Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ADL018W7.126ON24424411191e-156
Ecym_83517.126ON2242406469e-85
KAFR0K012007.126ON2021535543e-71
SAKL0F05368g7.126ON2312345471e-69
KLLA0D14333g7.126ON2052325381e-68
NDAI0H013107.126ON2612575326e-67
TDEL0H028807.126ON3541485353e-66
YIL010W (DOT5)7.126ON2152425103e-64
Kpol_1062.577.126ON2192265094e-64
Skud_9.1627.126ON2172365077e-64
Suva_9.1947.126ON2152425078e-64
KNAG0G010207.126ON2071494972e-62
Smik_9.1847.126ON2142364982e-62
TBLA0A009407.126ON2881495042e-62
CAGL0C03850g7.126ON2092324921e-61
ZYRO0C05214g7.126ON2701464902e-60
NCAS0F008107.126ON2311484834e-60
Kwal_55.208397.126ON3051724801e-58
TPHA0C043307.126ON2091504294e-52
KLTH0F12562g7.126ON2932314251e-50
Ecym_46877.388ON25274682.8
SAKL0F12320g7.388ON24874664.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADL018W
         (244 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADL018W Chr4 (678193..678927) [735 bp, 244 aa] {ON} Syntenic hom...   435   e-156
Ecym_8351 Chr8 complement(702059..702733) [675 bp, 224 aa] {ON} ...   253   9e-85
KAFR0K01200 Chr11 complement(247261..247869) [609 bp, 202 aa] {O...   218   3e-71
SAKL0F05368g Chr6 complement(415292..415987) [696 bp, 231 aa] {O...   215   1e-69
KLLA0D14333g Chr4 complement(1218148..1218765) [618 bp, 205 aa] ...   211   1e-68
NDAI0H01310 Chr8 (318386..319171) [786 bp, 261 aa] {ON} Anc_7.12...   209   6e-67
TDEL0H02880 Chr8 (479958..481022) [1065 bp, 354 aa] {ON} Anc_7.1...   210   3e-66
YIL010W Chr9 (334882..335529) [648 bp, 215 aa] {ON}  DOT5Nuclear...   201   3e-64
Kpol_1062.57 s1062 complement(128150..128809) [660 bp, 219 aa] {...   200   4e-64
Skud_9.162 Chr9 (304819..305472) [654 bp, 217 aa] {ON} YIL010W (...   199   7e-64
Suva_9.194 Chr9 (323335..323982) [648 bp, 215 aa] {ON} YIL010W (...   199   8e-64
KNAG0G01020 Chr7 complement(217202..217825) [624 bp, 207 aa] {ON...   196   2e-62
Smik_9.184 Chr9 (309471..310115) [645 bp, 214 aa] {ON} YIL010W (...   196   2e-62
TBLA0A00940 Chr1 (209206..210072) [867 bp, 288 aa] {ON} Anc_7.12...   198   2e-62
CAGL0C03850g Chr3 complement(377957..378586) [630 bp, 209 aa] {O...   194   1e-61
ZYRO0C05214g Chr3 (407597..408409) [813 bp, 270 aa] {ON} some si...   193   2e-60
NCAS0F00810 Chr6 (165372..166067) [696 bp, 231 aa] {ON} Anc_7.12...   190   4e-60
Kwal_55.20839 s55 (579138..580055) [918 bp, 305 aa] {ON} YIL010W...   189   1e-58
TPHA0C04330 Chr3 complement(934432..935061) [630 bp, 209 aa] {ON...   169   4e-52
KLTH0F12562g Chr6 (1052954..1053835) [882 bp, 293 aa] {ON} simil...   168   1e-50
Ecym_4687 Chr4 complement(1340392..1341150) [759 bp, 252 aa] {ON...    31   2.8  
SAKL0F12320g Chr6 (963021..963767) [747 bp, 248 aa] {ON} highly ...    30   4.7  

>ADL018W Chr4 (678193..678927) [735 bp, 244 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL010W (DOT5)
          Length = 244

 Score =  435 bits (1119), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 219/244 (89%), Positives = 219/244 (89%)

Query: 1   MATELRRSTRLATRKASDASEYAESKLPLTKRVRKAPKTDAPKKVATDAPKKVVTXXXXX 60
           MATELRRSTRLATRKASDASEYAESKLPLTKRVRKAPKTDAPKKVATDAPKKVVT     
Sbjct: 1   MATELRRSTRLATRKASDASEYAESKLPLTKRVRKAPKTDAPKKVATDAPKKVVTEAPKK 60

Query: 61  XXXXXXXXXTPKKAAAAEASTGPGGELQVGDVLPEITLKNQDQADVKLSDVVKKNKIVVL 120
                    TPKKAAAAEASTGPGGELQVGDVLPEITLKNQDQADVKLSDVVKKNKIVVL
Sbjct: 61  EAGAAKKVETPKKAAAAEASTGPGGELQVGDVLPEITLKNQDQADVKLSDVVKKNKIVVL 120

Query: 121 FAYPKASTPGCTRQACGFRDNYQELQKHAVVFGISADSVXXXXXXXXXXXLPFDLLSDPK 180
           FAYPKASTPGCTRQACGFRDNYQELQKHAVVFGISADSV           LPFDLLSDPK
Sbjct: 121 FAYPKASTPGCTRQACGFRDNYQELQKHAVVFGISADSVKSQKSFQQKQKLPFDLLSDPK 180

