Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ADL017C7.127ON44344323110.0
Ecym_83507.127ON44544520790.0
SAKL0F05346g7.127ON44744620110.0
KLTH0F12584g7.127ON44144219290.0
Kwal_55.208437.127ON44144219190.0
KLLA0D14311g7.127ON44344318850.0
TBLA0A009507.127ON46946718380.0
TDEL0H028907.127ON44244318340.0
ZYRO0C05236g7.127ON44744518110.0
YPL259C (APM1)7.127ON47547418120.0
Suva_16.457.127ON47847717950.0
KNAG0L009507.127ON46146017860.0
NCAS0E021407.127ON48144917830.0
Kpol_1062.567.127ON45045017760.0
Smik_6.4667.127ON47647517770.0
TPHA0C043207.127ON45445217670.0
Skud_16.197.127ON47647517680.0
NDAI0E036807.127ON44444417640.0
KAFR0L004707.127ON46546817360.0
CAGL0K00539g7.127ON45645517000.0
Ecym_52393.165ON4644755875e-70
KLLA0C03894g3.165ON4754835405e-63
KLTH0F06534g3.165ON4664815292e-61
SAKL0D13090g2.555ON4995195293e-61
SAKL0C07414g3.165ON4824975206e-60
NCAS0C035803.165ON4914985136e-59
Kwal_33.141823.165ON4674785101e-58
CAGL0C05203g3.165ON4754885073e-58
NDAI0G029203.165ON4864985032e-57
YOL062C (APM4)3.165ON4915024981e-56
ADR315W3.165ON4924314971e-56
Suva_15.1033.165ON4915054911e-55
Kpol_1045.443.165ON4694814803e-54
Smik_15.963.165ON4915024813e-54
ABR047W2.555ON4984654771e-53
TDEL0D045803.165ON4824894752e-53
TBLA0F008403.165ON4814874742e-53
Kwal_26.81462.555ON5055304753e-53
KLTH0D07502g2.555ON5045374743e-53
ZYRO0B04840g3.165ON4764904715e-53
Skud_15.913.165ON4915024691e-52
Ecym_45912.555ON5015274403e-48
KLLA0F25432g2.555ON5074824333e-47
TPHA0P006603.165ON4734854289e-47
TDEL0B064302.555ON5255484248e-46
TPHA0I023902.555ON5595694048e-43
Kpol_1056.132.555ON5415633932e-41
KNAG0K011503.165ON4744893657e-38
ZYRO0E05874g2.555ON5493373511e-35
KAFR0A020602.555ON5403403441e-34
KAFR0C010203.165ON4284663321e-33
CAGL0K03223g2.555ON5983713372e-33
NCAS0A126502.555ON5883563186e-31
KNAG0C055502.555ON5823562931e-27
Skud_8.262.555ON5963522931e-27
Smik_8.232.555ON6033512885e-27
YHL019C (APM2)2.555ON6053552815e-26
Suva_8.332.555ON5963702805e-26
TBLA0B067602.555ON6572722424e-21
NDAI0B016102.555ON6722572168e-18
AGL061W2.522ON4112261748e-13
SAKL0A09218g2.522ON4732671731e-12
KLTH0D06556g2.522ON4563721562e-10
TPHA0C041302.522ON5331871552e-10
KAFR0D035602.522ON4553741525e-10
TDEL0A029702.522ON4963151516e-10
KLLA0E18789g2.522ON4971521364e-08
Kwal_26.79572.522ON4561291331e-07
TBLA0I006202.522ON6091531277e-07
ZYRO0B01738g2.522ON4922381232e-06
Kpol_1018.422.522ON5751881161e-05
NCAS0A048702.522ON4894751043e-04
Suva_4.5482.522ON4841321027e-04
Ecym_72662.522ON5172611027e-04
Skud_2.4192.522ON484131970.003
YBR288C (APM3)2.522ON483140930.007
Smik_2.4302.522ON484128900.016
CAGL0L02145g2.522ON54397880.029
TBLA0E001403.575ON543135820.17
KLLA0D11396g3.575ON536140820.18
KLTH0H11770g1.388ON156136770.27
Ecym_60073.575ON537140790.37
ZYRO0E09746g3.575ON538132790.41
Smik_15.524singletonON5045670.80
NDAI0K019302.522ON612152760.96
Suva_8.4187.22ON72663751.4
Smik_7.3713.575ON598115741.7
KNAG0A069702.522ON50598731.8
KNAG0D030003.575ON563134731.8
NCAS0G034001.505ON16255683.7
KLLA0B06545g1.505ON14856683.7
Kwal_27.100201.505ON14755683.9
Kpol_507.73.575ON533131714.0
NDAI0G052101.388ON15659674.5
ZYRO0C18524gsingletonON554120696.7
YKL215C (OXP1)na 1ON128698697.7
TDEL0D064303.575ON53685688.0
Skud_6.1423.575ON546115688.1
TPHA0G037003.575ON53986689.2
TDEL0G046406.7ON101773689.5
YFR051C (RET2)3.575ON546115679.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ADL017C
         (443 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ADL017C Chr4 complement(679085..680416) [1332 bp, 443 aa] {ON} S...   894   0.0  
Ecym_8350 Chr8 (700421..701758) [1338 bp, 445 aa] {ON} similar t...   805   0.0  
SAKL0F05346g Chr6 (413830..415173) [1344 bp, 447 aa] {ON} highly...   779   0.0  
KLTH0F12584g Chr6 complement(1053944..1055269) [1326 bp, 441 aa]...   747   0.0  
Kwal_55.20843 s55 complement(580157..581482) [1326 bp, 441 aa] {...   743   0.0  
KLLA0D14311g Chr4 (1216574..1217905) [1332 bp, 443 aa] {ON} simi...   730   0.0  
TBLA0A00950 Chr1 complement(210799..212208) [1410 bp, 469 aa] {O...   712   0.0  
TDEL0H02890 Chr8 complement(481125..482453) [1329 bp, 442 aa] {O...   711   0.0  
ZYRO0C05236g Chr3 complement(408616..409959) [1344 bp, 447 aa] {...   702   0.0  
YPL259C Chr16 complement(51244..52671) [1428 bp, 475 aa] {ON}  A...   702   0.0  
Suva_16.45 Chr16 complement(66786..68222) [1437 bp, 478 aa] {ON}...   696   0.0  
KNAG0L00950 Chr12 complement(174410..175795) [1386 bp, 461 aa] {...   692   0.0  
NCAS0E02140 Chr5 complement(410049..411494) [1446 bp, 481 aa] {O...   691   0.0  
Kpol_1062.56 s1062 (126558..127910) [1353 bp, 450 aa] {ON} (1265...   688   0.0  
Smik_6.466 Chr6 (768507..769937) [1431 bp, 476 aa] {ON} YPL259C ...   689   0.0  
TPHA0C04320 Chr3 (932871..934235) [1365 bp, 454 aa] {ON} Anc_7.1...   685   0.0  
Skud_16.19 Chr16 complement(30298..31728) [1431 bp, 476 aa] {ON}...   685   0.0  
NDAI0E03680 Chr5 complement(794613..795947) [1335 bp, 444 aa] {O...   684   0.0  
KAFR0L00470 Chr12 complement(85772..87169) [1398 bp, 465 aa] {ON...   673   0.0  
CAGL0K00539g Chr11 complement(64028..65398) [1371 bp, 456 aa] {O...   659   0.0  
Ecym_5239 Chr5 complement(492091..493485) [1395 bp, 464 aa] {ON}...   230   5e-70
KLLA0C03894g Chr3 complement(354889..356316) [1428 bp, 475 aa] {...   212   5e-63
KLTH0F06534g Chr6 complement(565211..566611) [1401 bp, 466 aa] {...   208   2e-61
SAKL0D13090g Chr4 (1093315..1094814) [1500 bp, 499 aa] {ON} weak...   208   3e-61
SAKL0C07414g Chr3 complement(683859..685307) [1449 bp, 482 aa] {...   204   6e-60
NCAS0C03580 Chr3 complement(715761..717236) [1476 bp, 491 aa] {O...   202   6e-59
Kwal_33.14182 s33 complement(560456..561859) [1404 bp, 467 aa] {...   201   1e-58
CAGL0C05203g Chr3 (496561..497988) [1428 bp, 475 aa] {ON} highly...   199   3e-58
NDAI0G02920 Chr7 complement(676413..677873) [1461 bp, 486 aa] {O...   198   2e-57
YOL062C Chr15 complement(210520..211995) [1476 bp, 491 aa] {ON} ...   196   1e-56
ADR315W Chr4 (1259839..1261317) [1479 bp, 492 aa] {ON} Syntenic ...   196   1e-56
Suva_15.103 Chr15 complement(183026..184501) [1476 bp, 491 aa] {...   193   1e-55
Kpol_1045.44 s1045 complement(103089..104498) [1410 bp, 469 aa] ...   189   3e-54
Smik_15.96 Chr15 complement(174750..176225) [1476 bp, 491 aa] {O...   189   3e-54
ABR047W Chr2 (479283..480779) [1497 bp, 498 aa] {ON} Syntenic ho...   188   1e-53
TDEL0D04580 Chr4 (840369..841817) [1449 bp, 482 aa] {ON} Anc_3.1...   187   2e-53
TBLA0F00840 Chr6 (213915..215360) [1446 bp, 481 aa] {ON} Anc_3.1...   187   2e-53
Kwal_26.8146 s26 (665689..667206) [1518 bp, 505 aa] {ON} YHL019C...   187   3e-53
KLTH0D07502g Chr4 (650799..652313) [1515 bp, 504 aa] {ON} simila...   187   3e-53
ZYRO0B04840g Chr2 (389669..391099) [1431 bp, 476 aa] {ON} highly...   186   5e-53
Skud_15.91 Chr15 complement(169608..171083) [1476 bp, 491 aa] {O...   185   1e-52
Ecym_4591 Chr4 complement(1154444..1155949) [1506 bp, 501 aa] {O...   174   3e-48
KLLA0F25432g Chr6 complement(2365434..2366957) [1524 bp, 507 aa]...   171   3e-47
TPHA0P00660 Chr16 (136114..137535) [1422 bp, 473 aa] {ON} Anc_3....   169   9e-47
TDEL0B06430 Chr2 (1137277..1138854) [1578 bp, 525 aa] {ON} Anc_2...   167   8e-46
TPHA0I02390 Chr9 (528997..530676) [1680 bp, 559 aa] {ON} Anc_2.5...   160   8e-43
Kpol_1056.13 s1056 complement(30531..32156) [1626 bp, 541 aa] {O...   155   2e-41
KNAG0K01150 Chr11 complement(225095..226519) [1425 bp, 474 aa] {...   145   7e-38
ZYRO0E05874g Chr5 (452910..454559) [1650 bp, 549 aa] {ON} simila...   139   1e-35
KAFR0A02060 Chr1 (428640..430262) [1623 bp, 540 aa] {ON} Anc_2.5...   137   1e-34
KAFR0C01020 Chr3 (208272..209558) [1287 bp, 428 aa] {ON} Anc_3.1...   132   1e-33
CAGL0K03223g Chr11 (296371..298167) [1797 bp, 598 aa] {ON} simil...   134   2e-33
NCAS0A12650 Chr1 (2492345..2494111) [1767 bp, 588 aa] {ON} Anc_2...   127   6e-31
KNAG0C05550 Chr3 complement(1076437..1078185) [1749 bp, 582 aa] ...   117   1e-27
Skud_8.26 Chr8 complement(55759..57549) [1791 bp, 596 aa] {ON} Y...   117   1e-27
Smik_8.23 Chr8 complement(51372..53183) [1812 bp, 603 aa] {ON} Y...   115   5e-27
YHL019C Chr8 complement(67731..69548) [1818 bp, 605 aa] {ON}  AP...   112   5e-26
Suva_8.33 Chr8 complement(69735..71525) [1791 bp, 596 aa] {ON} Y...   112   5e-26
TBLA0B06760 Chr2 (1594957..1596930) [1974 bp, 657 aa] {ON} Anc_2...    98   4e-21
NDAI0B01610 Chr2 complement(384287..386305) [2019 bp, 672 aa] {O...    88   8e-18
AGL061W Chr7 (593647..594882) [1236 bp, 411 aa] {ON} Syntenic ho...    72   8e-13
SAKL0A09218g Chr1 complement(802348..803734,803809..803843) [142...    71   1e-12
KLTH0D06556g Chr4 complement(570972..572342) [1371 bp, 456 aa] {...    65   2e-10
TPHA0C04130 Chr3 complement(886804..888405) [1602 bp, 533 aa] {O...    64   2e-10
KAFR0D03560 Chr4 complement(695693..697060) [1368 bp, 455 aa] {O...    63   5e-10
TDEL0A02970 Chr1 complement(532395..533885) [1491 bp, 496 aa] {O...    63   6e-10
KLLA0E18789g Chr5 (1669103..1670596) [1494 bp, 497 aa] {ON} simi...    57   4e-08
Kwal_26.7957 s26 complement(586544..587914) [1371 bp, 456 aa] {O...    56   1e-07
TBLA0I00620 Chr9 complement(110231..112060) [1830 bp, 609 aa] {O...    54   7e-07
ZYRO0B01738g Chr2 complement(139975..141453) [1479 bp, 492 aa] {...    52   2e-06
Kpol_1018.42 s1018 (137162..138889) [1728 bp, 575 aa] {ON} (1371...    49   1e-05
NCAS0A04870 Chr1 (973552..975021) [1470 bp, 489 aa] {ON} Anc_2.5...    45   3e-04
Suva_4.548 Chr4 complement(950244..951698) [1455 bp, 484 aa] {ON...    44   7e-04
Ecym_7266 Chr7 (559988..560022,560112..561630) [1554 bp, 517 aa]...    44   7e-04
Skud_2.419 Chr2 complement(746943..748397) [1455 bp, 484 aa] {ON...    42   0.003
YBR288C Chr2 complement(778012..779463) [1452 bp, 483 aa] {ON}  ...    40   0.007
Smik_2.430 Chr2 complement(763687..765141) [1455 bp, 484 aa] {ON...    39   0.016
CAGL0L02145g Chr12 (252110..253741) [1632 bp, 543 aa] {ON} simil...    39   0.029
TBLA0E00140 Chr5 (17316..18947) [1632 bp, 543 aa] {ON} Anc_3.575...    36   0.17 
KLLA0D11396g Chr4 complement(976408..978018) [1611 bp, 536 aa] {...    36   0.18 
KLTH0H11770g Chr8 (1010683..1011153) [471 bp, 156 aa] {ON} highl...    34   0.27 
Ecym_6007 Chr6 (17110..18723) [1614 bp, 537 aa] {ON} similar to ...    35   0.37 
ZYRO0E09746g Chr5 complement(772264..773880) [1617 bp, 538 aa] {...    35   0.41 
Smik_15.524 Chr15 complement(923208..923357) [150 bp, 50 aa] {ON...    30   0.80 
NDAI0K01930 Chr11 (437535..439373) [1839 bp, 612 aa] {ON} Anc_2....    34   0.96 
Suva_8.418 Chr8 complement(751125..753305) [2181 bp, 726 aa] {ON...    33   1.4  
Smik_7.371 Chr7 complement(610971..612767) [1797 bp, 598 aa] {ON...    33   1.7  
KNAG0A06970 Chr1 complement(1086674..1088191) [1518 bp, 505 aa] ...    33   1.8  
KNAG0D03000 Chr4 complement(537905..539596) [1692 bp, 563 aa] {O...    33   1.8  
NCAS0G03400 Chr7 complement(623483..623971) [489 bp, 162 aa] {ON}      31   3.7  
KLLA0B06545g Chr2 (583095..583541) [447 bp, 148 aa] {ON} highly ...    31   3.7  
Kwal_27.10020 s27 (161799..162242) [444 bp, 147 aa] {ON} YJR058C...    31   3.9  
Kpol_507.7 s507 (49309..50910) [1602 bp, 533 aa] {ON} (49309..50...    32   4.0  
NDAI0G05210 Chr7 (1268117..1268587) [471 bp, 156 aa] {ON} Anc_1....    30   4.5  
ZYRO0C18524g Chr3 (1450641..1452305) [1665 bp, 554 aa] {ON} simi...    31   6.7  
YKL215C Chr11 complement(26827..30687) [3861 bp, 1286 aa] {ON}  ...    31   7.7  
TDEL0D06430 Chr4 complement(1151544..1153154) [1611 bp, 536 aa] ...    31   8.0  
Skud_6.142 Chr6 complement(245137..246777) [1641 bp, 546 aa] {ON...    31   8.1  
TPHA0G03700 Chr7 complement(783421..785040) [1620 bp, 539 aa] {O...    31   9.2  
TDEL0G04640 Chr7 complement(845491..848544) [3054 bp, 1017 aa] {...    31   9.5  
YFR051C Chr6 complement(250163..251803) [1641 bp, 546 aa] {ON}  ...    30   9.5  

>ADL017C Chr4 complement(679085..680416) [1332 bp, 443 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL259C
           (APM1)
          Length = 443

 Score =  894 bits (2311), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/443 (97%), Positives = 434/443 (97%)

Query: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60
           MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI
Sbjct: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60

Query: 61  QHNDLYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDEMMD 120
           QHNDLYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDEMMD
Sbjct: 61  QHNDLYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDEMMD 120

Query: 121 HGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPATLTNSVSWRPEGIVYKKNEAFL 180
           HGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPATLTNSVSWRPEGIVYKKNEAFL
Sbjct: 121 HGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPATLTNSVSWRPEGIVYKKNEAFL 180

