YDSDGNIPEGQGILNALLAGCFDILHELKV 500

>KNAG0L00940 Chr12 (172417..174066) [1650 bp, 549 aa] {ON} Anc_7.125
           YPL260W
          Length = 549

 Score =  498 bits (1282), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 266/477 (55%), Positives = 333/477 (69%), Gaps = 36/477 (7%)

Query: 3   TYQAVLTKVRLLDQVRKQRHGAEDTTGGFTLIHSAALHNRVDSVLDDVFQLLSLSFLTVG 62
           TYQ VLTKVR LD +RK+ H A   T   TLIH+A LHNRVDSVLDDVFQLLSL FLTVG
Sbjct: 52  TYQEVLTKVRELDAIRKKNHDAV-ATNVPTLIHNADLHNRVDSVLDDVFQLLSLCFLTVG 110

Query: 63  LKNTAPATYASLSTVQRLLEHMEEANVYTYSDLRPIKERLDEIGEIVEKN-SYMSMVXXX 121
           LKN+APATYASLSTV+ LL+H+EEA +YT+ DL+PIK+RL+EI +IVE++ +  + +   
Sbjct: 111 LKNSAPATYASLSTVESLLQHLEEAKIYTHHDLKPIKDRLNEISKIVEESCAQTNAIQDA 170

Query: 122 XXXXXXXXXKRL------NKLEEDLLVRAKLQHCVDSYQKVKSKPATIPPELQPLSDKLF 175
                    K +      NKLE++LL++AKL+HCVDSY +V+SK   I P L  + +KLF
Sbjct: 171 LENDEEQAIKDIDAERTRNKLEQNLLLKAKLKHCVDSYNEVESKLEDIDPTLTSVMEKLF 230

Query: 176 HIRRELLSLAASAKT-DRAAGEGSTERSTTPASPNTLASRLKD----------------- 217
            IRR LLSL AS++  D    E   + S+  +S + +A+ L +                 
Sbjct: 231 QIRRGLLSLVASSRNMDSQISEEDLDTSSRTSSQSNIANPLGNELGSEQKKNAISHKLVR 290

Query: 218 -----LESMILEVESHRDDSGKFISPDDPDTVPQKGQSALNGLLDDCRNLFGDLSHQT-- 270
                L + +  +E+HRD+ GKF S +  D V + GQ  LNGLLDDC +L  DLSHQ   
Sbjct: 291 EKFEVLRNDLKNLEAHRDEDGKFKSLE-TDKVAENGQLVLNGLLDDCNDLVSDLSHQIET 349

Query: 271 -SGV-LHLDPQLQPIYEELLEIKTTLENLLVTRRWTLRETDLFAYQKRLAELDNLRVNRK 328
            +G+ L +DP LQP+YE LLEIKTTLENL++TRRWTLRETDLF+YQK+L E+DNLRVN +
Sbjct: 350 GNGLKLSMDPSLQPVYERLLEIKTTLENLMITRRWTLRETDLFSYQKKLNEIDNLRVNGR 409

Query: 329 XXXXXXXXKGQALILYLLRRCYATIYKXXXXXXXXXXXXQKIHNQLSTVRRCLFELKRMG 388
                   +GQ+++LYLLRRCYA IYK            Q IHNQLSTVRRCL ELKRMG
Sbjct: 410 FPTETADSRGQSILLYLLRRCYAIIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMG 469

Query: 389 GVDSERDLYPYQMKLASLDNMRVDGKFYDADGNIPEGQGTLNALLAECFDILHEMKI 445
           GV++ER+LYPYQMKLASLDN+R DG FYD+DGNIPEGQG LNALLA CFDI+HE+K+
Sbjct: 470 GVNNERELYPYQMKLASLDNLRQDGIFYDSDGNIPEGQGILNALLAGCFDIIHELKV 526

>Kpol_322.7 s322 (16650..18254) [1605 bp, 534 aa] {ON}
           (16650..18254) [1605 nt, 535 aa]
          Length = 534