Query: 181 RELIGALGARKTAQTGVIRSHWVFVDGKLGSKRIKISPEMSIADGLSEVLLFAKKSLAGN 240
           RELIGALGARKTAQTGVIRSHWVFVDGKLGSKRIKISPEMSIADGLSEVLLFAKKSLAGN
Sbjct: 181 RELIGALGARKTAQTGVIRSHWVFVDGKLGSKRIKISPEMSIADGLSEVLLFAKKSLAGN 240

Query: 241 PGKT 244
           PGKT
Sbjct: 241 PGKT 244

>Ecym_8351 Chr8 complement(702059..702733) [675 bp, 224 aa] {ON}
           similar to Ashbya gossypii ADL018W
          Length = 224

 Score =  253 bits (646), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 132/240 (55%), Positives = 161/240 (67%), Gaps = 20/240 (8%)

Query: 1   MATELRRSTRLATRKASDASEYAESKLPLTKRVRKAPKTDAPKKVATDAPKKVVTXXXXX 60
           MATELRRSTRLATRKA++  E+ E +    K+++ +      KK + +     V      
Sbjct: 1   MATELRRSTRLATRKANEKPEFEEIRFS-QKKIKTSSGVSGVKKKSNNGGSVGVL----- 54

Query: 61  XXXXXXXXXTPKKAAAAEASTGPGG--ELQVGDVLPEITLKNQDQADVKLSDVVKKNKIV 118
                       KA +   S   GG  EL+VGD +PEI LKNQD  +V L DV KKNKIV
Sbjct: 55  ------------KADSVLKSEKVGGPKELEVGDNVPEIALKNQDDKEVNLKDVAKKNKIV 102

Query: 119 VLFAYPKASTPGCTRQACGFRDNYQELQKHAVVFGISADSVXXXXXXXXXXXLPFDLLSD 178
           ++FAYPKA+TPGCTRQACGFRDNY+ELQKHAV+FGIS+DSV           LPFDLLSD
Sbjct: 103 LIFAYPKANTPGCTRQACGFRDNYEELQKHAVIFGISSDSVKSQKAFQSKQHLPFDLLSD 162

Query: 179 PKRELIGALGARKTAQTGVIRSHWVFVDGKLGSKRIKISPEMSIADGLSEVLLFAKKSLA 238
           P RELIG LGA+KTAQ GVIRSHW+F +GKL  KR+K+SPE SI++GL EVL   KK ++
Sbjct: 163 PDRELIGMLGAKKTAQAGVIRSHWIFCNGKLKYKRVKVSPETSISEGLEEVLGLIKKKVS 222

>KAFR0K01200 Chr11 complement(247261..247869) [609 bp, 202 aa] {ON}
           Anc_7.126 YIL010W
          Length = 202

 Score =  218 bits (554), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 119/153 (77%)

Query: 84  GGELQVGDVLPEITLKNQDQADVKLSDVVKKNKIVVLFAYPKASTPGCTRQACGFRDNYQ 143
             ELQ+GD++P+ITL NQD   + L +V K NKI+VLFAYPKASTPGCTRQACGFRDNY 
Sbjct: 48  SSELQIGDIMPDITLMNQDNQKISLQEVAKNNKILVLFAYPKASTPGCTRQACGFRDNYD 107

Query: 144 ELQKHAVVFGISADSVXXXXXXXXXXXLPFDLLSDPKRELIGALGARKTAQTGVIRSHWV 203
           E++KHA VFG+SADSV           LPF+LLSDPKRELIG LGA+KT Q+G+IRSHWV
Sbjct: 108 EIKKHAAVFGLSADSVVSQKRFQEKQNLPFELLSDPKRELIGILGAKKTPQSGIIRSHWV 167

Query: 204 FVDGKLGSKRIKISPEMSIADGLSEVLLFAKKS 236
           F+DGKL  + IK+SPE SI++   EV+  A+K+
Sbjct: 168 FLDGKLRFRNIKVSPERSISESKKEVMELAEKN 200

>SAKL0F05368g Chr6 complement(415292..415987) [696 bp, 231 aa] {ON}
           highly similar to gnl|GLV|KLLA0D14333g Kluyveromyces
           lactis KLLA0D14333g and similar to YIL010W
           uniprot|P40553 Saccharomyces cerevisiae YIL010W DOT5
           Nuclear thiol peroxidase
          Length = 231

 Score =  215 bits (547), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 114/234 (48%), Positives = 144/234 (61%), Gaps = 18/234 (7%)

Query: 4   ELRRSTRLATRKASDASEYAESKLPLTKRVRKAPKTDAPKKVATDAPKKVVTXXXXXXXX 63
           ELRRS RLA  K     E   S  P  K+++ + K  +  K+      +V          
Sbjct: 3   ELRRSNRLAASKKLGKGEKP-SVEPPAKKLKISRKNKSEDKIEDKTEDEV---------- 51

Query: 64  XXXXXXTPKKAAAAEASTGPG---GELQVGDVLPEITLKNQDQADVKLSDVVKKNKIVVL 120
                  P   +  E +  P     EL+VGD +P++ LKNQD  D+ L ++ KKN+IVV 
Sbjct: 52  ----QDKPADKSEDEPTEEPNPASSELEVGDDIPDLILKNQDDKDISLKELAKKNRIVVF 107