Query: 181 DVVESINMLLTQQGQVLRSEILGKVKVKSRLSGMPDLKLGLNDKGIFAQXXXXXXXXXAS 240
           DVVESINMLLTQQGQVLRSEILGKVKVKSRLSGMPDLKLGLNDKGIFAQ         AS
Sbjct: 181 DVVESINMLLTQQGQVLRSEILGKVKVKSRLSGMPDLKLGLNDKGIFAQGDDDDDEEGAS 240

Query: 241 GGTKKKSNIELEDLKFHQCVRLTKFENEKIITFIPPDGDFELMSYRLSTPIKPLIWCDVK 300
           GGTKKKSNIELEDLKFHQCVRLTKFENEKIITFIPPDGDFELMSYRLSTPIKPLIWCDVK
Sbjct: 241 GGTKKKSNIELEDLKFHQCVRLTKFENEKIITFIPPDGDFELMSYRLSTPIKPLIWCDVK 300

Query: 301 LQVHSRSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGTIKWVPSQNAIL 360
           LQVHSRSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGTIKWVPSQNAIL
Sbjct: 301 LQVHSRSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGTIKWVPSQNAIL 360

Query: 361 WKIKSFPGGKDYSMAAEMGLPSVSDNSDHKLKRPVQIKFQIPYFTTSGIQVRYLKINEPK 420
           WKIKSFPGGKDYSMAAEMGLPSVSDNSDHKLKRPVQIKFQIPYFTTSGIQVRYLKINEPK
Sbjct: 361 WKIKSFPGGKDYSMAAEMGLPSVSDNSDHKLKRPVQIKFQIPYFTTSGIQVRYLKINEPK 420

Query: 421 MQYNSYPWVRYITQSGDDYTIRM 443
           MQYNSYPWVRYITQSGDDYTIRM
Sbjct: 421 MQYNSYPWVRYITQSGDDYTIRM 443

>Ecym_8350 Chr8 (700421..701758) [1338 bp, 445 aa] {ON} similar to
           Ashbya gossypii ADL017C
          Length = 445

 Score =  805 bits (2079), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/445 (85%), Positives = 415/445 (93%), Gaps = 2/445 (0%)

Query: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60
           M+SGIYFCD+KGKLLLSRRYKDDIP +AIEQFP+LLIEKEQES+V+PPCFS NGVQYLFI
Sbjct: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60

Query: 61  QHNDLYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDEMMD 120
           QHNDLY+LTLT+SM  NVAQVFS+LH L++VL+EYMKVVEEESIKDNFVIIYELLDE+MD
Sbjct: 61  QHNDLYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDEVMD 120

Query: 121 HGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPATLTNSVSWRPEGIVYKKNEAFL 180
            GIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPP++LT +VSWRPEGI YKKNEAFL
Sbjct: 121 SGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPSSLTTAVSWRPEGIKYKKNEAFL 180

Query: 181 DVVESINMLLTQQGQVLRSEILGKVKVKSRLSGMPDLKLGLNDKGIFAQXXXXXXXXXAS 240
           DV+ESINM++TQQGQVLRSEILGKVKV+SRLSGMPDLKLGLNDKGIF Q         +S
Sbjct: 181 DVIESINMMMTQQGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTQSNEEEEDEPSS 240

Query: 241 --GGTKKKSNIELEDLKFHQCVRLTKFENEKIITFIPPDGDFELMSYRLSTPIKPLIWCD 298
               T+KKSNIELEDLKFHQCVRL+KFENEKIITFIPPDGDFELMSYRLSTPIKPLIWCD
Sbjct: 241 QPSITRKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRLSTPIKPLIWCD 300

Query: 299 VKLQVHSRSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGTIKWVPSQNA 358
            K+QVHSRSR+E+HCRAKAQIK KSTANNVEILIPVP DADSPKFRYSHG+IKWVP +NA
Sbjct: 301 AKIQVHSRSRVEVHCRAKAQIKAKSTANNVEILIPVPNDADSPKFRYSHGSIKWVPEKNA 360

Query: 359 ILWKIKSFPGGKDYSMAAEMGLPSVSDNSDHKLKRPVQIKFQIPYFTTSGIQVRYLKINE 418
           ILWKIKSFPGGKDYSMAAEMGLPSV+D +D+  KRPVQIKFQIPYFTTSGIQVRYLKINE
Sbjct: 361 ILWKIKSFPGGKDYSMAAEMGLPSVNDIADYNFKRPVQIKFQIPYFTTSGIQVRYLKINE 420

Query: 419 PKMQYNSYPWVRYITQSGDDYTIRM 443
           PK+QYNSYPWVRYITQSG+DY IRM
Sbjct: 421 PKLQYNSYPWVRYITQSGEDYIIRM 445

>SAKL0F05346g Chr6 (413830..415173) [1344 bp, 447 aa] {ON} highly
           similar to uniprot|Q00776 Saccharomyces cerevisiae
           YPL259C APM1 medium subunit of the clathrin- associated
           protein complex
          Length = 447

 Score =  779 bits (2011), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/446 (82%), Positives = 410/446 (91%), Gaps = 3/446 (0%)

Query: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60
           M S IYFCDSKGK +LSRRYKDDIP NAI++FP LL+E+EQESSV+PPC + NG+QYLF+
Sbjct: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVEREQESSVIPPCLAHNGIQYLFV 60

Query: 61  QHNDLYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDEMMD 120
           QHNDLYVLT+T+S+S NVAQ+F++L+K++EVL EY+KVVEEESI+DNFVIIYELLDEMMD
Sbjct: 61  QHNDLYVLTMTRSLSTNVAQLFAFLYKVVEVLTEYVKVVEEESIRDNFVIIYELLDEMMD 120

Query: 121 HGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPATLTNSVSWRPEGIVYKKNEAFL 180
           +GIPQIT+TKML+QYITQKSFKL++SAKK KNV+RPP  LTNSVSWRPEGI+YKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLMKSAKKSKNVIRPPIALTNSVSWRPEGIMYKKNEAFL 180

Query: 181 DVVESINMLLTQQGQVLRSEILGKVKVKSRLSGMPDLKLGLNDKGIFAQXXXXXXXXXA- 239
           DVVESINML+TQQGQVLRSEILGKVKVKS LSGMPDLKLGLNDKGIF+          A 
Sbjct: 181 DVVESINMLITQQGQVLRSEILGKVKVKSHLSGMPDLKLGLNDKGIFSNHVSGGVEDEAD 240

Query: 240 --SGGTKKKSNIELEDLKFHQCVRLTKFENEKIITFIPPDGDFELMSYRLSTPIKPLIWC 297
             S   KKK+NIELEDLKFHQCVRL+KFENEKIITFIPPDGDFELMSYRL+TPIKPLIWC
Sbjct: 241 DLSATGKKKANIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMSYRLTTPIKPLIWC 300

Query: 298 DVKLQVHSRSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGTIKWVPSQN 357
           D+K+QVHS+SRIE+HCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHG+IKW P +N
Sbjct: 301 DIKIQVHSKSRIEVHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSIKWAPEKN 360

Query: 358 AILWKIKSFPGGKDYSMAAEMGLPSVSDNSDHKLKRPVQIKFQIPYFTTSGIQVRYLKIN 417
           AILWKIKSFPGGK+YSMAA++GLPSVSD  +  +KRPVQ+KFQIPYFTTSGIQVRYLKIN
Sbjct: 361 AILWKIKSFPGGKEYSMAAQLGLPSVSDFEEPVMKRPVQVKFQIPYFTTSGIQVRYLKIN 420

Query: 418 EPKMQYNSYPWVRYITQSGDDYTIRM 443
           EPKMQY SYPWVRYITQSGDDYTIRM
Sbjct: 421 EPKMQYQSYPWVRYITQSGDDYTIRM 446

>KLTH0F12584g Chr6 complement(1053944..1055269) [1326 bp, 441 aa]
           {ON} highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259C APM1 medium subunit of the clathrin-
           associated protein complex
          Length = 441

 Score =  747 bits (1929), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/442 (78%), Positives = 399/442 (90%), Gaps = 3/442 (0%)

Query: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60
           M S IYFCD+KGK++LSRRY+DD+P +AIE+FP LL+E EQESS++PPC + NGVQYLFI
Sbjct: 1   MASCIYFCDNKGKVILSRRYRDDVPPSAIEKFPSLLLEAEQESSIVPPCLTHNGVQYLFI 60

Query: 61  QHNDLYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDEMMD 120
           QHND+YVLT+++S+SINVAQVFS+L+KL+EVL EY+K VEEESI+DNFVIIYELLDEM+D
Sbjct: 61  QHNDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYVKTVEEESIRDNFVIIYELLDEMLD 120

Query: 121 HGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPATLTNSVSWRPEGIVYKKNEAFL 180
           +GIPQIT+TKML+QYITQKS+KLI+SAKK KNV+RPP+ LT SVSWRPEGI YKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSYKLIKSAKKSKNVIRPPSQLTKSVSWRPEGITYKKNEAFL 180

Query: 181 DVVESINMLLTQQGQVLRSEILGKVKVKSRLSGMPDLKLGLNDKGIFAQXXXXXXXXXAS 240
           DV ESINML+T  GQVLRSEILGKV V+SRLSGMPDLKLGLNDKGIF             
Sbjct: 181 DVTESINMLITASGQVLRSEILGKVNVRSRLSGMPDLKLGLNDKGIFTSVESASSSEATE 240

Query: 241 GGTKKKSNIELEDLKFHQCVRLTKFENEKIITFIPPDGDFELMSYRLSTPIKPLIWCDVK 300
           G   KKSNIELEDLKFHQCVRL+KFENEKIITFIPPDGDFELM+YRLSTPIKPLIWCD K
Sbjct: 241 G---KKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELMNYRLSTPIKPLIWCDAK 297

Query: 301 LQVHSRSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGTIKWVPSQNAIL 360
           +QVHS+SRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHG++K+VP ++AIL
Sbjct: 298 IQVHSQSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSLKYVPEKSAIL 357

Query: 361 WKIKSFPGGKDYSMAAEMGLPSVSDNSDHKLKRPVQIKFQIPYFTTSGIQVRYLKINEPK 420
           WKIK+F GGK+YS AA++GLPS++D    + KRP+Q+KFQIPYFTTSGIQVRYLKINEPK
Sbjct: 358 WKIKTFNGGKEYSFAAQLGLPSMTDAEVPRAKRPIQVKFQIPYFTTSGIQVRYLKINEPK 417

Query: 421 MQYNSYPWVRYITQSGDDYTIR 442
           +QY SYPWVRYITQSGDDYTIR
Sbjct: 418 LQYQSYPWVRYITQSGDDYTIR 439

>Kwal_55.20843 s55 complement(580157..581482) [1326 bp, 441 aa] {ON}
           YPL259C (APM1) - medium subunit of the
           clathrin-associated protein complex [contig 138] FULL
          Length = 441

 Score =  743 bits (1919), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/442 (78%), Positives = 401/442 (90%), Gaps = 3/442 (0%)

Query: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60
           M S IYFCD+ GK++LSRRY+DD+P +AIE+FP LL+E EQESSV+PPC + NG+QY+FI
Sbjct: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFI 60

Query: 61  QHNDLYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDEMMD 120
           QHND+YVLT+++S+SINVAQVFS+L+KL+EVL EY+K VEEESI+DNFVIIYELLDEM+D
Sbjct: 61  QHNDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDEMLD 120

Query: 121 HGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPATLTNSVSWRPEGIVYKKNEAFL 180
           +GIPQIT+TKML+QYITQKS+KLI+S KK KNVVRPPA LT SVSWRPEGI YKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSYKLIKSVKKSKNVVRPPAQLTKSVSWRPEGITYKKNEAFL 180

Query: 181 DVVESINMLLTQQGQVLRSEILGKVKVKSRLSGMPDLKLGLNDKGIFAQXXXXXXXXXAS 240
           DV ESINML+T  GQVLRSEILGKVKV+SRLSGMPDLKLGLNDKGIF           A 
Sbjct: 181 DVTESINMLITASGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTS---EEGGNNAE 237

Query: 241 GGTKKKSNIELEDLKFHQCVRLTKFENEKIITFIPPDGDFELMSYRLSTPIKPLIWCDVK 300
           GG+ KKSNIELEDL+FHQCVRL+KFENEKII+FIPPDGDF+LM+YRLSTPIKPLIWCD K
Sbjct: 238 GGSGKKSNIELEDLQFHQCVRLSKFENEKIISFIPPDGDFDLMNYRLSTPIKPLIWCDAK 297

Query: 301 LQVHSRSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGTIKWVPSQNAIL 360
           +QVHS+SRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHG++K+VP ++AIL
Sbjct: 298 IQVHSQSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGSLKYVPEKSAIL 357

Query: 361 WKIKSFPGGKDYSMAAEMGLPSVSDNSDHKLKRPVQIKFQIPYFTTSGIQVRYLKINEPK 420
           W+IK+F GGK+YS AA++GLPS++D    K KRP+Q+KFQIPYFTTSGIQVRYLK++EPK
Sbjct: 358 WRIKTFNGGKEYSFAAQLGLPSMTDVEVPKAKRPIQVKFQIPYFTTSGIQVRYLKVHEPK 417

Query: 421 MQYNSYPWVRYITQSGDDYTIR 442
           +QY SYPWVRYITQSGDDYTIR
Sbjct: 418 LQYQSYPWVRYITQSGDDYTIR 439

>KLLA0D14311g Chr4 (1216574..1217905) [1332 bp, 443 aa] {ON} similar
           to uniprot|Q00776 Saccharomyces cerevisiae YPL259C APM1
           medium subunit of the clathrin-associated protein
           complex
          Length = 443

 Score =  730 bits (1885), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/443 (76%), Positives = 388/443 (87%)

Query: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60
           M S + FCDSKGK LLSRRY+DD+  +A+E F HLL+E+EQESSV+PPCF  NG+ Y+++
Sbjct: 1   MASYVAFCDSKGKPLLSRRYQDDVSQSAVESFQHLLLEREQESSVMPPCFHHNGIHYMYV 60

Query: 61  QHNDLYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDEMMD 120
           Q+ND+YVL LT+S+S+N   +F++++KLI V+EEY+K VEEESI+DN++IIYELLDEMMD
Sbjct: 61  QYNDVYVLALTRSVSVNATTMFAFMYKLINVVEEYVKRVEEESIRDNYIIIYELLDEMMD 120

Query: 121 HGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPATLTNSVSWRPEGIVYKKNEAFL 180
            G+PQ+T+TKML+QYITQKSFKL RSAKK+KNV RPP  LTNSVSWRPEGI YKKNEAFL
Sbjct: 121 KGVPQVTETKMLKQYITQKSFKLTRSAKKQKNVARPPTELTNSVSWRPEGIKYKKNEAFL 180

Query: 181 DVVESINMLLTQQGQVLRSEILGKVKVKSRLSGMPDLKLGLNDKGIFAQXXXXXXXXXAS 240
           DV+ESINML+TQQGQVLRSEILG VKV+SRLSGMPDLKLGLNDKGIF             
Sbjct: 181 DVIESINMLMTQQGQVLRSEILGTVKVRSRLSGMPDLKLGLNDKGIFTTNDQEDSPEPVV 240

Query: 241 GGTKKKSNIELEDLKFHQCVRLTKFENEKIITFIPPDGDFELMSYRLSTPIKPLIWCDVK 300
              KK SNIELEDLKFHQCVRL+KFENEKIITFIPPDG+F+LM+YRLSTPIKPLIWCDVK
Sbjct: 241 SSKKKNSNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMTYRLSTPIKPLIWCDVK 300

Query: 301 LQVHSRSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGTIKWVPSQNAIL 360
           +QVHS SRIEIHCRAKAQIKKKS ANNVEILIP+PEDADSP F+YS G IKWVP +NAIL
Sbjct: 301 VQVHSGSRIEIHCRAKAQIKKKSVANNVEILIPIPEDADSPTFKYSRGNIKWVPEKNAIL 360

Query: 361 WKIKSFPGGKDYSMAAEMGLPSVSDNSDHKLKRPVQIKFQIPYFTTSGIQVRYLKINEPK 420
           WK  SF GGK+YSMAA++GLPSVSD    KLKRPVQIKFQIPYFTTSGIQVRYLKI EPK
Sbjct: 361 WKFSSFQGGKEYSMAAQLGLPSVSDAEPPKLKRPVQIKFQIPYFTTSGIQVRYLKIEEPK 420

Query: 421 MQYNSYPWVRYITQSGDDYTIRM 443
           +QYNSYPWVRYITQSGDDYTIR+
Sbjct: 421 LQYNSYPWVRYITQSGDDYTIRL 443

>TBLA0A00950 Chr1 complement(210799..212208) [1410 bp, 469 aa] {ON}
           Anc_7.127 YPL259C
          Length = 469

 Score =  712 bits (1838), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/467 (72%), Positives = 395/467 (84%), Gaps = 24/467 (5%)

Query: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60
           M S I FCDSKGK LLSR+Y+DDIP  AI+ F  LL++ E+ESSV+PPC + NG+ YLFI
Sbjct: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHYLFI 60

Query: 61  QHNDLYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDEMMD 120
           QHNDLY++ LT S+S N +QVF++LHKL+EV+ EY+K VEEESI+DNFVIIYELLDEMMD
Sbjct: 61  QHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDEMMD 120

Query: 121 HGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPATLTNSVSWRPEGIVYKKNEAFL 180
           +GIPQIT+TKML+QYITQKSFKL+++AKKK+N  RPP  LTNSVSWRPEGI YKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKAAKKKRNAARPPQALTNSVSWRPEGIKYKKNEAFL 180

Query: 181 DVVESINMLLTQQGQVLRSEILGKVKVKSRLSGMPDLKLGLNDKGIFAQXXXXXXXXXA- 239
           D+VESINML+TQQGQVLRSEI+G+VKV+SRLSGMPDLKLG+NDKGIF++           
Sbjct: 181 DIVESINMLMTQQGQVLRSEIIGEVKVRSRLSGMPDLKLGINDKGIFSKYLESTSSNSNS 240