 Score =  479 bits (1234), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 248/443 (55%), Positives = 314/443 (70%), Gaps = 8/443 (1%)

Query: 4   YQAVLTKVRLLDQVRKQRHGAEDTTGGFTLIHSAALHNRVDSVLDDVFQLLSLSFLTVGL 63
           +Q VLTKVR LD +RK R   ED     T+IH+ ALHN+VDS+LDDVFQLLSL FLTVGL
Sbjct: 58  HQEVLTKVRELDDIRK-RQAGEDAVYSKTMIHNEALHNKVDSLLDDVFQLLSLCFLTVGL 116

Query: 64  KNTAPATYASLSTVQRLLEHMEEANVYTYSDLRPIKERLDEIGEIVEKNSYMSMVXXXXX 123
           KN+APATY+SLSTVQ+LLEH++E+N++T  DLRPIK+RLDEI  IVE NSY +       
Sbjct: 117 KNSAPATYSSLSTVQKLLEHLDESNIFTNHDLRPIKDRLDEISTIVENNSYRNYDFDLTN 176

Query: 124 XXXXXXXKR-LNKLEEDLLVRAKLQHCVDSYQKVKSKPATIPPELQPLSDKLFHIRRELL 182
                  KR  NK+EEDLL+RAKL+HC+D Y K+ SK   I PEL  + +KL+HIRR LL
Sbjct: 177 PADETEEKRNKNKIEEDLLLRAKLKHCLDEYNKIHSKLEEISPELSSIMEKLYHIRRSLL 236

Query: 183 SLAASAKTDRAAGEGSTERSTTPASPNTLASRLKDLESMILEVESHRDDSGKFISPDDPD 242
           SLA+ ++      + S   S+  +     +         + E+ESHRD++G F S +  +
Sbjct: 237 SLASPSRKIDTREDFSQFNSSKESQEALSSLE-----QELEELESHRDENGNFKSLETGE 291

Query: 243 TVPQKGQSALNGLLDDCRNLFGDLSHQTSGVLHLDPQLQPIYEELLEIKTTLENLLVTRR 302
            V  KGQ+ L GL+D+C +L  D ++  +G   +DP+L+PIY+EL+ IKT L NL++TRR
Sbjct: 292 VV-LKGQNVLAGLVDNCHDLINDFNNSGNGSDLVDPELEPIYDELINIKTNLANLMITRR 350

Query: 303 WTLRETDLFAYQKRLAELDNLRVNRKXXXXXXXXKGQALILYLLRRCYATIYKXXXXXXX 362
           WTLR+TDLF YQK+L  +DN RVN K        KGQA++LYLLRRCYA IYK       
Sbjct: 351 WTLRDTDLFQYQKKLQAIDNKRVNGKFPTKSGDTKGQAILLYLLRRCYAIIYKLLESSVP 410

Query: 363 XXXXXQKIHNQLSTVRRCLFELKRMGGVDSERDLYPYQMKLASLDNMRVDGKFYDADGNI 422
                Q IHNQLST RRCL  LKRMGGV+SER+LYPYQ+KLASLD +R+DGKF+DA+G I
Sbjct: 411 VSESLQSIHNQLSTARRCLLSLKRMGGVNSERELYPYQLKLASLDELRIDGKFFDANGEI 470

Query: 423 PEGQGTLNALLAECFDILHEMKI 445
           PEGQGTLNALLAECFDI+HE++I
Sbjct: 471 PEGQGTLNALLAECFDIMHELEI 493

>TBLA0A00930 Chr1 (206453..208213) [1761 bp, 586 aa] {ON} Anc_7.125
           YPL260W
          Length = 586

 Score =  476 bits (1226), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 247/460 (53%), Positives = 316/460 (68%), Gaps = 18/460 (3%)

Query: 3   TYQAVLTKVRLLDQVRKQRHGAEDTTGGFTLIHSAALHNRVDSVLDDVFQLLSLSFLTVG 62
           TYQ+VLTKVR LD++RK        T   TLIH + LHNRVDSVLDDVFQLLSL FLTVG
Sbjct: 55  TYQSVLTKVRELDEIRKNSLTTPAKTAT-TLIHDSQLHNRVDSVLDDVFQLLSLCFLTVG 113