Query: 121 FAYPKASTPGCTRQACGFRDNYQELQKHAVVFGISADSVXXXXXXXXXXXLPFDLLSDPK 180
           FAYPKASTPGCTRQ CG+RDNY++L++HA VFG+SAD+            LP+DLLSDPK
Sbjct: 108 FAYPKASTPGCTRQVCGYRDNYEDLKEHAAVFGLSADTTKAQKNFQTKQSLPYDLLSDPK 167

Query: 181 RELIGALGARKTAQTGVIRSHWVFVDGKLGSKRIKISPEMSIADGLSEVLLFAK 234
           RE IG LGA+KT Q+GVIRSHWVF +GKL  KR+KISPE S+ADG  EVL  AK
Sbjct: 168 REFIGLLGAKKTPQSGVIRSHWVFSEGKLRFKRVKISPETSVADGKKEVLELAK 221

>KLLA0D14333g Chr4 complement(1218148..1218765) [618 bp, 205 aa]
           {ON} similar to uniprot|P40553 Saccharomyces cerevisiae
           YIL010W DOT5 Nuclear thiol peroxidase
          Length = 205

 Score =  211 bits (538), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 111/232 (47%), Positives = 139/232 (59%), Gaps = 30/232 (12%)

Query: 3   TELRRSTRLATRKASDASEYAESKLPLTKRVRKAPKTDAPKKVATDAPKKVVTXXXXXXX 62
            ELRRS R++ +K    SE AE   P+  + +   K   P                    
Sbjct: 2   VELRRSNRISAKKEPLDSESAE---PIKVKAKTESKVTKP-------------------- 38

Query: 63  XXXXXXXTPKKAAAAEASTGPGGELQVGDVLPEITLKNQDQADVKLSDVVKKNKIVVLFA 122
                    KK    E S     ELQ+GD +P++TL NQD   + L +V  KNK+VV FA
Sbjct: 39  -------NGKKEVKNEDSANKLAELQIGDDIPDLTLLNQDDEPISLKEVASKNKLVVFFA 91

Query: 123 YPKASTPGCTRQACGFRDNYQELQKHAVVFGISADSVXXXXXXXXXXXLPFDLLSDPKRE 182
           YPKASTPGCTRQACG+RDNY EL++HA VFG+SAD+            LPFDLLSDPKRE
Sbjct: 92  YPKASTPGCTRQACGYRDNYSELKEHAAVFGLSADAPKSQKSFQTKQALPFDLLSDPKRE 151

Query: 183 LIGALGARKTAQTGVIRSHWVFVDGKLGSKRIKISPEMSIADGLSEVLLFAK 234
            IGALGA+KTA +GV+RSHW+F +GKL  KR+++SPE+SI +G  EVL  AK
Sbjct: 152 FIGALGAKKTAVSGVVRSHWIFKNGKLEVKRVQVSPEVSIEEGKKEVLELAK 203

>NDAI0H01310 Chr8 (318386..319171) [786 bp, 261 aa] {ON} Anc_7.126
           YIL010W
          Length = 261

 Score =  209 bits (532), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 110/257 (42%), Positives = 157/257 (61%), Gaps = 22/257 (8%)

Query: 1   MATELRRSTRLATRKAS---DASEYAESKLPL-TKRVRKAPKTD---APKKVATDA---- 49
           M  ELRRS R+   K +   D   + E +  + T++ +K+P      + KKV  +A    
Sbjct: 1   MVMELRRSGRVTAGKRTFDEDTDNHVEKRKKIATQKAKKSPSKKLLVSEKKVIKNAGSIN 60

Query: 50  ---------PKKVVTXXXXXXXXXXXXXXTPKKAAAAEASTGPGG--ELQVGDVLPEITL 98
                    P+ VV                  +   ++ S       EL++GD +P+ITL
Sbjct: 61  GRETKKETKPRSVVEDKVDGIEHEEVKKVKFDEQQVSDKSANNDSIIELEIGDDIPDITL 120

Query: 99  KNQDQADVKLSDVVKKNKIVVLFAYPKASTPGCTRQACGFRDNYQELQKHAVVFGISADS 158
            NQ+  ++ L ++ K NKI+V+FA+P+ASTPGCTRQACGFRDNY EL+K+A+VFG+SAD+
Sbjct: 121 SNQNGKEISLKEIAKTNKIIVIFAFPRASTPGCTRQACGFRDNYDELKKNAIVFGLSADA 180

Query: 159 VXXXXXXXXXXXLPFDLLSDPKRELIGALGARKTAQTGVIRSHWVFVDGKLGSKRIKISP 218
           +           LP+DLLSDPKR+LIG LGA+KT Q+G +RS+W+FV+GKL  KRIK+SP
Sbjct: 181 ISSQKKFEEKQHLPYDLLSDPKRQLIGLLGAKKTPQSGTVRSYWIFVEGKLSIKRIKVSP 240

Query: 219 EMSIADGLSEVLLFAKK 235
           E+S+A+   EV+ FAKK
Sbjct: 241 EISVAESKKEVIEFAKK 257

>TDEL0H02880 Chr8 (479958..481022) [1065 bp, 354 aa] {ON} Anc_7.126
           YIL010W
          Length = 354