Query: 240 -----------------------SGGTKKKSNIELEDLKFHQCVRLTKFENEKIITFIPP 276
                                   G ++K SN+ELEDLKFHQCVRL+KFENEKIITFIPP
Sbjct: 241 NDDNSNEVNSSKSSTPQPSTGQDEGSSRKTSNVELEDLKFHQCVRLSKFENEKIITFIPP 300

Query: 277 DGDFELMSYRLSTPIKPLIWCDVKLQVHSRSRIEIHCRAKAQIKKKSTANNVEILIPVPE 336
           DG+FELMSYRL+TPIKPLIWCDV + VHS+SR+EIHCRAKAQIKKKS ANNVEILIPVP+
Sbjct: 301 DGNFELMSYRLTTPIKPLIWCDVNIHVHSKSRVEIHCRAKAQIKKKSIANNVEILIPVPD 360

Query: 337 DADSPKFRYSHGTIKWVPSQNAILWKIKSFPGGKDYSMAAEMGLPSVSDNSDHKLKRPVQ 396
           DAD+P FRYSHG+IKWVP +NAILWKI+SF GGK+YSMAA++GLPS+ DN   KLKRPVQ
Sbjct: 361 DADTPSFRYSHGSIKWVPEKNAILWKIRSFAGGKEYSMAAQLGLPSIDDNEKPKLKRPVQ 420

Query: 397 IKFQIPYFTTSGIQVRYLKINEPKMQYNSYPWVRYITQSGDDYTIRM 443
           IKFQIPYFTTSGIQVRYLK+NEPK+QY SYPWVRYITQSGDDYTIR+
Sbjct: 421 IKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGDDYTIRL 467

>TDEL0H02890 Chr8 complement(481125..482453) [1329 bp, 442 aa] {ON}
           Anc_7.127 YPL259C
          Length = 442

 Score =  711 bits (1834), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/443 (74%), Positives = 387/443 (87%), Gaps = 2/443 (0%)

Query: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60
           M SGIYFCD KG+ +LSRRY+DDIP +AI++F  LL + E+ESSV+PPC +  G+QYLFI
Sbjct: 1   MVSGIYFCDIKGRPILSRRYRDDIPLSAIDRFAPLLADLEEESSVIPPCLNHRGIQYLFI 60

Query: 61  QHNDLYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDEMMD 120
           +H DLYV+ L+ S++ N AQVF++LHKL+E L +Y+K VEEES++DNFVIIYELLDEMMD
Sbjct: 61  EHEDLYVVALSTSLATNAAQVFTFLHKLVEALGDYLKTVEEESVRDNFVIIYELLDEMMD 120

Query: 121 HGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPATLTNSVSWRPEGIVYKKNEAFL 180
           +GIPQIT+TKML+QYITQKSFKLI++ KK K   RPP  LTNSVSWR +GI YKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLIKAVKKVKATARPPTGLTNSVSWRADGITYKKNEAFL 180

Query: 181 DVVESINMLLTQQGQVLRSEILGKVKVKSRLSGMPDLKLGLNDKGIFAQXXXXXXXXXAS 240
           D+VESINM++ QQGQVLRSEI+G+V V+SRLSGMPDLKLG+NDKGIF +          +
Sbjct: 181 DIVESINMVMNQQGQVLRSEIIGQVIVRSRLSGMPDLKLGINDKGIFTRDPETGESQVTA 240

Query: 241 GGTKKKSNIELEDLKFHQCVRLTKFENEKIITFIPPDGDFELMSYRLSTPIKPLIWCDVK 300
           G  KKKS+ ELEDLKFHQCVRL+KFENEKIITFIPPDG+FELMSYRL+TP+KPLIWCDV 
Sbjct: 241 G--KKKSSAELEDLKFHQCVRLSKFENEKIITFIPPDGEFELMSYRLTTPVKPLIWCDVN 298

Query: 301 LQVHSRSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGTIKWVPSQNAIL 360
           +QVHS+SRIEIHCRAKAQIKKKS ANNVEILIPVP+DAD+P FRYSHG+IKWVP +NAIL
Sbjct: 299 VQVHSKSRIEIHCRAKAQIKKKSVANNVEILIPVPDDADTPSFRYSHGSIKWVPEKNAIL 358

Query: 361 WKIKSFPGGKDYSMAAEMGLPSVSDNSDHKLKRPVQIKFQIPYFTTSGIQVRYLKINEPK 420
           WKI+SF GGK+YSMAA+MGLPS++     K KRPVQ+KFQIPYFTTSGIQVRYLKINEPK
Sbjct: 359 WKIRSFYGGKEYSMAAQMGLPSINGVEKPKFKRPVQVKFQIPYFTTSGIQVRYLKINEPK 418

Query: 421 MQYNSYPWVRYITQSGDDYTIRM 443
           +QY SYPWVRYITQ+GDDYTIR+
Sbjct: 419 LQYKSYPWVRYITQNGDDYTIRL 441

>ZYRO0C05236g Chr3 complement(408616..409959) [1344 bp, 447 aa] {ON}
           highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259C APM1 medium subunit of the clathrin-
           associated protein complex
          Length = 447

 Score =  702 bits (1811), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/445 (72%), Positives = 390/445 (87%), Gaps = 2/445 (0%)

Query: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60
           M S +YFCD KG+ +LSRRY+DDIP +AI++F  LL++ E+ESSV+PPC S +G+QYLFI
Sbjct: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60

Query: 61  QHNDLYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDEMMD 120
           QHNDLYV+ L  S++ NVAQVF++LHKL+EVLEEY+K VEEES++DNF+IIYELLDEMMD
Sbjct: 61  QHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDEMMD 120

Query: 121 HGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPATLTNSVSWRPEGIVYKKNEAFL 180
           +GIPQIT+TKML+QYITQKSFKL+++ KK K   RPP  +TNSVSWR   IV+KKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLMKAVKKSKAAPRPPTEVTNSVSWRAPNIVHKKNEAFL 180

Query: 181 DVVESINMLLTQQGQVLRSEILGKVKVKSRLSGMPDLKLGLNDKGIFAQXXXXXXXXXAS 240
           D+VESINML+ QQGQVLRSEI+G++KVKS+LSGMPDLKLG+NDKGIF++          +
Sbjct: 181 DIVESINMLMNQQGQVLRSEIIGQIKVKSKLSGMPDLKLGINDKGIFSKYVEGDSDPVTT 240

Query: 241 GGT--KKKSNIELEDLKFHQCVRLTKFENEKIITFIPPDGDFELMSYRLSTPIKPLIWCD 298
             T  KKK+NIELEDLKFHQCVRL+KFENEKIITFIPPDG FELM+YRLS P+KPLIWCD
Sbjct: 241 AVTEGKKKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGAFELMNYRLSMPVKPLIWCD 300

Query: 299 VKLQVHSRSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGTIKWVPSQNA 358
           V +QVHS+SRIEIHCRA+AQIKK+S AN+VEILIPVP+DAD+P F+Y+HG++KWVP +NA
Sbjct: 301 VNVQVHSQSRIEIHCRARAQIKKRSIANSVEILIPVPDDADTPSFKYTHGSVKWVPQKNA 360

Query: 359 ILWKIKSFPGGKDYSMAAEMGLPSVSDNSDHKLKRPVQIKFQIPYFTTSGIQVRYLKINE 418
           ILWKI+SF GGK+YSM+A+MGLPS++     K+KRPVQIKFQIPYFTTSGIQVRYLKI E
Sbjct: 361 ILWKIRSFTGGKEYSMSAQMGLPSINALDKPKVKRPVQIKFQIPYFTTSGIQVRYLKITE 420

Query: 419 PKMQYNSYPWVRYITQSGDDYTIRM 443
           PK+ Y SYPWVRYITQSGDDYTI++
Sbjct: 421 PKLLYKSYPWVRYITQSGDDYTIKL 445

>YPL259C Chr16 complement(51244..52671) [1428 bp, 475 aa] {ON}
           APM1Mu1-like medium subunit of the clathrin-associated
           protein complex (AP-1); binds clathrin; involved in
           clathrin-dependent Golgi protein sorting
          Length = 475

 Score =  702 bits (1812), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/474 (69%), Positives = 393/474 (82%), Gaps = 31/474 (6%)

Query: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60
           M S +YFCD  GK LLSRRY+DDIP +AI++FP LL + E++S+++PPC + NG++YLFI
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLEYLFI 60

Query: 61  QHNDLYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDEMMD 120
           QHNDLYV+ +  S+S N A +F++LHKL+EVL +Y+K VEEESI+DNFVIIYELLDE+MD
Sbjct: 61  QHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120

Query: 121 HGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPATLTNSVSWRPEGIVYKKNEAFL 180
           +GIPQIT+TKML+QYITQKSFKL++SAKKK+N  RPP  LTNSVSWRPEGI +KKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKSAKKKRNATRPPVALTNSVSWRPEGITHKKNEAFL 180

Query: 181 DVVESINMLLTQQGQVLRSEILGKVKVKSRLSGMPDLKLGLNDKGIFAQXXXXXXXXXAS 240
           D+VESINML+TQ+GQVLRSEI+G VKV S+LSGMPDLKLG+NDKGIF++         ++
Sbjct: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDTNIPSA 240

Query: 241 GGT---------------------KKKSNIELEDLKFHQCVRLTKFENEKIITFIPPDGD 279
             T                     KKK NIELEDLKFHQCVRL+KFENEKIITFIPPDG 
Sbjct: 241 SATTSDNNTETDKKPSITSSSATNKKKVNIELEDLKFHQCVRLSKFENEKIITFIPPDGK 300

Query: 280 FELMSYRLSTPIKPLIWCDVKLQVHSRSRIEIHCRAKAQIKKKSTANNVEILIPVPEDAD 339
           F+LM+YRLST IKPLIWCDV +QVHS SRIEIHC+AKAQIK+KSTA NVEILIPVP+DAD
Sbjct: 301 FDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDAD 360

Query: 340 SPKFRYSHGTIKWVPSQNAILWKIKSFPGGKDYSMAAEMGLPSVSDNSDHK--------- 390
           +P F+YSHG++K+VP ++AILWKI+SFPGGK+YSM+AE+GLPS+S+N D           
Sbjct: 361 TPTFKYSHGSLKYVPEKSAILWKIRSFPGGKEYSMSAELGLPSISNNEDGNRTMPKSNAE 420

Query: 391 -LKRPVQIKFQIPYFTTSGIQVRYLKINEPKMQYNSYPWVRYITQSGDDYTIRM 443
            LK PVQIKFQIPYFTTSGIQVRYLKINEPK+QY SYPWVRYITQSGDDYTIR+
Sbjct: 421 ILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 474

>Suva_16.45 Chr16 complement(66786..68222) [1437 bp, 478 aa] {ON}
           YPL259C (REAL)
          Length = 478

 Score =  696 bits (1795), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/477 (68%), Positives = 393/477 (82%), Gaps = 34/477 (7%)

Query: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60
           M S +YFCD  GK LLSRRY+DDIP +AI++FP LL + E++S+++PPC + NG++YLFI
Sbjct: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60

Query: 61  QHNDLYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDEMMD 120
           QHNDLY++ +  S+S N A +F++LHKL+EVL +Y+K VEEESI+DNFVIIYELLDE+MD
Sbjct: 61  QHNDLYLVAIATSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120

Query: 121 HGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPATLTNSVSWRPEGIVYKKNEAFL 180
           +GIPQIT+TKML+QYITQKSFKL++SAKKK+N  RPP  LTNSVSWRPEGI +KKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKSAKKKRNATRPPVALTNSVSWRPEGISHKKNEAFL 180

Query: 181 DVVESINMLLTQQGQVLRSEILGKVKVKSRLSGMPDLKLGLNDKGIFAQXXXXXXX---- 236
           D+VESINML+TQ+GQVLRSEI+G VKV S+LSGMPDLKLG+NDKGIF++           
Sbjct: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDSSNLPPA 240

Query: 237 --------------------XXASGGTKKKSNIELEDLKFHQCVRLTKFENEKIITFIPP 276
                                 +S  +K+K NIELEDLKFHQCVRL+KFENEKIITFIPP
Sbjct: 241 ASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDLKFHQCVRLSKFENEKIITFIPP 300

Query: 277 DGDFELMSYRLSTPIKPLIWCDVKLQVHSRSRIEIHCRAKAQIKKKSTANNVEILIPVPE 336
           DG F+LM+YRLST IKPLIWCDV +QVHS SRIEIHC+AKAQIK+KSTA NVEILIPVP+
Sbjct: 301 DGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPD 360

Query: 337 DADSPKFRYSHGTIKWVPSQNAILWKIKSFPGGKDYSMAAEMGLPSVSDNSDHK------ 390
           DAD+P F+YSHG++K+VP ++AILWK++SFPGGK+YSM+AE+GLPS+S+ +D        
Sbjct: 361 DADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNGNDGSKTIPKN 420

Query: 391 ----LKRPVQIKFQIPYFTTSGIQVRYLKINEPKMQYNSYPWVRYITQSGDDYTIRM 443
               LK PVQIKFQIPYFTTSGIQVRYLKINEPK+QY SYPWVRYITQSGDDYTIR+
Sbjct: 421 NAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 477

>KNAG0L00950 Chr12 complement(174410..175795) [1386 bp, 461 aa] {ON}
           Anc_7.127 YPL259C
          Length = 461

 Score =  692 bits (1786), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/460 (70%), Positives = 388/460 (84%), Gaps = 17/460 (3%)

Query: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60
           M S +YFCD KGK LLSRRYKDD+P +AI++F  LL + E ES+V+PPC + NG++YLFI
Sbjct: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60

Query: 61  QHNDLYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDEMMD 120
           QHNDLYV+ L  S+++N+A+VF++LHKL+ VL EY+K VEEESI+DNFVIIYEL+DEMMD
Sbjct: 61  QHNDLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMMD 120

Query: 121 HGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPATLTNSVSWRPEGIVYKKNEAFL 180
           +GIPQIT+ +ML++YITQKSFKL ++ KKK+N  RPP+ L NSVSWR EGI YKKNEAFL
Sbjct: 121 YGIPQITEPRMLKKYITQKSFKLEKAHKKKRNAARPPSELNNSVSWRAEGIKYKKNEAFL 180

Query: 181 DVVESINMLLTQQGQVLRSEILGKVKVKSRLSGMPDLKLGLNDKGIFAQ----------- 229
           D+VESINML+TQ+GQVLRSEI+G VK+KSRLSGMPDLKLG+ND+GIF +           
Sbjct: 181 DIVESINMLITQKGQVLRSEIIGAVKIKSRLSGMPDLKLGINDRGIFTKYLEGNNIGVNI 240

Query: 230 ------XXXXXXXXXASGGTKKKSNIELEDLKFHQCVRLTKFENEKIITFIPPDGDFELM 283
                           + G K+K+NIELEDLKFHQCVRL+KFENEKIITFIPPDG+F+LM
Sbjct: 241 PDPQEHGSGVAESSITNDGKKRKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLM 300

Query: 284 SYRLSTPIKPLIWCDVKLQVHSRSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKF 343
           +YRL+T IKPLIWCDV +QVHS+SRIEI CRAKAQIKKKS A NV+ILIPVP+DAD+P F
Sbjct: 301 NYRLTTSIKPLIWCDVSIQVHSKSRIEIRCRAKAQIKKKSVAANVQILIPVPDDADTPSF 360

Query: 344 RYSHGTIKWVPSQNAILWKIKSFPGGKDYSMAAEMGLPSVSDNSDHKLKRPVQIKFQIPY 403
           +YSHG+IK+VP Q+AILWKIKSFPGGK+Y+M AEMGLPS+    + K+KRPVQ+KF+IPY
Sbjct: 361 KYSHGSIKYVPEQSAILWKIKSFPGGKEYAMFAEMGLPSMDSYEEPKVKRPVQVKFEIPY 420

Query: 404 FTTSGIQVRYLKINEPKMQYNSYPWVRYITQSGDDYTIRM 443
           FTTSGIQVRYLKINEPK+QY SYPWVRYITQSGDDYTIR+
Sbjct: 421 FTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRV 460

>NCAS0E02140 Chr5 complement(410049..411494) [1446 bp, 481 aa] {ON}
           Anc_7.127
          Length = 481

 Score =  691 bits (1783), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/449 (72%), Positives = 393/449 (87%), Gaps = 6/449 (1%)

Query: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60
           M S +YFCDSKG  LL+RRY+DDIP +AIE+FP LL + E+E++++PPC S+NG+QYLFI
Sbjct: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPTLLSDLEEETNLVPPCLSYNGMQYLFI 91

Query: 61  QHNDLYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDEMMD 120
           QHND+Y++ +  SMS N AQ+F++L+KL++VL  Y+K VEEESI+DNFVIIYELLDE MD
Sbjct: 92  QHNDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLDETMD 151

Query: 121 HGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPATLTNSVSWRPEGIVYKKNEAFL 180
           +GIPQIT+TKML+QYITQKSFKL+++AKKK+N  RPP  LTNSVSWR   I YKKNEAFL
Sbjct: 152 YGIPQITETKMLKQYITQKSFKLVKAAKKKRNAARPPEALTNSVSWRSADIKYKKNEAFL 211

Query: 181 DVVESINMLLTQQGQVLRSEILGKVKVKSRLSGMPDLKLGLNDKGIFAQXX------XXX 234
           D++ESINML+TQ+GQ+LRSEI+G+VKVKSRLSGMPDLKLG+NDKGIF++           
Sbjct: 212 DIIESINMLMTQKGQILRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKHMDDDSLNNEG 271