Query: 63  LKNTAPATYASLSTVQRLLEHMEEANVYTYSDLRPIKERLDEIGEIVEKNSY-------- 114
           +KN+APATY+SLSTVQ LLEH+ E+ ++T  DLRPIKERLDEI EIVEK+SY        
Sbjct: 114 MKNSAPATYSSLSTVQCLLEHLNESRMFTMHDLRPIKERLDEIQEIVEKSSYRNDEFNDS 173

Query: 115 --MSMVXXXXXXXXXXXXKRLNKLEEDLLVRAKLQHCVDSYQKVKSKPATIPPELQPLSD 172
             + +             +  N++EEDLLVRAKLQ C++ + +++S+   I P L  + D
Sbjct: 174 ALVGLSKQEHELIEIENERTRNRIEEDLLVRAKLQFCIEQFNQMESRLEKINPNLSSIVD 233

Query: 173 KLFHIRRELLSLAASAKTDRAAGE----GSTERSTTPASPNTLASRLKDLESMILEVESH 228
           KL+HIRR LLSLA+      +  +     ST  + +  S   L   L  ++  ++E+ES 
Sbjct: 234 KLYHIRRGLLSLASPTNDTLSKSDNNHIASTNHNVSDKSHKELV--LLKMKKQLVEIESQ 291

Query: 229 RDDSGKFISPDDPDTVPQKGQSALNGLLDDCRNLFGDLSHQTSGVLHLDPQLQPIYEELL 288
           RD++G + S +  + V  +GQ  +N L+DDC +L  DLSH  +G +  DP LQ IY+ L+
Sbjct: 292 RDENGYYKSLE-TNKVEMEGQGIVNKLVDDCNDLINDLSHTQNGNIITDPYLQQIYKNLI 350

Query: 289 EIKTTLENLLVTRRWTLRETDLFAYQKRLAELDNLRVNRKXXXXXXXXKGQALILYLLRR 348
           +IKT L NL+VTRRWTLRETDLF+YQK+LAE+D+LRVN K        KGQ++ILYLLRR
Sbjct: 351 DIKTNLANLMVTRRWTLRETDLFSYQKKLAEIDSLRVNGKFKSATSDAKGQSIILYLLRR 410

Query: 349 CYATIYKXXXXXXXXXXXXQKIHNQLSTVRRCLFELKRMGGVDSERDLYPYQMKLASLDN 408
           CYA IYK            Q IH QLSTVRRCL  LKR+GGV   ++LYPYQMKLASLD 
Sbjct: 411 CYAIIYKLLESSEPISESLQSIHTQLSTVRRCLMTLKRLGGVTDIKELYPYQMKLASLDE 470

Query: 409 MRVDGKFYDADGNIPEGQGTLNALLAECFDILHEMKIEAE 448
           +R+DGKFYDA+G+IPEGQG LNA+LAECFD++HE+K +AE
Sbjct: 471 LRIDGKFYDANGDIPEGQGILNAMLAECFDMVHELKCDAE 510

>KAFR0L00460 Chr12 (84023..85558) [1536 bp, 511 aa] {ON} Anc_7.125
           YPL260W
          Length = 511

 Score =  467 bits (1201), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 240/450 (53%), Positives = 308/450 (68%), Gaps = 23/450 (5%)

Query: 3   TYQAVLTKVRLLDQVRKQRHGAEDTTGGFTLIHSAALHNRVDSVLDDVFQLLSLSFLTVG 62
           TYQ VLTKVR LD++R+Q+HG    T   T +HS  LHNRVD+VLDDVFQLLSL F+T G
Sbjct: 49  TYQRVLTKVRELDEIRRQKHGNSQETEIKTFVHSPELHNRVDNVLDDVFQLLSLCFITCG 108