 Score =  210 bits (535), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 113/148 (76%)

Query: 86  ELQVGDVLPEITLKNQDQADVKLSDVVKKNKIVVLFAYPKASTPGCTRQACGFRDNYQEL 145
           EL +GD +P++TL+NQD  DV L DV K++KI+++FAYPKASTPGCTRQACG+RDNY EL
Sbjct: 201 ELDIGDEIPDVTLQNQDGKDVSLRDVAKEHKIIIIFAYPKASTPGCTRQACGYRDNYDEL 260

Query: 146 QKHAVVFGISADSVXXXXXXXXXXXLPFDLLSDPKRELIGALGARKTAQTGVIRSHWVFV 205
           ++HA VFG+S D+            LPFDLL DP R LIG LGA+KTAQ+G +RSHWVF 
Sbjct: 261 KEHAAVFGLSGDNASAQKKFQTKQSLPFDLLCDPGRVLIGHLGAKKTAQSGTLRSHWVFF 320

Query: 206 DGKLGSKRIKISPEMSIADGLSEVLLFA 233
           DGKL  KR+K+SPE+SI DG  EVL  A
Sbjct: 321 DGKLKYKRVKVSPEVSIQDGKKEVLELA 348

>YIL010W Chr9 (334882..335529) [648 bp, 215 aa] {ON}  DOT5Nuclear
           thiol peroxidase which functions as an
           alkyl-hydroperoxide reductase during post-diauxic growth
          Length = 215

 Score =  201 bits (510), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 108/242 (44%), Positives = 144/242 (59%), Gaps = 38/242 (15%)

Query: 1   MATELRRSTRLATRKASDASEYAESKL-PLT------KRVRKAPKTDAPKKVATDAPKKV 53
           M   LRRSTR+A  K     E  ESKL P++      K+++  PK +A + V  +A +  
Sbjct: 1   MGEALRRSTRIAISKR--MLEEEESKLAPISTPEVPKKKIKTGPKHNANQAVVQEANR-- 56

Query: 54  VTXXXXXXXXXXXXXXTPKKAAAAEASTGPGGELQVGDVLPEITLKNQDQADVKLSDVVK 113
                                      +    EL++GD +P+++L N+D   + L  + +
Sbjct: 57  ---------------------------SSDVNELEIGDPIPDLSLLNEDNDSISLKKITE 89

Query: 114 KNKIVVLFAYPKASTPGCTRQACGFRDNYQELQKHAVVFGISADSVXXXXXXXXXXXLPF 173
            N++VV F YP+ASTPGCTRQACGFRDNYQEL+K+A VFG+SADSV           LP+
Sbjct: 90  NNRVVVFFVYPRASTPGCTRQACGFRDNYQELKKYAAVFGLSADSVTSQKKFQSKQNLPY 149

Query: 174 DLLSDPKRELIGALGARKTAQTGVIRSHWVFVDGKLGSKRIKISPEMSIADGLSEVLLFA 233
            LLSDPKRE IG LGA+KT  +G IRSH++FVDGKL  KR+KISPE+S+ D   EVL  A
Sbjct: 150 HLLSDPKREFIGLLGAKKTPLSGSIRSHFIFVDGKLKFKRVKISPEVSVNDAKKEVLEVA 209

Query: 234 KK 235
           +K
Sbjct: 210 EK 211

>Kpol_1062.57 s1062 complement(128150..128809) [660 bp, 219 aa] {ON}
           complement(128150..128809) [660 nt, 220 aa]
          Length = 219

 Score =  200 bits (509), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 102/226 (45%), Positives = 134/226 (59%), Gaps = 18/226 (7%)

Query: 5   LRRSTRLATRKASDASEYAESKLPLTKRVRKAPKTDAPKKVATDAPKKVVTXXXXXXXXX 64
           +RRSTR+A  K                  RK    +A + VA+ + ++  +         
Sbjct: 4   VRRSTRIANSK------------------RKLEADEAERDVASKSGEETTSSKKLKKEKD 45

Query: 65  XXXXXTPKKAAAAEASTGPGGELQVGDVLPEITLKNQDQADVKLSDVVKKNKIVVLFAYP 124
                   K + AE       E+++GD +P++ L+NQD   + L  + K N I+V FAYP
Sbjct: 46  VRVTKVDDKESKAENKPSGIKEVEIGDEIPDLELENQDGVKISLRQLAKDNNILVFFAYP 105

Query: 125 KASTPGCTRQACGFRDNYQELQKHAVVFGISADSVXXXXXXXXXXXLPFDLLSDPKRELI 184
           +A TPGCTRQACGFRD Y +L+KHA VFG+SADS            LP+DLLSDPKRE I
Sbjct: 106 RAMTPGCTRQACGFRDTYDDLKKHAAVFGLSADSTHSQKKFQDKYSLPYDLLSDPKREFI 165

Query: 185 GALGARKTAQTGVIRSHWVFVDGKLGSKRIKISPEMSIADGLSEVL 230
           G LGA+KT Q+G+IRSH++FVDGKL  KRIKISPE+S+ DG  EVL
Sbjct: 166 GLLGAKKTPQSGIIRSHFIFVDGKLRFKRIKISPEISVNDGKKEVL 211