Query: 235 XXXXASGGTKKKSNIELEDLKFHQCVRLTKFENEKIITFIPPDGDFELMSYRLSTPIKPL 294
               +S   KKK+NIELEDLKFHQCVRL+KFE EKIITFIPPDGDFELM+YRLST IKPL
Sbjct: 272 ASVASSTTDKKKNNIELEDLKFHQCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIKPL 331

Query: 295 IWCDVKLQVHSRSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGTIKWVP 354
           IWCD+ +QVHS+SRIEIHCRAKAQIKKKSTA NV+I+IPVPEDAD+P+F+YSHG+IK+VP
Sbjct: 332 IWCDMNIQVHSQSRIEIHCRAKAQIKKKSTATNVQIIIPVPEDADTPEFKYSHGSIKYVP 391

Query: 355 SQNAILWKIKSFPGGKDYSMAAEMGLPSVSDNSDHKLKRPVQIKFQIPYFTTSGIQVRYL 414
            +N I+WKI+SFPGGK+YSM+A+M LPS+ +  +HK KRPVQIKFQIPYFTTSGIQV+YL
Sbjct: 392 EKNVIIWKIRSFPGGKEYSMSAQMQLPSIGNIEEHKAKRPVQIKFQIPYFTTSGIQVKYL 451

Query: 415 KINEPKMQYNSYPWVRYITQSGDDYTIRM 443
           KINEPK+QY SYPWVRYITQSGDDYTIR+
Sbjct: 452 KINEPKLQYKSYPWVRYITQSGDDYTIRL 480

>Kpol_1062.56 s1062 (126558..127910) [1353 bp, 450 aa] {ON}
           (126558..127910) [1353 nt, 451 aa]
          Length = 450

 Score =  688 bits (1776), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/450 (72%), Positives = 388/450 (86%), Gaps = 8/450 (1%)

Query: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60
           M SG+YFCD+ GK +LSRRY+DDIP +AI++F  +L+E E+ESSV+PPC  + G+ YLFI
Sbjct: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFI 60

Query: 61  QHNDLYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDEMMD 120
           QH+D+YV+ LT S   N+AQ+F +LH+L+ VL +Y+K VEEESI+DNFVIIYELLDEMMD
Sbjct: 61  QHSDIYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDEMMD 120

Query: 121 HGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPATLTNSVSWRPEGIVYKKNEAFL 180
           +GIPQIT+TKML+QYITQKSFKLI++AKKK+N  RPP  LTNSVSWR EGI YKKNEA+L
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLIKAAKKKRNAARPPVALTNSVSWRQEGIKYKKNEAYL 180

Query: 181 DVVESINMLLTQQGQVLRSEILGKVKVKSRLSGMPDLKLGLNDKGIFAQXXXXXXXXXA- 239
           D++ESINML+ QQGQVLRSEI+G+VKVKSRLSGMPDLKLG+NDKGIF++           
Sbjct: 181 DIIESINMLMNQQGQVLRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKYLENEEDFSKP 240

Query: 240 -------SGGTKKKSNIELEDLKFHQCVRLTKFENEKIITFIPPDGDFELMSYRLSTPIK 292
                  S    KKSNIELEDLKFHQCVRL+KFENEKIITFIPPDG+FELM+YRL+TPIK
Sbjct: 241 VQIINDDSTTNGKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFELMNYRLTTPIK 300

Query: 293 PLIWCDVKLQVHSRSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGTIKW 352
           PLIWCD+ +QVHS+SRIEIHCRAKAQIKKKS ANNVEILIPVP+DAD+P F+YSHG+IKW
Sbjct: 301 PLIWCDINIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPDDADTPTFKYSHGSIKW 360

Query: 353 VPSQNAILWKIKSFPGGKDYSMAAEMGLPSVSDNSDHKLKRPVQIKFQIPYFTTSGIQVR 412
           +P +NAILWK++SF GGK+YSM A++GLPSV      K+KRPVQIKFQIPYFTTSGIQVR
Sbjct: 361 LPEKNAILWKLRSFAGGKEYSMTAQLGLPSVDGIEPPKVKRPVQIKFQIPYFTTSGIQVR 420

Query: 413 YLKINEPKMQYNSYPWVRYITQSGDDYTIR 442
           YLKINEPK+QY S+PWVRYITQSGDDYTIR
Sbjct: 421 YLKINEPKLQYKSFPWVRYITQSGDDYTIR 450

>Smik_6.466 Chr6 (768507..769937) [1431 bp, 476 aa] {ON} YPL259C
           (REAL)
          Length = 476

 Score =  689 bits (1777), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/475 (68%), Positives = 390/475 (82%), Gaps = 32/475 (6%)

Query: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60
           M S +YFCD  GK LLSRRY+DD+P +AI++F  LL + E++S+++PPC + NG++YLFI
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDVPLSAIDKFSTLLSDLEEQSNLIPPCLNHNGLEYLFI 60

Query: 61  QHNDLYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDEMMD 120
           QHNDLY++ +  S++ N A +F++LHKL+EVL +Y+K VEEESI+DNFVIIYELLDE+MD
Sbjct: 61  QHNDLYLVAIVTSLTANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120

Query: 121 HGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPATLTNSVSWRPEGIVYKKNEAFL 180
           +GIPQIT+TKML+QYITQKSFKL++SAKKK+N  RPP  LTNSVSWRPEGI +KKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKSAKKKRNATRPPVALTNSVSWRPEGITHKKNEAFL 180

Query: 181 DVVESINMLLTQQGQVLRSEILGKVKVKSRLSGMPDLKLGLNDKGIFAQXXXXXXX--XX 238
           D+VESINML+TQ+GQVLRSEI+G VKV S+LSGMPDLKLG+NDKGIF++           
Sbjct: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDNDSNIPSA 240

Query: 239 ASGGT--------------------KKKSNIELEDLKFHQCVRLTKFENEKIITFIPPDG 278
            S  T                    K+K NIELEDLKFHQCVRL+KFENEKIITFIPPDG
Sbjct: 241 VSAATSDNNTDTDKKPSITSSSTTSKRKVNIELEDLKFHQCVRLSKFENEKIITFIPPDG 300

Query: 279 DFELMSYRLSTPIKPLIWCDVKLQVHSRSRIEIHCRAKAQIKKKSTANNVEILIPVPEDA 338
            F+LM+YRLST IKPLIWCDV +QVHS SRIEIHC+AKAQIK+KSTA NVEILIPVP+DA
Sbjct: 301 KFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIPVPDDA 360

Query: 339 DSPKFRYSHGTIKWVPSQNAILWKIKSFPGGKDYSMAAEMGLPSVSDNSDHK-------- 390
           D+P F+YSHG++K+VP ++AILWK++SFPGGK+YSM+AE+GLPS+S + D          
Sbjct: 361 DTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISTSKDGSRTIPKSNA 420

Query: 391 --LKRPVQIKFQIPYFTTSGIQVRYLKINEPKMQYNSYPWVRYITQSGDDYTIRM 443
             LK PVQIKFQIPYFTTSGIQVRYLKINEPK+QY SYPWVRYITQSGDDYTIR+
Sbjct: 421 KLLKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 475

>TPHA0C04320 Chr3 (932871..934235) [1365 bp, 454 aa] {ON} Anc_7.127
           YPL259C
          Length = 454

 Score =  685 bits (1767), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/452 (71%), Positives = 386/452 (85%), Gaps = 9/452 (1%)

Query: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60
           M SGIYFCD+ GK +L+RRY+DDI  NAI+ F  LL++ E+E+ V+PPC    G+ YLFI
Sbjct: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHYLFI 60

Query: 61  QHNDLYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDEMMD 120
           +H+D+YV+ LT S   NVAQ+F +LH+L+EVLEEY+K+V EES++DNFVIIYELLDEMMD
Sbjct: 61  KHSDIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEMMD 120

Query: 121 HGIPQITDTKMLRQYITQKSFKLIRSAKKKK--NVVRPPATLTNSVSWRPEGIVYKKNEA 178
            GIPQIT+TKML++YITQKSFKLI+++  KK  N  RPPA LTNSVSWRPEGI YKKNEA
Sbjct: 121 FGIPQITETKMLKKYITQKSFKLIKTSTSKKKKNAARPPAELTNSVSWRPEGITYKKNEA 180

Query: 179 FLDVVESINMLLTQQGQVLRSEILGKVKVKSRLSGMPDLKLGLNDKGIFAQXXXXXXXXX 238
           FLD++ESINML+TQQGQVLRSEI+G V+V+SRLSGMPDLKLG+ND+GIF+          
Sbjct: 181 FLDIIESINMLVTQQGQVLRSEIVGAVRVRSRLSGMPDLKLGINDRGIFSNYLEENNVDG 240

Query: 239 ASGGT-------KKKSNIELEDLKFHQCVRLTKFENEKIITFIPPDGDFELMSYRLSTPI 291
           +S  T        KK  IELEDLKFHQCVRL+KFENEKIITFIPPDG+F+LM+YRL+TPI
Sbjct: 241 SSSSTPIPEGVEDKKPQIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMNYRLTTPI 300

Query: 292 KPLIWCDVKLQVHSRSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGTIK 351
           KPLIWCDV +QVHS+SRIEIHCRAKAQIKKKS ANNVEILIPVP+DAD+P+FRYSHG+IK
Sbjct: 301 KPLIWCDVNIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPDDADTPQFRYSHGSIK 360

Query: 352 WVPSQNAILWKIKSFPGGKDYSMAAEMGLPSVSDNSDHKLKRPVQIKFQIPYFTTSGIQV 411
           W+P +NAILWK++SF GGK+YSM+A++ LPSV      K++RPVQ+KFQIPYFTTSGIQV
Sbjct: 361 WLPEKNAILWKLRSFAGGKEYSMSAQLHLPSVDGVEPPKVRRPVQVKFQIPYFTTSGIQV 420

Query: 412 RYLKINEPKMQYNSYPWVRYITQSGDDYTIRM 443
           RYLK+NEPK+QY SYPWVRYITQSG+DYTIR+
Sbjct: 421 RYLKVNEPKLQYKSYPWVRYITQSGEDYTIRL 452

>Skud_16.19 Chr16 complement(30298..31728) [1431 bp, 476 aa] {ON}
           YPL259C (REAL)
          Length = 476

 Score =  685 bits (1768), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/475 (68%), Positives = 393/475 (82%), Gaps = 32/475 (6%)

Query: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60
           M S +YFCD  GK LLSRRY+DDIP +AI++FP LL + E++S+++PPC + NG++YLFI
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60

Query: 61  QHNDLYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDEMMD 120
           QHNDLY++ +  S+  N A +F++LHKL+EVL +Y+K VEEESI+DNFVIIYELLDE+MD
Sbjct: 61  QHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120

Query: 121 HGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPATLTNSVSWRPEGIVYKKNEAFL 180
           +GIPQI +TKML+QYITQKSFKL++SAKKK+N  RPP  LTNSVSWRPEGI++KKNEAFL
Sbjct: 121 YGIPQICETKMLKQYITQKSFKLVKSAKKKRNATRPPVALTNSVSWRPEGIIHKKNEAFL 180

Query: 181 DVVESINMLLTQQGQVLRSEILGKVKVKSRLSGMPDLKLGLNDKGIFAQXXXXXXXX--X 238
           D+VESINML+TQ+GQVLRSEI+G VKV S+LSGMPDLKLG+NDKGIF++           
Sbjct: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDSNTPPP 240

Query: 239 ASGGT--------------------KKKSNIELEDLKFHQCVRLTKFENEKIITFIPPDG 278
            S  T                    K+K NIELEDLKFHQCVRL+KFENEKIITFIPPDG
Sbjct: 241 TSAATSDNITDTDKKPSITSSSTTSKRKVNIELEDLKFHQCVRLSKFENEKIITFIPPDG 300

Query: 279 DFELMSYRLSTPIKPLIWCDVKLQVHSRSRIEIHCRAKAQIKKKSTANNVEILIPVPEDA 338
            F+LM+YRLST IKPLIWCDV +QVHS SRIEIHC+AKAQIK+KSTA NVEI+IPVP+DA
Sbjct: 301 KFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEIIIPVPDDA 360

Query: 339 DSPKFRYSHGTIKWVPSQNAILWKIKSFPGGKDYSMAAEMGLPSVSDNSD-HK------- 390
           D+P F+YSHG++K+VP ++AILWK++SFPGGK+YSM+AE+GLPS+S++ + H+       
Sbjct: 361 DTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNDIEGHRAIPKSNA 420

Query: 391 --LKRPVQIKFQIPYFTTSGIQVRYLKINEPKMQYNSYPWVRYITQSGDDYTIRM 443
             LK PVQIKFQIPYFTTSGIQVRYLKINEPK+QY SYPWVRYITQSGDDYTIR+
Sbjct: 421 EILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 475

>NDAI0E03680 Chr5 complement(794613..795947) [1335 bp, 444 aa] {ON}
           Anc_7.127
          Length = 444

 Score =  684 bits (1764), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/444 (72%), Positives = 390/444 (87%), Gaps = 2/444 (0%)

Query: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60
           M S IYFCD KG+ LLSR+Y+DDIP  AI++F  LL + E+ESSV+PPC ++N  QYLFI
Sbjct: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFASLLADLEEESSVIPPCLTYNNTQYLFI 60

Query: 61  QHNDLYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDEMMD 120
           QH+D+Y++ +T  +  N+A+VF++L+K+I+VL +Y+K VEEESI+DN+VIIYELLDE+MD
Sbjct: 61  QHSDIYLVAITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLDELMD 120

Query: 121 HGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPATLTNSVSWRPEGIVYKKNEAFL 180
           +GIPQIT+TKML+QYITQKSFKL+++AKKK+N  RPP+ LT+SVSWR EGI YKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKAAKKKQNAARPPSALTDSVSWRSEGIKYKKNEAFL 180

Query: 181 DVVESINMLLTQQGQVLRSEILGKVKVKSRLSGMPDLKLGLNDKGIFAQXXXXXXXXXAS 240
           D+VESINML+TQ+GQ+LRSEILG VK+KSRLSGMPDLKLG+NDKGIF++          +
Sbjct: 181 DIVESINMLMTQKGQILRSEILGVVKIKSRLSGMPDLKLGINDKGIFSKQLTEDDTNN-N 239

Query: 241 GGTKKKSNIELEDLKFHQCVRLTKFENEKIITFIPPDGDFELMSYRLSTPIKPLIWCDVK 300
             +KK++ IELEDLKFHQCVRL+KFE EKIITFIPPDGDFELM+YRLST IKPLIWCD+ 
Sbjct: 240 ATSKKQNKIELEDLKFHQCVRLSKFETEKIITFIPPDGDFELMNYRLSTSIKPLIWCDMN 299

Query: 301 LQVHSRSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGTIKWVPSQNAIL 360
           +QVHS SRIEIHCRAKAQIKKKSTA NVEILIPVPEDAD+P F+YSHG+IKWVP ++AIL
Sbjct: 300 VQVHSNSRIEIHCRAKAQIKKKSTATNVEILIPVPEDADTPNFKYSHGSIKWVPEKSAIL 359

Query: 361 WKIKSFPGGKDYSMAAEMGLPSVSDNSDH-KLKRPVQIKFQIPYFTTSGIQVRYLKINEP 419
           WKI+SFPGGK+YSMAAE+ LPS S  S+  + K+PVQ+KFQIPYFTTSGIQVRYLKINEP
Sbjct: 360 WKIRSFPGGKEYSMAAELCLPSTSSKSEEVQNKKPVQVKFQIPYFTTSGIQVRYLKINEP 419

Query: 420 KMQYNSYPWVRYITQSGDDYTIRM 443
           K+QY SYPWVRYITQSGDDYTIR+
Sbjct: 420 KLQYKSYPWVRYITQSGDDYTIRL 443

>KAFR0L00470 Chr12 complement(85772..87169) [1398 bp, 465 aa] {ON}
           Anc_7.127 YPL259C
          Length = 465

 Score =  673 bits (1736), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/468 (67%), Positives = 384/468 (82%), Gaps = 28/468 (5%)

Query: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60
           M S +YFCD KGK LLSR+Y+DDIP +AI++F  LL +KE+ES++LPPC S NG+QY+FI
Sbjct: 1   MASAVYFCDHKGKPLLSRKYRDDIPLSAIDKFSSLLSDKEEESNLLPPCISHNGIQYMFI 60

Query: 61  QHNDLYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDEMMD 120
           QHNDLY+  L  S+  N++ +F++LHK+I+VL+ Y+K VEEESI+DNF+IIYELLDEMMD
Sbjct: 61  QHNDLYLAALATSVQANISLIFAFLHKIIDVLDGYLKTVEEESIRDNFIIIYELLDEMMD 120

Query: 121 HGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPATLTNSVSWRPEGIVYKKNEAFL 180
           +G+PQIT+TKML++YIT KSFKL ++ KKK+N  RPP  LTNSVSWRPEGI YKKNEAFL
Sbjct: 121 YGLPQITETKMLKKYITTKSFKLEKAHKKKRNAARPPTELTNSVSWRPEGIKYKKNEAFL 180

Query: 181 DVVESINMLLTQQGQVLRSEILGKVKVKSRLSGMPDLKLGLNDKGIF------------- 227
           D++ESINML+TQ+GQVLRSEI+G V+VKSRLSGMPDLKLG+ND+GIF             
Sbjct: 181 DIIESINMLITQKGQVLRSEIVGNVRVKSRLSGMPDLKLGINDRGIFTKYLEGNNIGIAK 240

Query: 228 ------AQXXXXXXXXXASGGTKKKSNIELEDLKFHQCVRLTKFENEKIITFIPPDGDFE 281
                 A          + G  K+K+NIELEDLKFHQCVRL+KFENEKII+FIPPDG+F+
Sbjct: 241 NGDDEDADDTNNESSIVSEGSNKRKTNIELEDLKFHQCVRLSKFENEKIISFIPPDGEFD 300