Query: 63  LKNTAPATYASLSTVQRLLEHMEEANVYTYSDLRPIKERLDEIGEIV----EKNSYM--- 115
           LKN+APATYASLSTVQ LLEH+ E+ +YT+ DL+PIKERLDEI +IV    E N+Y    
Sbjct: 109 LKNSAPATYASLSTVQSLLEHLIESKIYTHHDLKPIKERLDEIAKIVDQNCESNTYQDAS 168

Query: 116 SMVXXXXXXXXXXXXKRLNKLEEDLLVRAKLQHCVDSYQKVKSKPATIPPELQPLSDKLF 175
           ++             +  NK+E++LL++AKL HC+  Y  ++S+   + P    L +KLF
Sbjct: 169 TLDDDDNEVSRIDNERNKNKIEQNLLLQAKLNHCLHEYNYIESQLEEVDPSSNSLVEKLF 228

Query: 176 HIRRELLSLAASAKTDRAAGEGSTERSTTPASPNTLASRLKDLESMILEVESHRDDSGKF 235
            IRR L+SL   +K++    +              +  +LK L+  + E+E++RD  G F
Sbjct: 229 QIRRNLVSLVEISKSNTGVQD-------------QIDKKLKHLQLQLNEIENNRDPDGNF 275

Query: 236 ISPDDPDTVPQKGQSALNGLLDDCRNLFGDLSHQTSGVLHLDPQLQPIYEELLEIKTTLE 295
           +S +  + +  KG + LNGL DDC +L  DL+H T   L  DP LQ +Y+ L+++K +LE
Sbjct: 276 VSIESGNPII-KGSNVLNGLSDDCHDLISDLTHHTKTFL--DPDLQNVYDNLIDVKGSLE 332

Query: 296 NLLVTRRWTLRETDLFAYQKRLAELDNLRVNRKXXXXXXXXKGQALILYLLRRCYATIYK 355
           NL+VTRRWTLRETDLF+Y K+L E+DNLRV+ K        KGQA++LYLLRRCY  IYK
Sbjct: 333 NLMVTRRWTLRETDLFSYLKKLNEIDNLRVDGKFPTKSGSTKGQAILLYLLRRCYTLIYK 392

Query: 356 XXXXXXXXXXXXQKIHNQLSTVRRCLFELKRMGGVDSERDLYPYQMKLASLDNMRVDGKF 415
                       Q IHNQLSTVRRCL +LKRMGGV++ER+LYPYQMKLASLDN+R DGKF
Sbjct: 393 LLESSEPVSEALQPIHNQLSTVRRCLLDLKRMGGVNNERELYPYQMKLASLDNLRKDGKF 452

Query: 416 YDADGNIPEGQGTLNALLAECFDILHEMKI 445
           YD+ GNIPEGQG LNALLA CFDILHE+KI
Sbjct: 453 YDSKGNIPEGQGILNALLAGCFDILHELKI 482

>TPHA0C01610 Chr3 (373462..375117) [1656 bp, 551 aa] {ON} Anc_7.125
           YPL260W
          Length = 551

 Score =  461 bits (1187), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 245/454 (53%), Positives = 310/454 (68%), Gaps = 16/454 (3%)

Query: 4   YQAVLTKVRLLDQVRKQR---HGAED--TTGGFTLIHSAALHNRVDSVLDDVFQLLSLSF 58
           +Q VLTKVR LD +RK +    G +D  T    TL+ +  LHN+VDS++DDVFQLLSL F
Sbjct: 55  HQEVLTKVRELDDIRKSKLKDDGQDDSQTQQITTLLCNLTLHNKVDSLVDDVFQLLSLCF 114

Query: 59  LTVGLKNTAPATYASLSTVQRLLEHMEEANVYTYSDLRPIKERLDEIGEIVEKNSYMSMV 118
           LTVGLKN+APATY SLSTVQ+LLEH++E+N++T  DLRPIKERLDEI +IV+ NSY +  
Sbjct: 115 LTVGLKNSAPATYTSLSTVQKLLEHLDESNIFTNHDLRPIKERLDEISKIVQNNSYKNYE 174