>Skud_9.162 Chr9 (304819..305472) [654 bp, 217 aa] {ON} YIL010W
           (REAL)
          Length = 217

 Score =  199 bits (507), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 110/236 (46%), Positives = 144/236 (61%), Gaps = 26/236 (11%)

Query: 1   MATELRRSTRLATRKASDASEYAESKL-PLTKRVRKAPKTDAPKKVATDAPKKVVTXXXX 59
           M   LRRSTR+A  K     E  ESKL P++         + PKK    APK        
Sbjct: 1   MGEALRRSTRIAASKR--LLEDEESKLVPISP-------PEVPKKKVKTAPK-------- 43

Query: 60  XXXXXXXXXXTPKKAAAAEASTGPGGELQVGDVLPEITLKNQDQADVKLSDVVKKNKIVV 119
                     T +   + + S     EL++GD +P+++L ++D   + L ++ K+NKIVV
Sbjct: 44  --------VKTSEPVKSEDDSLSAATELEIGDSIPDLSLLSEDNDPISLKEIAKENKIVV 95

Query: 120 LFAYPKASTPGCTRQACGFRDNYQELQKHAVVFGISADSVXXXXXXXXXXXLPFDLLSDP 179
            F YPKASTPGCTRQACGFRDNY++L+KHA VFG+SAD V           LP+ L+SDP
Sbjct: 96  FFVYPKASTPGCTRQACGFRDNYEDLKKHAAVFGLSADPVTSQKKFQTKQNLPYHLISDP 155

Query: 180 KRELIGALGARKTAQTGVIRSHWVFVDGKLGSKRIKISPEMSIADGLSEVLLFAKK 235
           KRE IG LGA+KT  +G IRSH+VFV+GKL  KRIKISPE+S++D   EVL  A++
Sbjct: 156 KREFIGLLGAKKTPLSGSIRSHFVFVNGKLRFKRIKISPEVSVSDAKKEVLEIAER 211

>Suva_9.194 Chr9 (323335..323982) [648 bp, 215 aa] {ON} YIL010W
           (REAL)
          Length = 215

 Score =  199 bits (507), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 111/242 (45%), Positives = 142/242 (58%), Gaps = 38/242 (15%)

Query: 1   MATELRRSTRLATRKASDASEYAESKL-------PLTKRVRKAPKTDAPKKVATDAPKKV 53
           M   LRRS R+AT K     E   SKL       P  K+++  PK D  + V  +     
Sbjct: 1   MGEALRRSARIATSKR--LLENEGSKLVPVSPPEPAKKKIKTVPKLDIEEPVKRE----- 53

Query: 54  VTXXXXXXXXXXXXXXTPKKAAAAEASTGPGGELQVGDVLPEITLKNQDQADVKLSDVVK 113
                                   + S+    EL+VGD +P+++L N+D   V L ++ K
Sbjct: 54  ------------------------DHSSLGANELKVGDDIPDLSLLNEDNDPVSLKEIAK 89

Query: 114 KNKIVVLFAYPKASTPGCTRQACGFRDNYQELQKHAVVFGISADSVXXXXXXXXXXXLPF 173
           +NKIVV F YPKASTPGCTRQACGFRDNY++L++HA VFG+SADSV           LP+
Sbjct: 90  ENKIVVFFVYPKASTPGCTRQACGFRDNYEDLKEHAAVFGLSADSVISQKKFQTKQKLPY 149

Query: 174 DLLSDPKRELIGALGARKTAQTGVIRSHWVFVDGKLGSKRIKISPEMSIADGLSEVLLFA 233
            LLSDPKRE IG LGA+KT  +G IRSH+VFVDGKL  KR+KISPE+S+ D   EV+  A
Sbjct: 150 HLLSDPKREFIGLLGAKKTPLSGSIRSHFVFVDGKLRFKRVKISPEVSVGDAKKEVMELA 209

Query: 234 KK 235
           +K
Sbjct: 210 EK 211

>KNAG0G01020 Chr7 complement(217202..217825) [624 bp, 207 aa] {ON}
           Anc_7.126 YIL010W
          Length = 207

 Score =  196 bits (497), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 116/149 (77%)

Query: 87  LQVGDVLPEITLKNQDQADVKLSDVVKKNKIVVLFAYPKASTPGCTRQACGFRDNYQELQ 146
           L++GD +P++TL +Q+   V L++V   NKI+V+FAYP+ASTPGCTRQACGFRDNY EL+
Sbjct: 58  LEIGDEIPDLTLVDQEGELVSLTEVASNNKILVIFAYPRASTPGCTRQACGFRDNYAELK 117

Query: 147 KHAVVFGISADSVXXXXXXXXXXXLPFDLLSDPKRELIGALGARKTAQTGVIRSHWVFVD 206
           KHA V+G+SAD+V           LP++LLSDPKRE IG LGA+KT+Q+G+IRS+W+F +
Sbjct: 118 KHAAVYGLSADTVASQKKFQTKQNLPYNLLSDPKREFIGVLGAKKTSQSGIIRSYWIFFN 177

Query: 207 GKLGSKRIKISPEMSIADGLSEVLLFAKK 235
           GKL  K+IK+SPE S+A+  +EVL   K+
Sbjct: 178 GKLRIKKIKVSPEASVAESKAEVLELVKE 206