Query: 282 LMSYRLSTPIKPLIWCDVKLQVHSRSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSP 341
           LM+YRLST IKPLIWCDV +Q +   RIEIHC+AKAQIKKKS A NVEILIPVPEDADSP
Sbjct: 301 LMNYRLSTSIKPLIWCDVSIQTY---RIEIHCKAKAQIKKKSIATNVEILIPVPEDADSP 357

Query: 342 KFRYSHGTIKWVPSQNAILWKIKSFPGGKDYSMAAEMGLPSVSDNSD------HKLKRPV 395
            F+YSHG IK++P +N +LWKI SFPGGK+YSMAA+MGLPS+S   D      ++ K+PV
Sbjct: 358 IFKYSHGKIKYLPEKNLLLWKISSFPGGKEYSMAAQMGLPSISGEDDLNTRVSNQSKKPV 417

Query: 396 QIKFQIPYFTTSGIQVRYLKINEPKMQYNSYPWVRYITQSGDDYTIRM 443
           Q+KF+IPYFTTSGIQVRYLK+NEPK+QY +YPWVRYITQSGDDYTIR+
Sbjct: 418 QVKFKIPYFTTSGIQVRYLKVNEPKLQYKTYPWVRYITQSGDDYTIRI 465

>CAGL0K00539g Chr11 complement(64028..65398) [1371 bp, 456 aa] {ON}
           highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259c Clathrin coat assembly protein
          Length = 456

 Score =  659 bits (1700), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/455 (70%), Positives = 386/455 (84%), Gaps = 12/455 (2%)

Query: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60
           M S IYFCD+KG+ LLSR+Y+DDIP +AI++FP LL   E+E++++PPC   NG+Q+LFI
Sbjct: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI 60

Query: 61  QHNDLYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDEMMD 120
           QHNDLY++ +  S+S N A +FS+LHK+IEVL EY+K VEEESI+DNFVIIYELLDEMMD
Sbjct: 61  QHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDEMMD 120

Query: 121 HGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPATLTNSVSWRPEGIVYKKNEAFL 180
           +GIPQIT+ KML+QYITQKSFKL ++AKKK+N  RPP +LTNSVSWRPEGI +KKNEAFL
Sbjct: 121 YGIPQITEPKMLKQYITQKSFKLKKAAKKKRNAARPPTSLTNSVSWRPEGIKHKKNEAFL 180

Query: 181 DVVESINMLLTQQGQVLRSEILGKVKVKSRLSGMPDLKLGLNDKGIFAQ----------- 229
           D++ESINML+TQ+GQVLRSEI+G+VKVKS+LSGMPDLKLG+NDKG+F++           
Sbjct: 181 DIIESINMLMTQKGQVLRSEIIGEVKVKSKLSGMPDLKLGINDKGLFSKYLEGDENGVPI 240

Query: 230 XXXXXXXXXASGGTKKKSNIELEDLKFHQCVRLTKFENEKIITFIPPDGDFELMSYRLST 289
                    +    K+ +N+ELEDLKFHQCVRL+KFENEK ITFIPPDGDFELMSYRLST
Sbjct: 241 APDDSSVDESKPKKKRSNNMELEDLKFHQCVRLSKFENEKQITFIPPDGDFELMSYRLST 300

Query: 290 PIKPLIWCDVKLQVHSRSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGT 349
            IKPLIWCDV ++ HS+SRIEI CRAKAQIKKKSTA NVEILIPVPEDAD+P F+YSHG+
Sbjct: 301 AIKPLIWCDVNIKTHSKSRIEIFCRAKAQIKKKSTATNVEILIPVPEDADTPVFKYSHGS 360

Query: 350 IKWVPSQNAILWKIKSFPGGKDYSMAAEMGLPSVSDNSD-HKLKRPVQIKFQIPYFTTSG 408
           IK+VP +NAILWKI++FPG K+YSMAAEMGLPS +   +  KLKRPVQ+KFQIPYFTTSG
Sbjct: 361 IKYVPEKNAILWKIRTFPGDKEYSMAAEMGLPSTNAGEESEKLKRPVQVKFQIPYFTTSG 420

Query: 409 IQVRYLKINEPKMQYNSYPWVRYITQSGDDYTIRM 443
           IQVRYLKI E  +QY SYPWVRYIT+SGDDYTIR+
Sbjct: 421 IQVRYLKIEEKNLQYKSYPWVRYITKSGDDYTIRL 455

>Ecym_5239 Chr5 complement(492091..493485) [1395 bp, 464 aa] {ON}
           similar to Ashbya gossypii ADR315W
          Length = 464

 Score =  230 bits (587), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 152/475 (32%), Positives = 248/475 (52%), Gaps = 45/475 (9%)

Query: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60
           M S ++    +G L++S+  KD+I     E F    I+      V  P  +     +  I
Sbjct: 1   MISALFLYSPRGDLIISKLIKDNIKLGVSEIFR---IQVINNLDVRSPILTLGSTTFHHI 57

Query: 61  QHND-LYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDEMM 119
           + N  L+++T+++  + + A ++ +L+   ++LE Y  +  E+S++ +F++ YE+LD ++
Sbjct: 58  RSNGGLWLVTVSRG-NTDSAGIWEFLYNFNKLLEVY-DINSEDSLQGDFMLCYEILDIVL 115

Query: 120 DHGIPQITDTKMLRQYITQKSFK---------------LIRSAKKKKNVVRPPATLTNSV 164
           D+GIP+ T+   +  YI++K                  L+++  +  +      T  +  
Sbjct: 116 DNGIPRDTELTHIMPYISKKPLSENLLGSDDILNTPSWLVKAGARGMSSENLGLTSKDMC 175

Query: 165 SWRPEGIVYKKNEAFLDVVESINMLLTQQGQVLRSEILGKVKVKSRLSGMPDLKLGLND- 223
            WR EGI YKKNE +LDV E I++L+ + G +L+S + G V+  + LSGMP  + G ND 
Sbjct: 176 LWRSEGIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGSVQCVAHLSGMPVCQFGFNDY 235

Query: 224 --KGIFAQXXXXXXXXXASGGTKKKSN-----IELEDLKFHQCVRLTKFENEKIITFIPP 276
                  Q            GTK   N     + LED KFHQCV+L KF+ E++I F+PP
Sbjct: 236 LSPSSNTQSSGNDGWAEEENGTKAIKNAITGSVILEDCKFHQCVQLDKFDQERVIRFVPP 295

Query: 277 DGDFELMSYR----LSTPIK--PLIWCDVKLQVHSRSRIEIHCRAKAQIKKKSTANNVEI 330
           DG FELM Y     L+ P K  P++     L+  S   +E     K+    K  A +VE+
Sbjct: 296 DGLFELMKYHVRDNLNLPFKVTPMV---TTLKGKS---VEYRITLKSLFPSKLCAKDVEL 349

Query: 331 LIPVPEDADSPKFRYSHGTIKWVPSQNAILWKIKSFPGGKDYSMAA---EMGLPSVSDNS 387
            IP P D  + K   S G  K++P +NAI+WKI  + G  +   +A    MG  + S N 
Sbjct: 350 YIPAPPDTVNAKINVSSGKGKFIPEENAIVWKIHKYHGLTENVFSAVIVPMGNGNDSLNL 409

Query: 388 DHKLKRPVQIKFQIPYFTTSGIQVRYLKINEPKMQYNSYPWVRYITQSGDDYTIR 442
           +   + P+ ++F+I  F+ SG+ VRYLK+ E  + YN+  WV+YI++SG  Y +R
Sbjct: 410 EQWSRPPISVRFEISMFSNSGLVVRYLKVMEKDLNYNTVKWVKYISKSG-AYEVR 463

>KLLA0C03894g Chr3 complement(354889..356316) [1428 bp, 475 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit,
          Length = 475

 Score =  212 bits (540), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 137/483 (28%), Positives = 244/483 (50%), Gaps = 50/483 (10%)

Query: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGV--QYL 58
           M S I+  ++KG LL+S+  KD +  +  + F   +I    +  V  P  +      Q++
Sbjct: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVI---NDPHVRSPILTLGSTTFQHV 57

Query: 59  FIQHND---LYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELL 115
             + +D   ++++ +++S +++ + ++ YLHKL +++E +  + +E+ +KD F+++YE+L
Sbjct: 58  IRESSDNLPMWLVAVSRS-NVDSSMIWEYLHKLYQLMEAF-GINDEDVLKDEFMLLYEIL 115

Query: 116 DEMMDHGIPQITDTKMLRQYITQKSFKLIRSAKKKK-----------NVVRPP------- 157
           +  +++GIPQ TD   L Q I + S K I +    K           N+++ P       
Sbjct: 116 ELTLENGIPQTTD---LAQIIPRVSRKPIENNTISKSPDLDDFLSGSNILKAPKLSKRSS 172

Query: 158 ----ATLTNSVSWRPEGIVYKKNEAFLDVVESINMLLTQQGQVLRSEILGKVKVKSRLSG 213
                +  +   WRP G+ YKKNE +LD+ E I +L+ + G +++S + G V   S LSG
Sbjct: 173 SSIALSSLSECPWRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGSVDCVSHLSG 232

Query: 214 MPDLKLGLNDK-----------GIFAQXXXXXXXXXASGGTKKKSNIELEDLKFHQCVRL 262
           MP  +LGLND             I             +       ++ LED KFHQCV+L
Sbjct: 233 MPLCQLGLNDTYSIHGNEKSELSIVEMMSEYDIKNKKAIPNAAAGSVILEDCKFHQCVQL 292

Query: 263 TKFENEKIITFIPPDGDFELMSYRLSTPIKPLIWCDVKLQVHSRSRIEIHCRAKAQIKKK 322
            K+E   +I F+PPDG F+LM YR+   I        ++++   S +      ++     
Sbjct: 293 NKYEANHVIQFVPPDGPFQLMQYRVIDNINIPFNVIPEVEIVKNSTLNYKVTLRSLFPSN 352

Query: 323 STANNVEILIPVPEDADSPKFRYSHGTIKWVPSQNAILWKIKSFPGGKDYSMAAEMGLPS 382
            +A +V + IPVP       F  S G  K+   +  ++WK   + G  + +++ ++ +P+
Sbjct: 353 VSAKDVTVKIPVPPTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGSTENTLSGKVAIPA 412

Query: 383 VSDNSDHKL---KRPVQIKFQIPYFTTSGIQVRYLKINEPKMQYNSYPWVRYITQSGDDY 439
            S +    L   + P+ + F+I  F+ SG+ VR+LK  EP++ Y    W++YI+ SG  Y
Sbjct: 413 TSHDLSDLLRWSRPPISMGFEIVMFSNSGLVVRHLKCQEPQLNYQPVKWIKYISHSG-AY 471

Query: 440 TIR 442
            IR
Sbjct: 472 EIR 474

>KLTH0F06534g Chr6 complement(565211..566611) [1401 bp, 466 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 466

 Score =  208 bits (529), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 139/481 (28%), Positives = 248/481 (51%), Gaps = 55/481 (11%)

Query: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60
           M S ++    +G+LL+S+  +  +P +  E F    I+      V  P  +     +  +
Sbjct: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIF---RIQVINNLDVRSPVLTLGSTTFHHV 57

Query: 61  QH-NDLYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDEMM 119
           +   +L+++ +++S + + A ++ +L+KL  +LE +  +  E  +K++F+  YELLD ++
Sbjct: 58  KSPGNLWIVAVSRS-NADSAAIWEFLYKLSALLEAF-GLHSENELKEDFMTCYELLDIVL 115

Query: 120 DHGIPQITDTKMLRQYITQK---------SF---------------KLIRSAKKKKNVVR 155
           + G+P  T+   +   ++ K         +F               + +R+     N+  
Sbjct: 116 EDGVPVDTELSSVASKMSVKPSASAERINTFIESGNGGTNRILPVAQFLRARSSSSNLHD 175

Query: 156 PPATLTNSVSWRPEGIVYKKNEAFLDVVESINMLLTQQGQVLRSEILGKVKVKSRLSGMP 215
             + + +++ WR  GI YKKNE FL+V E I++L+++ G +L+S + G V+  + LSGMP
Sbjct: 176 SHSKVPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMP 235

Query: 216 DLKLGLNDKGIFAQXXXXXXXXXASGGTKKKS-------NIELEDLKFHQCVRLTKFENE 268
             + GLND    +           S  T KK+       ++ LED KFHQCV+L KF++E
Sbjct: 236 VCRFGLND----SLSVSTPFGDNESPTTNKKAIPKAAAGSVMLEDCKFHQCVQLDKFQSE 291

Query: 269 KIITFIPPDGDFELMSYR----LSTPIK--PLIWCDVKLQVHSRSRIEIHCRAKAQIKKK 322
           + I FIPPDG FELM Y     L+ P K  P++       +   + I+     K+    K
Sbjct: 292 RTINFIPPDGSFELMKYHVRENLNLPFKITPVV------TLFKANSIDYRVTIKSLFPSK 345

Query: 323 STANNVEILIPVPEDADSPKFRYSHGTIKWVPSQNAILWKIKSFPGGKDYSMAA-EMGLP 381
            TA +V++ IPVP +        S+G  K+VP ++AI+WK   + G  + S++A  + + 
Sbjct: 346 LTAKDVQLRIPVPPETVDCHISTSNGRCKFVPEESAIIWKFSKYQGLTENSLSATAVPMK 405

Query: 382 SVSDNSDHKLKRPVQIKFQIPYFTTSGIQVRYLKINEPKMQYNSYPWVRYITQSGDDYTI 441
             + N D   K P+ +KF+I  F+ SG+ VR+  ++E    Y    W++Y+++SG  Y +
Sbjct: 406 DSALNIDQWSKPPMSLKFEIVMFSNSGLVVRFFDVSEGDRNYKMVKWIKYLSKSG-AYEV 464

Query: 442 R 442
           R
Sbjct: 465 R 465

>SAKL0D13090g Chr4 (1093315..1094814) [1500 bp, 499 aa] {ON} weakly
           similar to uniprot|P38700 Saccharomyces cerevisiae
           YHL019C APM2 homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 499

 Score =  208 bits (529), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 147/519 (28%), Positives = 251/519 (48%), Gaps = 96/519 (18%)

Query: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60
           M+S IY  D   + L+ + +K    +N  E     L ++      + P F + G+ +++I
Sbjct: 1   MSSCIYILDETLQPLIYKNFK--AISNGEESIE--LFQQAHSKHPMVPVFHYKGIHFVYI 56

Query: 61  QHNDLYVLTL--------TKSMSINVAQVFSYLHKLIEVLEEYM--KVVEEESIKDNFVI 110
           + +  Y ++          K    NV  + +YL     +L+ Y   + +    I DNF +
Sbjct: 57  RRDGFYFISAVELVAEASNKKSHFNVMAILTYLENFYTLLKRYFNSQKLNRWLIVDNFHL 116

Query: 111 IYELLDEMMDHGIPQITDTKMLRQYITQK---SFKLIRSAKK--KKNVVRP--------- 156
           IYELLDE +D G+PQ+TD  +++ YI  +     +L  S+KK  KK  +           
Sbjct: 117 IYELLDESLDFGVPQLTDYNIIQDYIKVQVNLHDELADSSKKISKKEDLHGFEDDESYMN 176

Query: 157 ---PATLTNSVSWRPEGIVYKKNEAFLDVVESINMLLT-QQGQVLRSEILGKVKVKSRLS 212
                T T+++SWRP+GI Y KNE FLDV+E I   +   + ++ ++ + G+++ +S LS
Sbjct: 177 SFIARTTTSAISWRPKGIHYTKNEFFLDVIEEIEYCMDFNKSKIRKNFVHGRIRCRSYLS 236

Query: 213 GMPDLKLGLNDKGIFAQXXXXXXXXXASGGTKKKSNIELEDLKFHQCVRLTKFENEKIIT 272
           GMP LK+GL+                 +    K+    + + KFHQCV L   + + I++
Sbjct: 237 GMPKLKIGLS---------------KITSSLPKEREQFMNNAKFHQCVSLEDLQ-KNIVS 280

Query: 273 FIPPDGDFELMSYRLST-----PIKPLIWCDVKLQVHSRSRIEIHCRAKAQIKKKSTANN 327
           FIPPDG+F+L  Y+L       P+  L+  DVK +   R +I I        K +++ + 
Sbjct: 281 FIPPDGEFQLCEYKLKRHVRDPPVIKLVKFDVKKEEKKRPKILISLTITTDFKSQNSTSV 340

Query: 328 VEILIPVP--------EDADSPKFRYSHGTIKWVPSQNAILWKIKSFPGGK---DYSMAA 376
           + I IP+         + A  P+F+   G + +  + + +LW++ S  GG    ++SM  
Sbjct: 341 LNIRIPLTKIFSEYQIDLAKPPRFKCDQGNVLFNLTDDLLLWEVGSIKGGHAQTEHSMYC 400

Query: 377 EMGL--------------------------------PSVSDNSDHKLKRPVQIKFQIPYF 404
           E  L                                  V +N +    R V ++F+IPY+
Sbjct: 401 EFRLYDEEEYKKQLEELKNSMDPPPLRQGPKLEELYKQVHENENTNRSRLVSMEFEIPYY 460

Query: 405 TTSGIQVRYLKINEPKMQYNSYPWVRYITQSGDDYTIRM 443
           T SG++V+YLKI E ++QY+S+PWVRY T + ++Y  ++
Sbjct: 461 TCSGLKVQYLKIEEDQLQYHSFPWVRYKTVNDEEYAYQI 499

>SAKL0C07414g Chr3 complement(683859..685307) [1449 bp, 482 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 482