Query: 119 XXXXXXXXXXXXK---RLNKLEEDLLVRAKLQHCVDSYQKVKSKPATIPPELQPLSDKLF 175
                           + N +EEDLL+RAKL+ C D + ++ SK   I PEL  + +KL+
Sbjct: 175 FNEDEINPNQVDDDEIKQNLIEEDLLLRAKLKFCNDEFARIHSKLEEIDPELNSIMEKLY 234

Query: 176 HIRRELLSLAA-SAKTDRAAGEGSTERSTTPASPNTLASRLKDLESMILEVESHRDDSGK 234
           HIRR LLSLA+ + K D      +TE  +   +       LK L   + E+E+HRD+ G 
Sbjct: 235 HIRRNLLSLASPTHKID------TTENISIFNNNEESRKMLKHLSDELTELETHRDEDGN 288

Query: 235 FISPDDPDTVPQKGQSALNGLLDDCRNLFGDLSHQTSGVLHLDPQLQPIYEELLEIKTTL 294
           F S +  + V  KGQ+AL GL+D+C +L  D ++ +     LD  LQPIY  L+ IKT L
Sbjct: 289 FKSLE-TNEVKLKGQNALAGLVDNCHDLINDFTNSSGDNQILDKNLQPIYNNLINIKTNL 347

Query: 295 ENLLVTRRWTLRETDLFAYQKRLAELDNLRVNRKXXXXXXXXKGQALILYLLRRCYATIY 354
            NL++TRRWTLRETDLF YQKRL E+D+ RVN K        KGQ+++LYLLRRCYA IY
Sbjct: 348 ANLMITRRWTLRETDLFQYQKRLKEIDDQRVNGKFPSESGNTKGQSILLYLLRRCYAIIY 407

Query: 355 KXXXXXXXXXXXXQKIHNQLSTVRRCLFELKRMGGVDSERDLYPYQMKLASLDNMRVDGK 414
           K            Q IHNQLST RRCL  LKRMGGV+S R+LYPYQ+KLASLD +R+DGK
Sbjct: 408 KLLESSEPVSESLQPIHNQLSTTRRCLLALKRMGGVNSPRELYPYQLKLASLDELRIDGK 467

Query: 415 FYDADGNIPEGQGTLNALLAECFDILHEMKIEAE 448
           FYD+ G IPEGQGTLNALLAECFD+LHE++IE+E
Sbjct: 468 FYDSSGEIPEGQGTLNALLAECFDMLHELEIESE 501

>Kpol_1062.58 s1062 complement(129362..129739,129741..130838) [1476
           bp, 491 aa] {ON}
           complement(129362..129739,129741..130838) [1476 nt, 492
           aa]
          Length = 491

 Score =  140 bits (353), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 111/423 (26%), Positives = 200/423 (47%), Gaps = 38/423 (8%)

Query: 69  ATYASLSTVQRLLEHMEEANVYTYSDLRPIKERLDEIGEIVEKNSYM-------SMVXXX 121
           + Y+S+  ++ LL  + ++N++T  DL P+K RLDEI +I+E +  +             
Sbjct: 73  SIYSSIVEIKILLNQLNDSNLFTCYDLSPLKRRLDEIDDILEADYSLLQECEENDNEDNE 132

Query: 122 XXXXXXXXXKRLNKL---EEDLLV--------RAKLQHCVDSYQK--------------- 155
                    + +N++     D+            KLQ C DS  K               
Sbjct: 133 DNEDNDENIQGVNEIGGNSGDIPTPQTSYDYENGKLQKCDDSNLKKYIFQELDDCYKVHN 192

Query: 156 -VKSKPATIPPELQPLSDKLFHIRRELLSLAASAKTDRAAGEGSTERSTTPASPNTLASR 214
            ++ K   I   L  L DK+  +R++LL +  S +      +    +     S +T   +
Sbjct: 193 VIELKTDNIDVNLSSLLDKVLVVRKDLLYIVFS-RVKSVFPQCFVLKDPNHMSNSTFDKK 251