>Smik_9.184 Chr9 (309471..310115) [645 bp, 214 aa] {ON} YIL010W
           (REAL)
          Length = 214

 Score =  196 bits (498), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 109/236 (46%), Positives = 141/236 (59%), Gaps = 26/236 (11%)

Query: 1   MATELRRSTRLATRKASDASEYAESKL-PLTKRVRKAPKTDAPKKVATDAPKKVVTXXXX 59
           M   LRRSTR+A  K S   E  ESK  P++      P     K+V TD   KV      
Sbjct: 1   MGKALRRSTRIAASKRSLEDE--ESKFDPIS------PPEVLKKRVKTDLKVKV------ 46

Query: 60  XXXXXXXXXXTPKKAAAAEASTGPGGELQVGDVLPEITLKNQDQADVKLSDVVKKNKIVV 119
                       +     + S     EL++GD +P+++L ++D   + L  + ++NKIVV
Sbjct: 47  -----------SETEDQGDNSASTSTELKIGDPIPDLSLLSEDNDSISLKKIAEENKIVV 95

Query: 120 LFAYPKASTPGCTRQACGFRDNYQELQKHAVVFGISADSVXXXXXXXXXXXLPFDLLSDP 179
            F YPKASTPGCTRQACGFRDNY +L+KH+ VFG+S+DSV           LP+ LLSDP
Sbjct: 96  FFVYPKASTPGCTRQACGFRDNYDDLKKHSAVFGLSSDSVTSQKRFQTKQNLPYHLLSDP 155

Query: 180 KRELIGALGARKTAQTGVIRSHWVFVDGKLGSKRIKISPEMSIADGLSEVLLFAKK 235
           KRE IG LGA+KT  +G IRSH+VFVDGKL  KR+KISPE+S+ D   E+L  A+K
Sbjct: 156 KREFIGLLGAKKTPLSGSIRSHFVFVDGKLRFKRVKISPEVSVNDAKKEILELAEK 211

>TBLA0A00940 Chr1 (209206..210072) [867 bp, 288 aa] {ON} Anc_7.126
           YIL010W
          Length = 288

 Score =  198 bits (504), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 114/149 (76%)

Query: 86  ELQVGDVLPEITLKNQDQADVKLSDVVKKNKIVVLFAYPKASTPGCTRQACGFRDNYQEL 145
           EL+VGD +P+  LKNQ+   + L  V+++N+IVV+FAYPKA+TPGCTRQACG RDNY +L
Sbjct: 126 ELEVGDEVPDFELKNQNNETISLKKVMEENRIVVIFAYPKANTPGCTRQACGMRDNYNDL 185

Query: 146 QKHAVVFGISADSVXXXXXXXXXXXLPFDLLSDPKRELIGALGARKTAQTGVIRSHWVFV 205
           +K+AVVFGISADSV           LP+DLLSD  RELIGALG +KT  +G+IRSH++ V
Sbjct: 186 KKYAVVFGISADSVSAQKSFQEKQNLPYDLLSDKNRELIGALGCKKTPTSGIIRSHFIIV 245

Query: 206 DGKLGSKRIKISPEMSIADGLSEVLLFAK 234
           +GKL  KR+KISPE+S++D   EVL  +K
Sbjct: 246 NGKLKFKRVKISPEVSVSDCKKEVLEISK 274

>CAGL0C03850g Chr3 complement(377957..378586) [630 bp, 209 aa] {ON}
           similar to uniprot|P40553 Saccharomyces cerevisiae
           YIL010w DOT5 involved in derepression of telomeric
           silencing
          Length = 209

 Score =  194 bits (492), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 104/232 (44%), Positives = 139/232 (59%), Gaps = 27/232 (11%)

Query: 4   ELRRSTRLATRKASDASEYAESKLPLTKRVRKAPKTDAPKKVATDAPKKVVTXXXXXXXX 63
           ELRRSTRL+ +  ++  +      P+ K+ +   K    +KV T  P K           
Sbjct: 2   ELRRSTRLSAKHGNEVKDEG----PIKKKAKSVLK----EKVNTKEPVK----------- 42

Query: 64  XXXXXXTPKKAAAAEASTGPGGELQVGDVLPEITLKNQDQADVKLSDVVKKNKIVVLFAY 123
                   K     E  +     L+VGD +P+ITL+NQD  DV L  + K+NK++++F Y
Sbjct: 43  --------KPNTKEEKVSSDEAILEVGDDIPDITLQNQDGKDVSLKALAKENKVIIIFLY 94

Query: 124 PKASTPGCTRQACGFRDNYQELQKHAVVFGISADSVXXXXXXXXXXXLPFDLLSDPKREL 183
           PKASTPGCTRQACGFRDN+ +L++H +V G+S D+            LP+DLL DP RE 
Sbjct: 95  PKASTPGCTRQACGFRDNFDDLKEHGLVLGLSHDTPAAQLKFKEKYSLPYDLLCDPTREF 154

Query: 184 IGALGARKTAQTGVIRSHWVFVDGKLGSKRIKISPEMSIADGLSEVLLFAKK 235
           IG LGA+KT  +G IRSH+VF DGKL  KR+KISPE+S+ADG  EVL  AK+
Sbjct: 155 IGMLGAKKTPASGSIRSHFVFADGKLKFKRLKISPEISVADGKKEVLELAKQ 206