 Score =  204 bits (520), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 148/497 (29%), Positives = 251/497 (50%), Gaps = 71/497 (14%)

Query: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60
           M + ++    KG+L++S+  +D I  +  E F    I+      V  P  +     +  I
Sbjct: 1   MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFR---IQVINNLDVRSPVLTLGSTTFHHI 57

Query: 61  QHN-DLYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDEMM 119
           + + +L+++ +T+S + + A ++ +L+K   +LE Y  +  EES+K+ F+  YELLD ++
Sbjct: 58  RSSSNLWIVAVTRS-NADSAAIWEFLYKFNALLEAY-GLNSEESLKEEFMTCYELLDVVL 115

Query: 120 DHGIPQITD-----TKMLRQYITQK-----SFKLIRSAKKKKNV-VRPPATLTNSVS--- 165
           ++G+P  T+     +KM R+ +        + +L+ SA    ++  R P  L        
Sbjct: 116 ENGVPVDTELSSVASKMSRRPVVSLENNPLTDELLMSAAANVDLGFRMPKFLNKGSRSSS 175

Query: 166 ------------------WRPEGIVYKKNEAFLDVVESINMLLTQQGQVLRSEILGKVKV 207
                             WR  GI YKKNE FLDV E IN+L+++ G +L+S + G V +
Sbjct: 176 SVSSPANGDEHGDPCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYVDGSVDL 235

Query: 208 KSRLSGMPDLKLGLNDK-----GIFA---------QXXXXXXXXXASGGTKKKSNIELED 253
            + LSG P  + GLND      G  +         +         A+ G+     ++LED
Sbjct: 236 TTHLSGTPLCQFGLNDSLSLDGGTLSRDLDFISEYEVKNKKAIPKAAAGS-----VQLED 290

Query: 254 LKFHQCVRLTKFENEKIITFIPPDGDFELMSYR----LSTPIKPLIWCDVKLQVHSRSRI 309
            KFHQCV+L +F  ++II F+PPDG FELM Y     L+ P K      V+    +   +
Sbjct: 291 CKFHQCVQLNRFNTDRIIRFVPPDGSFELMRYHVRDNLNLPFKITPIFSVR---SNNGAV 347

Query: 310 EIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGTIKWVPSQNAILWKIKSFPGG 369
           E     K+    K TA +V + IPVP      K   S+G  ++VP +NA+LWK   + G 
Sbjct: 348 EYRVALKSLFPSKLTAKDVVLRIPVPPGTVDCKINTSNGRCRFVPEENAVLWKFAKYQGL 407

Query: 370 KDYSMAAEMGLPSVSDNSDHKLKR----PVQIKFQIPYFTTSGIQVRYLKINEPKMQYNS 425
            + +++A + +P + + S   L++    P+ + F+I  F+ SG+ VR+ K++E    Y++
Sbjct: 408 TENTLSA-LTVP-MDNQSSLNLQQWSRPPMSLTFEILMFSNSGLVVRFFKVSERDHSYHT 465

Query: 426 YPWVRYITQSGDDYTIR 442
             WV+YI++SG  Y +R
Sbjct: 466 VKWVKYISRSG-AYEVR 481

>NCAS0C03580 Chr3 complement(715761..717236) [1476 bp, 491 aa] {ON}
           Anc_3.165
          Length = 491

 Score =  202 bits (513), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 140/498 (28%), Positives = 255/498 (51%), Gaps = 64/498 (12%)

Query: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60
           M + +    ++G+L++S+ +K  +  +  + F    I+      V  P  +     +  I
Sbjct: 1   MINALLIFTARGELVVSKLFKGSMKRSIADIFR---IQVINNLDVRSPILTLGSTTFHHI 57

Query: 61  QH---NDLYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDE 117
           +    ++L+++ ++++ +++ A ++ +L+KL  +L+ Y  +  EE +K+ F+I++ELLD 
Sbjct: 58  KSTRGDNLWIVAVSRN-NVDSAAIWEFLYKLDSLLDSY-GLNHEEYLKEEFMIVHELLDV 115

Query: 118 MM--DHGIPQITDTKMLRQYITQKSFKLIRSAKKK------------------------K 151
           MM    GIP +T+  ++   ++ K  K I  A+                          K
Sbjct: 116 MMCGSGGIPMLTENSLVISRMSVKPSKSILEAQNSGNGSSNTNSNNNNNNVPDLLMSGPK 175

Query: 152 NVVRPPATLTNSVS------WRPEGIVYKKNEAFLDVVESINMLLTQQGQVLRSEILGKV 205
            + R  A+L+  +S      WRP+GIV+KKNE  L V E IN+L+++ G VL++ + G +
Sbjct: 176 LLRRNSASLSQDLSILTDFKWRPKGIVHKKNEVILHVNERINILVSKDGSVLKAYVDGSI 235

Query: 206 KVKSRLSGMPDLKLGLND----KGIFAQXXXXXXXXXASGG-----TKKK-------SNI 249
            +++ LSG P  + GLND     G+ +            G      T KK        ++
Sbjct: 236 DLETHLSGTPICQFGLNDSLSVSGVDSDMYGSHNHNHHFGDVNFDKTDKKQLSMASVGSV 295

Query: 250 ELEDLKFHQCVRLTKFENEKIITFIPPDGDFELMSYRLSTPIK-PLIWCDVKLQVHSRSR 308
            LED KFHQCV L KF+ ++II F+PPDG  ELM Y +   +  P     +     + + 
Sbjct: 296 ILEDCKFHQCVSLDKFDKDRIIKFVPPDGSMELMKYHVRDNLNLPFKVSPIVTNTRNGTA 355

Query: 309 IEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGTIKWVPSQNAILWKIKSFPG 368
           +E     K+    + +A NV + IPVP +    K   ++G+ K++P ++A++W+   F G
Sbjct: 356 LEYRITMKSLFPGRLSAKNVALHIPVPPNTMDCKINVTNGSCKFIPEESAMIWRFNKFNG 415

Query: 369 GKDYSMAAEMGLPSVSDNSDHKLKR----PVQIKFQIPYFTTSGIQVRYLKINEPKMQYN 424
             + +++A + +P+  DN+   L++    P+ + F+I  F+ SG+ VRY  I E   +Y 
Sbjct: 416 LTENTLSA-VTIPT-KDNTQLSLQQWSKPPMSLDFEILMFSNSGLVVRYFTITERDQKYK 473

Query: 425 SYPWVRYITQSGDDYTIR 442
           +  W++YI++SG  Y IR
Sbjct: 474 AVKWIKYISRSG-SYEIR 490

>Kwal_33.14182 s33 complement(560456..561859) [1404 bp, 467 aa] {ON}
           YOL062C (APM4) - Clathrin associated protein, medium
           subunit [contig 105] FULL
          Length = 467

 Score =  201 bits (510), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 137/478 (28%), Positives = 243/478 (50%), Gaps = 48/478 (10%)

Query: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60
           M + ++    +G+LL+S+  K  +  +  E F    I+      V  P  +     +  I
Sbjct: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIF---RIQVINNLDVRSPVLTLGSTTFHHI 57

Query: 61  QH-NDLYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDEMM 119
           +   +L+++ +++S + + A ++ +L++L E+LE +  +  E  +K+ F+I YELLD ++
Sbjct: 58  KSAKNLWIVAVSRS-NADSAAIWEFLYRLNELLEAF-NLYSENELKERFMICYELLDIVL 115

Query: 120 DHGIPQITDTKMLRQYITQK------SFKL------------------IRSAKKKKNVVR 155
           + G+P  T+   +   ++ K      +F +                  +R      N+  
Sbjct: 116 EDGLPVDTELSSVASKMSVKPNAGVDNFNMFAENGHGGTNRILPVSQFLRGRPSAGNLQD 175

Query: 156 PPATLTNSVSWRPEGIVYKKNEAFLDVVESINMLLTQQGQVLRSEILGKVKVKSRLSGMP 215
             +   +++ WR  GI YKKNE FL+V E I++L+++ G +L+S + G V+  + LSGMP
Sbjct: 176 IASEAPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMP 235

Query: 216 DLKLGLNDKGIFA---------QXXXXXXXXXASGGTKKKSNIELEDLKFHQCVRLTKFE 266
             + GLND    +         Q         A+ G+     + LED KFHQCV+L KF+
Sbjct: 236 VCRFGLNDALSVSTPFGDDDEYQVTNKKAIPKAAAGS-----VMLEDCKFHQCVQLDKFQ 290

Query: 267 NEKIITFIPPDGDFELMSYRLSTPIK-PLIWCDVKLQVHSRSRIEIHCRAKAQIKKKSTA 325
           +E+ I FI PDG FELM Y +   +  P     +   V S S I+     K+    K TA
Sbjct: 291 SERTINFIAPDGSFELMKYHVRENLNLPFKVTPIVTVVRSNS-IDYQITIKSLFPSKLTA 349

Query: 326 NNVEILIPVPEDADSPKFRYSHGTIKWVPSQNAILWKIKSFPGGKDYSMAA-EMGLPSVS 384
            +V++ IPVP +  S     S+G  K+VP ++AI+WK   + G  + S++A  + +   +
Sbjct: 350 KDVQLRIPVPPETVSCHISTSNGKCKFVPEESAIVWKFSKYQGLTENSISATAVPMKDST 409

Query: 385 DNSDHKLKRPVQIKFQIPYFTTSGIQVRYLKINEPKMQYNSYPWVRYITQSGDDYTIR 442
            N +   + P+ +KF+I  F+ SG+ VR+  ++E    Y    W++Y+++SG  Y +R
Sbjct: 410 LNIEQWPRPPISLKFEIVMFSNSGLVVRFFNVSERDRNYKMVKWIKYLSKSG-AYEVR 466

>CAGL0C05203g Chr3 (496561..497988) [1428 bp, 475 aa] {ON} highly
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062c APM4
          Length = 475

 Score =  199 bits (507), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 146/488 (29%), Positives = 241/488 (49%), Gaps = 60/488 (12%)

Query: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60
           M S +    S+G+L++S+ +K+++  +  + F    I+      V  P  +     +  I
Sbjct: 1   MISAVLVFSSRGELIVSKFFKNNLKRSISDIF---RIQVINNLDVRSPILTLGSTTFQHI 57

Query: 61  QHN----DLYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLD 116
           + N    DL+++++T+S +IN   V+ +L+K   +LE Y  +  EE +K+ F++ YELLD
Sbjct: 58  RSNVHGDDLWLVSVTRS-NINCGAVWEFLYKFDHMLELY-GLNNEEFLKEEFMVCYELLD 115

Query: 117 EMM-DHGIPQITDTKMLRQYITQKSFK------LIRSAKKKKNVVRPPATLTNSVS---- 165
            M+ ++G P  TD   + + ++ K  K       I    K   + + P  L  + S    
Sbjct: 116 VMLGENGTPMDTDPATVIKKMSVKPSKETIENFAISVQNKNSTLPKIPKFLRRTSSFLNQ 175

Query: 166 -----------------WRPEGIVYKKNEAFLDVVESINMLLTQQGQVLRSEILGKVKVK 208
                            WRP+GI +KKNE FL V E I++L++++G +L+S + G + + 
Sbjct: 176 ESSNNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSYVDGTIDLV 235

Query: 209 SRLSGMPDLKLGLNDK---------GIFAQXXXXXXXXXASGGTKKKSNIELEDLKFHQC 259
           + LSG P  + GLND            F           A+ G+     + LED KFHQC
Sbjct: 236 THLSGTPVCQFGLNDSLSVKNDDYGDSFDYIKNKKAIPKAAAGS-----VLLEDCKFHQC 290

Query: 260 VRLTKFENEKIITFIPPDGDFELMSYRLSTPIK-PLIWCDVKLQVHSRSRIEIHCRAKAQ 318
           V L KF+ ++II F+PPDG  ELM Y + + I  P     +     S + +E     K+ 
Sbjct: 291 VSLEKFDKDRIIKFVPPDGSMELMKYHVRSNINLPFKVSPIVTYSSSGTAVEYRITLKSL 350

Query: 319 IKKKSTANNVEILIPVPEDADSPKFRYSHGTIKWVPSQNAILWKIKSFPGGKDYSMAA-- 376
              K TA NV + IPVP +    K   S+G+ K+ P + A+LW    + G  + +++A  
Sbjct: 351 FPSKLTAKNVTMKIPVPPETLDCKIDVSNGSCKFAPEEKAMLWTFNKYNGLTENTLSAVT 410

Query: 377 --EMGLPSVSDNSDHKLKRPVQIKFQIPYFTTSGIQVRYLKINEPKMQYNSYPWVRYITQ 434
                 P +  N     K P+ + F+I  F+ SG+ VRY  I E + +Y +  W+RY+++
Sbjct: 411 ITSKDAPRL--NIQQWQKPPISLDFEIMMFSNSGLVVRYFTIKESE-RYKTVKWIRYVSK 467

Query: 435 SGDDYTIR 442
           SG  Y IR
Sbjct: 468 SG-SYEIR 474

>NDAI0G02920 Chr7 complement(676413..677873) [1461 bp, 486 aa] {ON}
           Anc_3.165
          Length = 486

 Score =  198 bits (503), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 145/498 (29%), Positives = 243/498 (48%), Gaps = 67/498 (13%)

Query: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60
           M +GI     +G+L++S+ +K  +  +  + F    I+      V  P  +     +  I
Sbjct: 1   MINGILIYSPRGELIVSKLFKGTLKRSIADIFR---IQVINNLDVRSPILTLGSTTFHHI 57

Query: 61  QH----NDLYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLD 116
           +     ++L+++  T++ + N A ++ +L+KL  +L EY  + +EE +K+ F+I++ELLD
Sbjct: 58  RSSKDSDNLWLVAATRN-NANSAAIWEFLYKLDSMLIEY-GLNKEEYLKEEFMIVHELLD 115

Query: 117 EMMDH-GIPQITDTKMLRQYITQKSFKLIRS----------AKKKKNVVRPPATLT---- 161
            M+   GIP  T+   +   ++ K  KL  +            K  N +  P  L     
Sbjct: 116 VMLGSCGIPLETEPSKVIAKMSVKPAKLHHNNTSSLLDGHLGSKGNNEISMPKFLKRNDS 175

Query: 162 ----------NSVSWRPEGIVYKKNEAFLDVVESINMLLTQQGQVLRSEILGKVKVKSRL 211
                     N  SWRP+ I +KKNE  L V E IN+L+ + G +L++ + G + +++RL
Sbjct: 176 SQSHDSNFSFNDFSWRPKDIKHKKNEVILHVNEKINILVAKDGSILKAYVDGSIDLQTRL 235

Query: 212 SGMPDLKLGLNDKGIFAQXXXXXXXXXASGGTKKKS-----------------NIELEDL 254
           SG P  + GLND                  G  K S                 N+ LED 
Sbjct: 236 SGTPVCQFGLNDSLTLGSNDSEYSSRNGRTGNNKSSMLDSNLSNKVLSKASVGNVILEDC 295

Query: 255 KFHQCVRLTKFENEKIITFIPPDGDFELMSYR----LSTPIK--PLIWCDVKLQVHSRSR 308
           KFHQCV L KF+ E+II F+PPDG  ELM Y     L+ P K  P++   V     +   
Sbjct: 296 KFHQCVSLDKFDRERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIVTNSV-----TGDA 350

Query: 309 IEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGTIKWVPSQNAILWKIKSFPG 368
           ++     K+    + +A  V + IPVP          S+GT K+VP++NA++WK   + G
Sbjct: 351 LDYRIALKSLFPGRLSAKGVVLHIPVPPGVMDCNISVSNGTCKFVPAENAMVWKFNKYNG 410

Query: 369 GKDYSMAAEMGLPS--VSDNSDHKLKR-PVQIKFQIPYFTTSGIQVRYLKINEPKMQYNS 425
             + +++A + +PS  V+  +  +  R P+ + F+I  F+ SG+ VRY  I+E    Y +
Sbjct: 411 LTENTLSA-VTVPSKEVNQTTLQQWARPPMSLDFEILMFSNSGLVVRYFTISEGHQNYKA 469

Query: 426 YPWVRYITQSGDDYTIRM 443
             W++Y+++SG  Y +R 
Sbjct: 470 VKWIKYVSKSG-SYEVRF 486

>YOL062C Chr15 complement(210520..211995) [1476 bp, 491 aa] {ON}
           APM4Mu2-like subunit of the clathrin associated protein
           complex (AP-2); involved in vesicle transport
          Length = 491

 Score =  196 bits (498), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 147/502 (29%), Positives = 249/502 (49%), Gaps = 72/502 (14%)

Query: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60
           M SG+    S+G+L+L++ +K+ +  +  + F   +I       V  P  +     +  I
Sbjct: 1   MISGVLVYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLD---VRSPVLTLGSTTFHHI 57

Query: 61  Q--HND-LYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDE 117
           +  H D L+++T+T+S + N A ++ +L+KL  V+  Y ++  EE++K+ F+I++E+LD 
Sbjct: 58  RSRHGDNLWLVTITRS-NANSAAIWEFLYKLDAVMNAY-RLDREEALKEEFMIVHEMLDI 115

Query: 118 MMD-HGIPQITDTKMLRQYITQKSFKLIRS-------------------AKKKKNVVRPP 157
           M+  +GIP  T+   L   I Q S K +R+                          +  P
Sbjct: 116 MLGGNGIPIDTE---LNSVIAQMSVKPVRNMGGLLDSPDGNDVLSSSSSPTSSAGELHFP 172

Query: 158 ATLT-------------------NSVSWRPEGIVYKKNEAFLDVVESINMLLTQQGQVLR 198
             LT                   N ++WRP+GI++KK+E FL V E IN+L+++ G +L+
Sbjct: 173 KFLTKRSSSFLGQGDSTSDFYDNNKITWRPKGIIHKKDEVFLYVNERINILVSRDGSILK 232