Query: 215 LKDLESMILEVESHRDDSGKFISPDDPDTVPQKGQSALNGLLDDCRNLFGDLSHQTSGVL 274
           L +++  +  ++    +  +  S  + +     GQ  LNGL+D C+ +  D+       +
Sbjct: 252 LNEIQRNLDVIKEKNTEYDEGQSQRNKNEGNINGQRILNGLVDYCQEVIHDVKLLAIDKI 311

Query: 275 HLDPQLQPIYEELLEIKTTLENLLVTRRWTLRETDLFAYQKRLAELDNLRVNRKXXXXXX 334
             D +   ++E+ L +K  LE +LVT R +L+  DLF   K L++L+   +  +      
Sbjct: 312 D-DEKKANLFEKSLLLKIKLETILVTNRHSLKSLDLFNLHKELSKLEKRTI--RHYNIED 368

Query: 335 XXKGQALILYLLRRCYATIYKXXXXXXXXXXXXQKIHNQLSTVRRCLFELKRMGGVDSER 394
             + +++I++ LRRC+  IYK            + ++NQLST+ R L +LK  GGV+   
Sbjct: 369 SFQAKSIIIFFLRRCHCIIYKILESSEPVPHCLRPLYNQLSTLARYLLKLKIAGGVEKMD 428

Query: 395 DLYPYQMKLASLDNMRVDGKFYDADGNIPEGQGTLNALLAECFDILHEMKIEAEVREEQL 454
           DL P ++KL ++ + R++  F D  GNIP GQ  LNALL EC ++L  ++I+ E R  ++
Sbjct: 429 DLLPVELKLNNIIDRRINENFPDESGNIPGGQRALNALLHECMELLKILEIDFEGRTREI 488

Query: 455 PQV 457
            ++
Sbjct: 489 EKI 491

>Suva_9.143 Chr9 (238577..240487) [1911 bp, 636 aa] {ON} YIL056W
           (REAL)
          Length = 636

 Score = 34.7 bits (78), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 56/128 (43%), Gaps = 15/128 (11%)

Query: 165 PELQPLSDKLFHIRRELLSLAASAKTDRAAGEGSTERSTTPASP-------NTLASRLKD 217
           P L PLS+ + HI      LA S  T          + + P  P       NTL++R   
Sbjct: 369 PTLYPLSEIIHHIVMVQYPLANSCATAPPPSSNKRVKRSPPTVPSDIIMNNNTLSNRATL 428

Query: 218 LESMILEVESHRDDSG-----KFISPDDPDTVPQ--KGQSALNGLLDDCRNLFGDLS-HQ 269
           L ++ ++ +S   D       +F   +   T  Q   G   ++ +L++C+NLF  ++ ++
Sbjct: 429 LTTLPMKPQSANKDVNRRVIIRFNDREQAFTFHQLSNGPPTVSEILENCKNLFNIINKNK 488

Query: 270 TSGVLHLD 277
             G+ H D
Sbjct: 489 NFGIFHND 496

>TPHA0G01410 Chr7 (286508..288760) [2253 bp, 750 aa] {ON} Anc_8.727
           YMR212C
          Length = 750

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 14/52 (26%), Positives = 30/52 (57%)

Query: 193 AAGEGSTERSTTPASPNTLASRLKDLESMILEVESHRDDSGKFISPDDPDTV 244
            +G G  +RS+T     +L SR+ ++  ++ E++S   ++ K   PD+ +T+
Sbjct: 634 TSGNGGVDRSSTIIGTESLKSRVTNITFLLSELKSSTKETNKIQDPDEEETI 685

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.132    0.369 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 47,842,912
Number of extensions: 1959371
Number of successful extensions: 7028
Number of sequences better than 10.0: 52
Number of HSP's gapped: 7078
Number of HSP's successfully gapped: 54
Length of query: 525
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 411
Effective length of database: 40,409,475
Effective search space: 16608294225
Effective search space used: 16608294225
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)