>ZYRO0C05214g Chr3 (407597..408409) [813 bp, 270 aa] {ON} some
           similarities with uniprot|P40553 Saccharomyces
           cerevisiae YIL010W DOT5 Nuclear thiol peroxidase
          Length = 270

 Score =  193 bits (490), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 86/146 (58%), Positives = 111/146 (76%)

Query: 90  GDVLPEITLKNQDQADVKLSDVVKKNKIVVLFAYPKASTPGCTRQACGFRDNYQELQKHA 149
           GD +P+I LKNQD  ++ L  V  ++KIVV+F YPKASTPGCTRQACGFRDNY+++++HA
Sbjct: 95  GDPIPDILLKNQDGKEISLKKVSDEHKIVVIFGYPKASTPGCTRQACGFRDNYEDIKEHA 154

Query: 150 VVFGISADSVXXXXXXXXXXXLPFDLLSDPKRELIGALGARKTAQTGVIRSHWVFVDGKL 209
            VFG+SAD+V           LPFDLLSDP+R L+G LGA+K+ ++G+IRSHWVF DG L
Sbjct: 155 AVFGLSADTVNAQKKFQEKQHLPFDLLSDPERHLVGLLGAKKSPESGIIRSHWVFADGVL 214

Query: 210 GSKRIKISPEMSIADGLSEVLLFAKK 235
             KR+KISPE+SI +G  EVL   K+
Sbjct: 215 KHKRVKISPEVSIEEGKKEVLELVKQ 240

>NCAS0F00810 Chr6 (165372..166067) [696 bp, 231 aa] {ON} Anc_7.126
           YIL010W
          Length = 231

 Score =  190 bits (483), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 87/148 (58%), Positives = 112/148 (75%)

Query: 86  ELQVGDVLPEITLKNQDQADVKLSDVVKKNKIVVLFAYPKASTPGCTRQACGFRDNYQEL 145
           ELQ+GD +P+I L +++   V L  VV++NKIVV FA+PKA+TPGCTRQACGFRDNY+EL
Sbjct: 82  ELQIGDDIPDIILPDEEGVSVSLKKVVEENKIVVFFAFPKANTPGCTRQACGFRDNYKEL 141

Query: 146 QKHAVVFGISADSVXXXXXXXXXXXLPFDLLSDPKRELIGALGARKTAQTGVIRSHWVFV 205
           ++HA V+GISAD V           LP+ LLSD KR+ IG LGA+KT Q+GVIRS+++FV
Sbjct: 142 KEHAAVYGISADPVTAQKKFKTKQNLPYSLLSDSKRDFIGLLGAKKTPQSGVIRSYFIFV 201

Query: 206 DGKLGSKRIKISPEMSIADGLSEVLLFA 233
           DGKL  KR+KISPE+S+ +   EV  FA
Sbjct: 202 DGKLKVKRVKISPELSVEEARKEVSAFA 229

>Kwal_55.20839 s55 (579138..580055) [918 bp, 305 aa] {ON} YIL010W
           (DOT5) - involved in telomeric silencing [contig 138]
           FULL
          Length = 305

 Score =  189 bits (480), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 120/172 (69%), Gaps = 1/172 (0%)

Query: 72  KKAAAAEASTGPGGELQVGDVLPEITLKNQDQADVKLSDVVKKNKIVVLFAYPKASTPGC 131
           KK   A++S    GEL+VGD +P++ LKNQD+ +V L  V ++NK+V++F+YPKASTPGC
Sbjct: 32  KKPKTAKSSDSSQGELEVGDEVPDVVLKNQDEEEVSLKKVAQENKVVIIFSYPKASTPGC 91

Query: 132 TRQACGFRDNYQELQKHAVVFGISADSVXXXXXXXXXXXLPFDLLSDPKRELIGALGARK 191
           T QACGFRDNY++L++   VFG+SAD+            LPFDLLSDPKRELIG LGA+K
Sbjct: 92  TTQACGFRDNYEDLKEVGAVFGLSADTPAAQRKFQDAHSLPFDLLSDPKRELIGLLGAKK 151

Query: 192 TAQTGVIRSHWVFVDGKLGSKRIKISPEMSIADGLSEVLLFAKKSLAGNPGK 243
           +  +G  RSHWVF +GKL +KRI +SPE+SI D  +E    AK     N  K
Sbjct: 152 SP-SGTKRSHWVFANGKLINKRIAVSPEVSIRDAKTEAHEAAKGDDEDNEKK 202

>TPHA0C04330 Chr3 complement(934432..935061) [630 bp, 209 aa] {ON}
           Anc_7.126 YIL010W
          Length = 209

 Score =  169 bits (429), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 73/150 (48%), Positives = 111/150 (74%), Gaps = 1/150 (0%)

Query: 86  ELQVGDVLPEITLKNQDQADVKLSDVVKKNKIVVLFAYPKASTPGCTRQACGFRDNYQEL 145
           E+QVGD +P++TL+NQ+  ++ L D+ +KNKI+ +F YP+ASTPGCTRQACGFRDN+ +L
Sbjct: 60  EIQVGDEIPDLTLENQEGEELSLRDLAQKNKIITIFVYPRASTPGCTRQACGFRDNFDDL 119