Query: 199 SEILGKVKVKSRLSGMPDLKLGLND---------KGIFAQXXXXXXXXXASGGTKKKS-- 247
           S + G + + + LSG P  + GLND         K   AQ          +     K+  
Sbjct: 233 SYVDGTIDITTHLSGTPICRFGLNDSLGMQSEDEKKWLAQQQRHSGSDFGNKNFIPKAAA 292

Query: 248 -NIELEDLKFHQCVRLTKFENEKIITFIPPDGDFELMSYRLSTPIKPLIWCDVKLQVHSR 306
            ++ LED KFH+CV L KF    II F+PPDG  ELM Y +   I  L +    +  HS 
Sbjct: 293 GSVLLEDCKFHECVSLDKFNRNHIIEFVPPDGSMELMKYHVRDNIN-LPFKVTPIVTHST 351

Query: 307 SRIEIHCRA--KAQIKKKSTANNVEILIPVPEDADSPKFRYSHGTIKWVPSQNAILWKIK 364
              EI  R   K+    K +A +V + IPVP      K   S+G  K+VP +NA++W+  
Sbjct: 352 RDNEIDYRITLKSLFPGKLSAKDVVLHIPVPPSTVDCKISVSNGHCKFVPEENAMIWRFN 411

Query: 365 SFPGGKDYSMAAEMGLPSVSDNSDHKLKR----PVQIKFQIPYFTTSGIQVRYLKINEPK 420
            + G  + +++A     S SD +   L++    P+ ++F++  F+ SG+ VRY  I+   
Sbjct: 412 KYNGLTENTLSAVT--VSTSDTTQLNLQQWTRPPISLEFEVMMFSNSGLVVRYFTISGKD 469

Query: 421 MQYNSYPWVRYITQSGDDYTIR 442
            ++ +  W++YI+++G  Y +R
Sbjct: 470 SKHRAVKWIKYISKAG-SYEVR 490

>ADR315W Chr4 (1259839..1261317) [1479 bp, 492 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL062C (APM4)
          Length = 492

 Score =  196 bits (497), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 124/431 (28%), Positives = 218/431 (50%), Gaps = 31/431 (7%)

Query: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60
           M    +    +G L++S+    +   +  E F   +I   +   +  P  +     +  I
Sbjct: 1   MIDAFFVFAPRGSLIVSKLISGEAKESLSEVFRLQVINGLE---IRSPVLTLGSTTFQHI 57

Query: 61  QHNDLYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDEMMD 120
           + +    + +    + + A ++ +L+ + ++L+ Y  +  EE++ D+F++ YELLD ++D
Sbjct: 58  RTSGGLWMVVVVRGNADSAAIWEFLYHMNKLLDAY-AINTEEALLDDFMLCYELLDVVLD 116

Query: 121 HGIPQITDTKMLRQYITQK--------------SFKLIRSAKKKKNVVRPPATLTNSVSW 166
            G+PQ T+   +   +++K              S +L R+  K  +V        +   W
Sbjct: 117 SGLPQDTELSHIVPLLSRKPATGESASGDDFLNSARLRRTGTKNVSVETLDHFSRDVCPW 176

Query: 167 RPEGIVYKKNEAFLDVVESINMLLTQQGQVLRSEILGKVKVKSRLSGMPDLKLGLNDKGI 226
           R EGI YKKNE +LDV+E +++L+ + G +L++ + G V+  + LSGMP    G ND   
Sbjct: 177 RGEGIKYKKNEVYLDVIEKLSLLVNRDGTILKAYVDGTVQCTAHLSGMPLCHFGFNDSQS 236

Query: 227 FAQXXXXXXXXXASGGTKKKSNIELEDLKFHQCVRLTKFENEKIITFIPPDGDFELMSYR 286
             Q            GT ++ ++ LED KFHQCV+L KF+ E++I F+PPDG+FELM Y 
Sbjct: 237 LRQRSPRRQYAPRVFGTDERESVVLEDCKFHQCVQLNKFDQERVIRFVPPDGEFELMKYH 296

Query: 287 LSTPIK-PLIWCDVKLQVHSRSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKFRY 345
           +   ++ P     V  +V+ RS IE     ++    K +A +VE+ IP P    S K   
Sbjct: 297 IRDDLRPPFKVTPVVSKVNERS-IEYRITLQSLFPTKLSAKDVELYIPAPPYTISAKVNV 355

Query: 346 SHGTIKWVPSQNAILWKIKSFPGGKDYSMAAEMGLPSVSDNSDHKL-------KRPVQIK 398
           S G  K+VP +NAI+WKI  F G  + +++A     +++D   H         + P+ +K
Sbjct: 356 SCGKCKFVPEENAIIWKIHKFHGLTENTLSA----VTIADEQGHYAQVLDQWPRPPISMK 411

Query: 399 FQIPYFTTSGI 409
            +I  F+T+ +
Sbjct: 412 LEIMMFSTAAL 422

>Suva_15.103 Chr15 complement(183026..184501) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  193 bits (491), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 142/505 (28%), Positives = 252/505 (49%), Gaps = 78/505 (15%)

Query: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60
           M SG+    S+G+L+L++ +K+ +  +  + F   +I       V  P  +     +  I
Sbjct: 1   MISGVLVYSSRGELILNKFFKNSLKRSISDIFRVQVINNLD---VRSPVLTLGSTTFHHI 57

Query: 61  QH---NDLYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDE 117
           +    ++L+++T+T+S + N A ++ +L+KL  V+  Y ++  EE++K+ F+I++E+LD 
Sbjct: 58  RSMRGDNLWLVTITRS-NANSAAIWEFLYKLDSVMNAY-RLDREEALKEEFMIVHEMLDI 115

Query: 118 MMD-HGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPATL---------------- 160
           M+  +GIP  T+   L   I Q S K IR+      ++  P ++                
Sbjct: 116 MLGGNGIPIDTE---LNSVIAQMSVKPIRNVG---GLLESPDSIDMLSSTSSPSSVGGEL 169

Query: 161 -------------------------TNSVSWRPEGIVYKKNEAFLDVVESINMLLTQQGQ 195
                                     N ++WRP+GI++KK+E FL V E +N+L+++ G 
Sbjct: 170 HFPKFLKKRSSSFLGQGDSHSDFSDGNKIAWRPKGIIHKKDEVFLYVNERMNILVSRDGS 229

Query: 196 VLRSEILGKVKVKSRLSGMPDLKLGLNDK-GIFAQXXX---XXXXXXASGGTKKKS---- 247
           +L+S + G + + + LSG P  + GLND  G+ ++            +  G + K+    
Sbjct: 230 ILKSYVDGTIDITTHLSGTPVCRFGLNDSLGMQSEDQENWLSQQDQHSHNGFENKNCFPK 289

Query: 248 ----NIELEDLKFHQCVRLTKFENEKIITFIPPDGDFELMSYRLSTPIKPLIWCDVKLQV 303
               ++ LED KFH+CV + KF    II F+PPDG  ELM Y +   I  L +    +  
Sbjct: 290 AAAGSVLLEDCKFHECVSIDKFNKNHIIEFVPPDGSMELMKYHVRDNIN-LPFKITPIVA 348

Query: 304 HSRSRIEIHCRA--KAQIKKKSTANNVEILIPVPEDADSPKFRYSHGTIKWVPSQNAILW 361
           HS    E+  R   K+    K +A +V + IPVP      K   S+G  K+VP +NA++W
Sbjct: 349 HSARDNEVDYRITLKSLFPGKLSAKDVILHIPVPPSTVDCKISVSNGNCKFVPEENAMIW 408

Query: 362 KIKSFPGGKDYSMAAEMGLPSVSDNSDHKLKR----PVQIKFQIPYFTTSGIQVRYLKIN 417
           +   F G  + +++A     S SD +   L++    P+ + F++  F+ SG+ VRY  I+
Sbjct: 409 RFNKFNGLTENTLSAVT--VSTSDTTQLSLQQWTRPPMSLDFEVMMFSNSGLVVRYFTIS 466

Query: 418 EPKMQYNSYPWVRYITQSGDDYTIR 442
               ++ +  W++YI++SG  Y +R
Sbjct: 467 SRDSKHRAVKWIKYISKSG-SYEVR 490

>Kpol_1045.44 s1045 complement(103089..104498) [1410 bp, 469 aa]
           {ON} complement(103091..104500) [1410 nt, 470 aa]
          Length = 469

 Score =  189 bits (480), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 136/481 (28%), Positives = 230/481 (47%), Gaps = 52/481 (10%)

Query: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60
           M +G+     KG+L++S+  K +   +  + F   +I       V  P  +     +  I
Sbjct: 1   MINGVLVYTGKGELIVSKFSKSNAKRSISDIFRVQVINNLD---VRSPILTLGSTTFHHI 57

Query: 61  QHND---LYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDE 117
           + N    L+++ +T+S + N   ++ +L+K   +L  +  +  E ++K+ F+  YELLD 
Sbjct: 58  RSNSRDHLWLVAVTRS-NANSGAIWEFLYKFDSLLNAF-GLDNETTLKEEFMTCYELLDL 115

Query: 118 MMD-HGIPQITDTKMLRQYITQKSFKLIR--------------------SAKKKKNVVRP 156
           M++  G+P  T+   +   ++ K    I                     +   +   V  
Sbjct: 116 MLNVDGVPLDTELSSVSAKMSTKPLHSINSPSDSSLDNSSSPLSISKFLNRNNRSMSVDT 175

Query: 157 PATLTNSVSWRPEGIVYKKNEAFLDVVESINMLLTQQGQVLRSEILGKVKVKSRLSGMPD 216
             T  ++  WRP GI YKKNE FL++ E I++L+++   +L++ + G V + S LSG P 
Sbjct: 176 MNTEPSNYPWRPNGIKYKKNEIFLNINEKISILVSKDETILKAYVDGTVDLTSHLSGTPT 235

Query: 217 LKLGLNDKGIFAQXXXXXXXXXASGGTKKKSNIE--------LEDLKFHQCVRLTKFENE 268
            + GLND                  G + + NI         LED KFH+CV L KF  +
Sbjct: 236 CQFGLNDS---LSVDEPNYYNSDDNGFRNQQNIPRATAGTVVLEDCKFHECVSLDKFNRD 292

Query: 269 KIITFIPPDGDFELMSYRLSTPIK-PLIWCDVKLQVHSRSRIEIHCRAKAQIKKKSTANN 327
           +II F+PPDG  ELM Y +   I  P       +   SR+ ++     K+    K +AN+
Sbjct: 293 RIIKFVPPDGHIELMKYHVRDNINLPFKVTPNVINSRSRTGLDYRITLKSLFPSKLSAND 352

Query: 328 VEILIPVPEDADSPKFRYSHGTIKWVPSQNAILWKIKSFPGGKDYSMAAEMGLPSVSDNS 387
           V + IPVP      K   S+G  ++VP ++ I+WK   + G  +  ++A     +VS N 
Sbjct: 353 VVLKIPVPSSTVDCKLNVSNGKCRFVPEESCIIWKFAKYNGLTENKLSA----VTVSSND 408

Query: 388 DHKL------KRPVQIKFQIPYFTTSGIQVRYLKINEPKMQYNSYPWVRYITQSGDDYTI 441
             +L      + P+ + F+I  F+ SG+ VRYLKI E   +Y +  W++YI++SG  Y +
Sbjct: 409 TTQLMLQQWARPPISLDFEIMMFSNSGLVVRYLKIMEKDQKYRTVKWIKYISRSG-SYEV 467

Query: 442 R 442
           R
Sbjct: 468 R 468

>Smik_15.96 Chr15 complement(174750..176225) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  189 bits (481), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 145/502 (28%), Positives = 246/502 (49%), Gaps = 72/502 (14%)

Query: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60
           M SG+    S+G+L+L++ +K+ +  +  + F   +I       V  P  +     +  I
Sbjct: 1   MISGVLIYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLD---VRSPVLTLGSTTFHHI 57

Query: 61  Q--HND-LYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDE 117
           +  H D L+++T+T+S + N A ++ +L+KL  V+  Y ++  EE++K+ F+I++E+LD 
Sbjct: 58  RSRHGDNLWLVTITRS-NANSAAIWEFLYKLDFVMNAY-RLDREEALKEEFMIVHEMLDI 115

Query: 118 MMD-HGIPQITDTKMLRQYITQKSFKLIRSA----------------------------- 147
           M+  +GIP  T+   L   I Q S K +R+                              
Sbjct: 116 MLGGNGIPIDTE---LNSVIAQMSVKPVRNTGGLLDSPDGNDMLSSSSSPSSVSGELHFP 172

Query: 148 ----KKKKNVVRPPATLT-----NSVSWRPEGIVYKKNEAFLDVVESINMLLTQQGQVLR 198
               K   + +    + +     N ++WRP+GI +KK+E FL V E +N+L+++ G +L+
Sbjct: 173 KFLKKSSSSFLGQGDSASDFYDGNKITWRPKGITHKKDEVFLYVNERMNILVSRDGSILK 232

Query: 199 SEILGKVKVKSRLSGMPDLKLGLND---------KGIFAQXXXXXXXXXASGGTKKKS-- 247
           S + G + + + LSG P  + GLND         K   AQ          S     K+  
Sbjct: 233 SYVDGTIDITTHLSGTPICRFGLNDSLGMQSEDEKKWLAQQQHHSRGNFESKNFIHKAAA 292

Query: 248 -NIELEDLKFHQCVRLTKFENEKIITFIPPDGDFELMSYRLSTPIKPLIWCDVKLQVHSR 306
            ++ LED KFH+CV L KF     I F+PPDG  ELM Y +   I  L +    +  HS 
Sbjct: 293 GSVLLEDCKFHECVSLDKFNKNHTIEFVPPDGSMELMKYHVRDNIN-LPFKITPIVTHST 351

Query: 307 SRIEIHCR--AKAQIKKKSTANNVEILIPVPEDADSPKFRYSHGTIKWVPSQNAILWKIK 364
              EI  R   K+    K +A +V + IPVP      K   S+G  K+VP +NA++W+  
Sbjct: 352 RDNEIDYRITLKSLFPGKLSAKDVTLHIPVPPSTVDCKISVSNGHCKFVPEENAMMWRFN 411

Query: 365 SFPGGKDYSMAAEMGLPSVSDNSDHKLKR----PVQIKFQIPYFTTSGIQVRYLKINEPK 420
            + G  + +++A     S SD +   L++    P+ + F++  F+ SG+ VRY  I    
Sbjct: 412 KYNGLTENTLSAVT--VSTSDTTQLNLQQWTRPPMSLDFEVMMFSNSGLVVRYFTIFGKD 469

Query: 421 MQYNSYPWVRYITQSGDDYTIR 442
            ++ +  W++YI++SG  Y +R
Sbjct: 470 SKHRAVKWIKYISRSG-SYEVR 490

>ABR047W Chr2 (479283..480779) [1497 bp, 498 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHL019C (APM2)
          Length = 498

 Score =  188 bits (477), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 130/465 (27%), Positives = 218/465 (46%), Gaps = 100/465 (21%)

Query: 48  PCFSFNGVQYLFIQHNDLYVLTLTKSMSINVAQ-VFSYLHKLIEVLEEYM-KVVEEESIK 105
           P  S  G  Y++IQ + LY L+L+  +   V   VF+YL +L ++ ++Y+ + +  + I 
Sbjct: 41  PVLSHRGYDYIYIQRDGLYFLSLSYGVETVVPMTVFAYLGQLYQLFKKYLGERLNRQLIM 100

Query: 106 DNFVIIYELLDEMMDHGIPQITDTKMLRQYITQKSFKLIRS--------------AKKKK 151
           DNF ++YEL+DE +D GIPQ+TD  ++R Y+  +  +                  A K++
Sbjct: 101 DNFHLVYELMDESIDMGIPQLTDHNIIRDYVKVQVVRRAEDGEKHAGKHKAKRDKAGKEE 160

Query: 152 NVVRPPA------------TLTNSVSWRPEGIVYKKNEAFLDVVESINMLLT-QQGQVLR 198
               P A            T T+++SWRP GI Y KNE FLDVVE +  L+  ++ QV  
Sbjct: 161 EEADPGAADEHFMNSYIAKTTTSAISWRPRGIYYSKNEFFLDVVEELEYLMDFERAQVRL 220

Query: 199 SEILGKVKVKSRLSGMPDLKLGLNDKGIFAQXXXXXXXXXASGGTKKKSNIELEDLKFHQ 258
           +++ G +  +S LSGMP L +GLN   + AQ                        + FHQ
Sbjct: 221 NQVHGAINCRSYLSGMPQLTVGLNK--MVAQDRDFT-----------------SQVHFHQ 261

Query: 259 CVRLTKFENEKIITFIPPDGDFELMSYRLS-----TPIKPLIWCDVKLQVHSR----SRI 309
           CV L +   ++ ITF+PPDG+F+L  Y+L+      P+  L  C   ++   R     R+
Sbjct: 262 CVDLERLATDRHITFVPPDGEFQLCHYKLARGANEQPLIKLEECRAAVKPRRRPADADRL 321

Query: 310 EIHCRAKAQIKKKSTANNVEILIPVPEDADS--------PKFRYSHGTIKWVPSQNAILW 361
            +        K +   + +++ +P+    +         P+F+   G + +  + + +LW
Sbjct: 322 VLTVSISTNFKLQDATSVLKVRVPLARVFEQWKVDLSFPPRFKCDAGCVMFNITDDYLLW 381

Query: 362 KI---KSFPGGKDYSMAAEMGL----------PSVSDNSDHKLKRPVQ------------ 396
            I   K   G + ++M ++  L            +S + D     P Q            
Sbjct: 382 DIGKAKGSHGDRRFTMQSQFHLYDEAYYSRRRAQLSTSMDPLPAHPGQQLEALYNQTHAS 441