Query: 146 QKHAVVFGISADSVXXXXXXXXXXXLPFDLLSDPKRELIGALGARKTAQTGVIRSHWVFV 205
           +K++++ G+S DS+           LP+DLL D +++LI  LG +K   +G+IRS+++FV
Sbjct: 120 KKYSLILGLSGDSITAQKHFKTKQNLPYDLLCDTEKKLITILGCKKKP-SGIIRSYFIFV 178

Query: 206 DGKLGSKRIKISPEMSIADGLSEVLLFAKK 235
           DGKL  KR+K+SPE+SI +   E+L   K+
Sbjct: 179 DGKLKLKRVKVSPEVSITESKKEILDLVKE 208

>KLTH0F12562g Chr6 (1052954..1053835) [882 bp, 293 aa] {ON} similar
           to uniprot|P40553 Saccharomyces cerevisiae YIL010W DOT5
           Nuclear thiol peroxidase
          Length = 293

 Score =  168 bits (425), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 105/231 (45%), Positives = 143/231 (61%), Gaps = 43/231 (18%)

Query: 4   ELRRSTRLATRKASDASEYAESKLPLTKRVRKAPKTDAPKKVATDAPKKVVTXXXXXXXX 63
           ELRRSTR   +K+SDA              ++AP+    ++VA +AP+            
Sbjct: 3   ELRRSTR---KKSSDAP-------------KRAPEE---EEVAPNAPET----------- 32

Query: 64  XXXXXXTPKKAAAAEASTGPGGELQVGDVLPEITLKNQDQADVKLSDVVKKNKIVVLFAY 123
                   KKA     + G  GEL+ GD +P++ LKNQ+  +V L  VV++NK+VV+FAY
Sbjct: 33  --------KKAK----TNGSKGELEEGDEVPDVVLKNQEGEEVSLKSVVQQNKVVVVFAY 80

Query: 124 PKASTPGCTRQACGFRDNYQELQKHAVVFGISADSVXXXXXXXXXXXLPFDLLSDPKREL 183
           PKASTPGCT+QACGFRDNY+EL+K+A VFG+S D+            LPFDLLSDP+R+L
Sbjct: 81  PKASTPGCTKQACGFRDNYEELKKNAAVFGLSTDTPNAQQKFKEKNSLPFDLLSDPQRKL 140

Query: 184 IGALGARKTAQTGVIRSHWVFVDGKLGSKRIKISPEMSIADGLSEVLLFAK 234
           IG LGA K+  +G  RS+WVFV GKL +KRI +SPE S+++   E +  A+
Sbjct: 141 IGPLGASKSP-SGTKRSYWVFVQGKLRTKRISVSPEASVSEAKKEAIEAAQ 190

>Ecym_4687 Chr4 complement(1340392..1341150) [759 bp, 252 aa] {ON}
           similar to Ashbya gossypii AGR368W
          Length = 252

 Score = 30.8 bits (68), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 35/74 (47%), Gaps = 3/74 (4%)

Query: 87  LQVGDVLPEITLKNQDQADVKLSDVVKKNKIVVLFAYPKASTPGCTRQACGFRDNYQELQ 146
           L+V  V P  T +  D   + L +    N   +LF++P   TP CT +   F     E +
Sbjct: 40  LRVNSVAPNFTAETTD-GKLNLYEYFG-NSWGILFSHPADFTPVCTTELGAFAKLKPEFE 97

Query: 147 KHAV-VFGISADSV 159
           K  V + G+SA+ V
Sbjct: 98  KRDVKLIGLSAEGV 111

>SAKL0F12320g Chr6 (963021..963767) [747 bp, 248 aa] {ON} highly
           similar to gnl|GLV|KLLA0E20383g Kluyveromyces lactis
           KLLA0E20383g and similar to YBL064C uniprot|P34227
           Saccharomyces cerevisiae YBL064C PRX1 Mitochondrial
           peroxiredoxin (1-Cys Prx) with thioredoxin peroxidase
           activity has a role in reduction of hydroperoxides
           induced during respiratory growth and under conditions
           of oxidative stress
          Length = 248

 Score = 30.0 bits (66), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 34/74 (45%), Gaps = 3/74 (4%)

Query: 87  LQVGDVLPEITLKNQDQADVKLSDVVKKNKIVVLFAYPKASTPGCTRQACGFRDNYQELQ 146
           L++  + P  T  N  Q  +   + +  +   VLF++P   TP CT +   F     E  
Sbjct: 37  LRINSLAPNFT-ANTTQGKIDFHEYIG-DSWTVLFSHPADFTPVCTTELGAFAKLKPEFD 94

Query: 147 KHAV-VFGISADSV 159
           K  V + G+SA+ V
Sbjct: 95  KRNVKLIGLSAEGV 108

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.129    0.359 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 20,341,893
Number of extensions: 681191
Number of successful extensions: 1375
Number of sequences better than 10.0: 23
Number of HSP's gapped: 1374
Number of HSP's successfully gapped: 24
Length of query: 244
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 137
Effective length of database: 41,212,137
Effective search space: 5646062769
Effective search space used: 5646062769
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 64 (29.3 bits)