Query: 397 ----------IKFQIPYFTTSGIQVRYLKINEPKMQYNSYPWVRY 431
                     + F++PY T SG++V +LKI EP++QY S+PW+RY
Sbjct: 442 APTHASALLRVDFEVPYHTISGLKVEFLKILEPQLQYQSFPWIRY 486

>TDEL0D04580 Chr4 (840369..841817) [1449 bp, 482 aa] {ON} Anc_3.165
           YOL062C
          Length = 482

 Score =  187 bits (475), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 135/489 (27%), Positives = 241/489 (49%), Gaps = 55/489 (11%)

Query: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60
           M S I    S+G+L++++  K  +  +  + F    I+      V  P  +     +  I
Sbjct: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIF---RIQVINNLDVRSPILTLGSTTFHHI 57

Query: 61  QHN---DLYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDE 117
           + +    L+++ +++S + N   ++ +L+KL  +++ Y  + +E ++K+NF+  YE+LD 
Sbjct: 58  RSDGSDSLWLVAVSRS-NANSGAIWEFLYKLNVIMDVY-GLTKEGTLKENFMNCYEILDT 115

Query: 118 MMDHG-IP------------------QITDTKMLR-QYITQKSFKLIRSAKKKKNVVRPP 157
           +++ G IP                  QI+   + R   +T  S  L         +  P 
Sbjct: 116 VLEEGGIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLTMSSLNLSTPGDSSSTLSMPK 175

Query: 158 ATLTNS--------------VSWRPEGIVYKKNEAFLDVVESINMLLTQQGQVLRSEILG 203
               N+              +SWRP GI YKKNE  L+V E I++L+++ G +L+S + G
Sbjct: 176 FLTRNNRSMSQDLGSNYPSNLSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVDG 235

Query: 204 KVKVKSRLSGMPDLKLGLNDKGI--FAQXXXXXXXXXASGGTKKKS---NIELEDLKFHQ 258
            + + + LSGMP  + GLND     F           A+     K+    + LED KFHQ
Sbjct: 236 TIDLTTHLSGMPICQFGLNDSLSVEFGDDSISEVEDFANKKAIPKAAAGRVMLEDCKFHQ 295

Query: 259 CVRLTKFENEKIITFIPPDGDFELMSYRLSTPIK-PLIWCDVKLQVHSRSRIEIHCRAKA 317
           CV L KF  +++I F+PPDG  ELM Y +   +  P     +   +   + I+     K+
Sbjct: 296 CVSLDKFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKVTPIVTSIGRGNTIDYRVTLKS 355

Query: 318 QIKKKSTANNVEILIPVPEDADSPKFRYSHGTIKWVPSQNAILWKIKSFPGGKDYSMAAE 377
               K +A +V + IPVP      +   S+G  K+VP ++A++WK   + G  + +++A 
Sbjct: 356 LFPGKLSAKDVSLRIPVPPGTVDCEINVSNGKCKFVPEESAMIWKFTKYTGLTENTLSA- 414

Query: 378 MGLPSVSDNSDHKLKR----PVQIKFQIPYFTTSGIQVRYLKINEPKMQYNSYPWVRYIT 433
           + +PS SD +   +++    P+ + F+I  F+ SG+ VRY K+++   +Y +  W++YI+
Sbjct: 415 VTVPS-SDTTQLTVQQWPRPPMSLNFEIMMFSNSGLVVRYFKVSDKDERYRTAKWIKYIS 473

Query: 434 QSGDDYTIR 442
           +SG  Y IR
Sbjct: 474 KSG-SYEIR 481

>TBLA0F00840 Chr6 (213915..215360) [1446 bp, 481 aa] {ON} Anc_3.165
           YOL062C
          Length = 481

 Score =  187 bits (474), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 127/487 (26%), Positives = 234/487 (48%), Gaps = 52/487 (10%)

Query: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60
           M + +     +G+LL+ + +K  +     + F   +I  +   ++  P  +     + FI
Sbjct: 1   MINAVMIFTPRGELLVFKVFKSSVKRTISDIFRVQVINND---NIRSPILTLGSTTFHFI 57

Query: 61  Q---HNDLYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDE 117
           +    + L+++ +T+S + +   ++ YL+KL  ++E Y  +  E+ +KD F++ +ELLD 
Sbjct: 58  RTTAGSKLWLVAVTRS-NADSGAIWEYLYKLNSLMEVY-GLTHEDILKDEFIVCHELLDI 115

Query: 118 MMD-HGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPATLT--------------- 161
            +  +G+P  T+   +   +T K  +++ S+  + +++    T                 
Sbjct: 116 TLGMNGLPMDTELSSVIGKMTLKPAQVLTSSADRSDILASSVTTLGHNSTPISMPKFLSR 175

Query: 162 ----------------NSVSWRPEGIVYKKNEAFLDVVESINMLLTQQGQVLRSEILGKV 205
                           +++ WR   I YKKNE  ++V+E IN+L+ +   +LR+ + G +
Sbjct: 176 NSNRSVTQEFESQFSPSNIPWRSRDIKYKKNEMIVNVIEKINVLVGKDDNILRAYVDGTI 235

Query: 206 KVKSRLSGMPDLKLGLNDKGIFAQXXXXXXXXXASGGTKKK------SNIELEDLKFHQC 259
            + + LSGMP  ++G+ND                    +          + LE  KFHQC
Sbjct: 236 DITAHLSGMPMCQIGMNDLSTIQGGENAHWTNEDRASNRDAMPDVSGDRVILEGSKFHQC 295

Query: 260 VRLTKFENEKIITFIPPDGDFELMSYRLSTPIK-PL-IWCDVKLQVHSRSRIEIHCRAKA 317
           V L K+  + +I FIPPDG FELM Y +S  +  P  I   V L  H  + +    + K+
Sbjct: 296 VALDKYNKDNVIWFIPPDGQFELMKYHVSNNLNLPFRITPQVTLTSHGTA-LSYAIKLKS 354

Query: 318 QIKKKSTANNVEILIPVPEDADSPKFRYSHGTIKWVPSQNAILWKIKSFPGGKDYSMAAE 377
              +K +A NV + IPVP      K   S G  K++P +N ++W    F G  +  + A+
Sbjct: 355 LFPRKLSAENVVLRIPVPPGTLDCKINASDGKCKFIPEENCMVWSFHRFNGSTENHLNAQ 414

Query: 378 -MGLPSVSDNSDHKLKR-PVQIKFQIPYFTTSGIQVRYLKINEPKMQYNSYPWVRYITQS 435
            +   S++  S  +  R P+ + F++  F+ +G+ VRYLK+ E  M YN+  W++YI+ +
Sbjct: 415 TVPTQSIASQSIKQWTRPPMSLDFKVLMFSNTGLIVRYLKVQEKNMHYNTIKWIKYISAA 474

Query: 436 GDDYTIR 442
           G  Y +R
Sbjct: 475 G-SYEVR 480

>Kwal_26.8146 s26 (665689..667206) [1518 bp, 505 aa] {ON} YHL019C
           (APM2) - Similiar to clathrin coat proteins [contig 55]
           FULL
          Length = 505

 Score =  187 bits (475), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 145/530 (27%), Positives = 249/530 (46%), Gaps = 112/530 (21%)

Query: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60
           M+S I+  D +   L+ + +K        E F +   E  + S+V  P     G+ ++ I
Sbjct: 1   MSSSIFLLDEQLNPLIVKSFKS---VQHPEAFAYRFKEVYKVSNV--PVIYHKGIVFISI 55

Query: 61  QHNDLYVLTLT-KSMSINVAQVFSYLHKLIEVLEEYMKV--VEEESIKDNFVIIYELLDE 117
             + LY ++++  S+  ++     YL+    +L++Y++V  ++   I DNF +IYELLDE
Sbjct: 56  CRDGLYFVSMSVGSLRSSIMSTLVYLNDFHMLLKKYLRVNALDRTRIVDNFNLIYELLDE 115

Query: 118 MMDHGIPQITDTKMLRQYITQKSF-----KLIRS-------AKKKKNVVRPPA------- 158
            +D GIPQ+TD  ++R  I  +       K+ RS        +++ NV            
Sbjct: 116 SLDFGIPQLTDFNIIRDSIKIQPNIPPDPKIARSNSDDDESEQEESNVAETQEKSNKHGF 175

Query: 159 -------------TLTNSVSWRPEGIVYKKNEAFLDVVESINMLLT-QQGQVLRSEILGK 204
                        T T ++SWRP+GI Y KNE F+DV+ES   ++  +  QV ++ I G+
Sbjct: 176 QDDEEYINSFVLRTTTQAISWRPKGIYYAKNELFVDVIESQAYVMDFKHHQVRKNFIFGR 235

Query: 205 VKVKSRLSGMPDLKLGLNDKGIFAQXXXXXXXXXASGGTKKKSNIELEDLKFHQCVRLTK 264
           +  +S LSGMP +K+ +N                      K  +  L   KFHQCV L  
Sbjct: 236 IICRSYLSGMPVVKICIN-------------------KMLKDRDQFLSSAKFHQCVSLES 276

Query: 265 FENEKIITFIPPDGDFELMSYRL-----STPIKPLIWCDVKLQVHSRSRIEIHCRAKAQI 319
             ++  I FIPPDGDF+L  Y++      +P+  LI   V ++   + +++I  + +   
Sbjct: 277 LSSQDFIEFIPPDGDFQLCEYKIKRHISDSPVIKLIEYKV-VEKPKKHKLQISMKIQPHF 335

Query: 320 KKKSTANNVEILIPVPEDADS--------PKFRYSHGTIKWVPSQNAILWKIKSFPGGKD 371
           K +++A  ++I +P+ +  ++        P+F+   G+I +  S   +LWK     GG  
Sbjct: 336 KAQNSATFLDIRVPIQDIFETYKIDLTKQPRFKCDFGSILFNLSDGYLLWKANGMKGGHG 395

Query: 372 ---YSMAAEM-------------------------------GLPSVSDNSDHKLKRPVQ- 396
              +SM  E                                 L +++     ++  PV+ 
Sbjct: 396 ETYHSMQVEFFLFDAEAHRKEAEELKNSMDPPPLREGVRMEELYALAHEEKGQINNPVRN 455

Query: 397 ---IKFQIPYFTTSGIQVRYLKINEPKMQYNSYPWVRYITQSGDDYTIRM 443
               +F++PYFT+SG++V YLKI E ++QY S+PWVRY T +  +Y  +M
Sbjct: 456 MITAEFEVPYFTSSGLRVEYLKIEEEQLQYQSFPWVRYKTINDTEYAFQM 505

>KLTH0D07502g Chr4 (650799..652313) [1515 bp, 504 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019C APM2
           homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 504

 Score =  187 bits (474), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 148/537 (27%), Positives = 250/537 (46%), Gaps = 127/537 (23%)

Query: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60
           M+S ++  D +   L+ R  K    + A  ++  L  ++    S  P  +S  G+ Y++I
Sbjct: 1   MSSCVFILDEQLNPLILRNLK----SIAHPEWYALYFKRVHPQSRGPVIYS-KGIIYIYI 55

Query: 61  QHNDLYVLTLTKS-MSINVAQVFSYLHKLIEVLEEYMKV--VEEESIKDNFVIIYELLDE 117
             + LY ++++   +  N+  + +YL+    +L +Y+KV  V+   I DNF +IYEL DE
Sbjct: 56  LRDGLYFVSVSNGGLRFNLMGILAYLNDFHALLVKYLKVNKVDRTGIIDNFNLIYELFDE 115

Query: 118 MMDHGIPQITDTKMLRQYI-----------------TQKSFKLIRSAKKKKN-------- 152
            +D+GIPQ+TD  ++R  I                  ++S   I  +K+ K+        
Sbjct: 116 SLDYGIPQLTDYNIIRDSIKIEANVPKVPSNSQADSDEESGPEILQSKENKDKADIHGFR 175

Query: 153 ---------VVRPPATLTNSVSWRPEGIVYKKNEAFLDVVESINMLLT-QQGQVLRSEIL 202
                    V+R   T T ++SWRP+GI Y KNE F+D++E  + L+  +  QV ++ + 
Sbjct: 176 DDEQYINSFVLR---TTTQAISWRPKGIYYTKNELFVDIIERQSYLMDFKNSQVRQTFVY 232

Query: 203 GKVKVKSRLSGMPDLKLGLN----DKGIFAQXXXXXXXXXASGGTKKKSNIELEDLKFHQ 258
           GK+  +S LSGMP +++ +N    DK +F                       L   KFHQ
Sbjct: 233 GKINCRSYLSGMPIVRVCINKMLKDKDLF-----------------------LGSSKFHQ 269

Query: 259 CVRLTKFENEKIITFIPPDGDFELMSYRL-----STPIKPLIWCDVKL-QVHSRSRIEIH 312
           CV L    ++  I FIPPDGDF+L  Y+L      +PI  LI  D K+ +   + R+ + 
Sbjct: 270 CVSLESLSSQDYIEFIPPDGDFQLCEYKLKRHINDSPIIKLI--DYKINERQKKHRLHLS 327

Query: 313 CRAKAQIKKKSTANNVEILIPVP--------EDADSPKFRYSHGTIKWVPSQNAILWKIK 364
              +   K +++A  ++I IP          +   +P+F+  HG++ +  S   +LW  +
Sbjct: 328 VTIQPHFKAQNSATALKIHIPTRDLFQNYKIDLTKAPRFKCDHGSVFFNLSDELLLWDAQ 387

Query: 365 SFPGGK---DYSMAAEMGL--------------------------------PSVSDNSDH 389
              GG     YSM  E  L                                  V  N + 
Sbjct: 388 GIKGGHGETSYSMHVEFALFDEEEHARKLEQIKKSMDPPPLREGAHLEELYAQVKSNKEG 447

Query: 390 KLK---RPVQIKFQIPYFTTSGIQVRYLKINEPKMQYNSYPWVRYITQSGDDYTIRM 443
           K +     +  +F++PY+T+SG++V YLKI+E  ++Y S+ WVRY T +  +Y  ++
Sbjct: 448 KGQFQSNAITAEFEVPYYTSSGLRVEYLKISEENLKYQSFSWVRYKTINDTEYAYQV 504

>ZYRO0B04840g Chr2 (389669..391099) [1431 bp, 476 aa] {ON} highly
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 476

 Score =  186 bits (471), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 136/490 (27%), Positives = 242/490 (49%), Gaps = 63/490 (12%)

Query: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60
           M + I+   ++G+L++S+ + + +  +  + F    I+      V  P  +     +  I
Sbjct: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIF---RIQVINNLDVRSPILTLGSTTFHHI 57

Query: 61  QHN---DLYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDE 117
           + N    L+++T++++ + N   ++ +L+K   +L+ Y  + +EE +K++F+I YE+LD 
Sbjct: 58  RSNGSDSLWIVTVSRT-NANSGAIWEFLYKFNAILDAY-DLTKEEKLKEDFMICYEILDV 115

Query: 118 MMDH-GIPQITDTKMLRQYITQKSFKLIRSAKKKK---------------NVVRPPATLT 161
           ++   GIP  T+   +   I+ K  K   ++ + K               N+  P     
Sbjct: 116 VIGAGGIPMDTELGSIASKISVKPPKSGGTSSEPKSSTVANFPGSNLSTSNLSMPKFLTR 175

Query: 162 NSVS--------------WRPEGIVYKKNEAFLDVVESINMLLTQQGQVLRSEILGKVKV 207
           N+ S              WRP GI YKKNE FL V E IN+L+++ G +L++ + G + +
Sbjct: 176 NNRSMSQDLGTNYPSNFPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDGTIDM 235

Query: 208 KSRLSGMPDLKLGLNDK-----GIFAQXXXXXXXXXASGGTKKKSNIELEDLKFHQCVRL 262
            + LSG P  + GLND      G              +       ++ LED KFHQCV L
Sbjct: 236 TTHLSGTPICQFGLNDSPSVEFGDSLWLDTQEFHNKKAVPKAAAGSVMLEDCKFHQCVSL 295

Query: 263 TKFENEKIITFIPPDGDFELMSY----RLSTPIK--PLIWCDVKLQVHSRSRIEIHCRAK 316
            KF  E+II F+PPDG+ ELM Y     L+ P K  P++           S +E     K
Sbjct: 296 DKFNKERIIKFVPPDGNMELMKYCVRDNLNLPFKITPVV-------TPCGSTVEYRITLK 348

Query: 317 AQIKKKSTANNVEILIPVPEDADSPKFRYSHGTIKWVPSQNAILWKIKSFPGGKDYSMAA 376
           +    K +A +V + IPVP      K   S+G  K+   +NA++W+   + G  + +++A
Sbjct: 349 SLFPNKLSAKDVALHIPVPPGTVDCKINISNGKCKFESEENAMVWRFNKYHGLTENTLSA 408

Query: 377 EMGLPSVSDNSDHKLKR----PVQIKFQIPYFTTSGIQVRYLKINEPKMQYNSYPWVRYI 432
            + +P+ SD +   L++    P+ + F+I  F+ SG+ VRY ++++   +Y    W++YI
Sbjct: 409 -VTVPT-SDTTQLTLQQWPRPPMSLGFEIMMFSNSGLVVRYFRVSDKDEKYRVVKWIKYI 466

Query: 433 TQSGDDYTIR 442
           ++SG  Y +R
Sbjct: 467 SKSG-SYEVR 475

>Skud_15.91 Chr15 complement(169608..171083) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  185 bits (469), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 142/502 (28%), Positives = 245/502 (48%), Gaps = 72/502 (14%)

Query: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60
           M SG+    S+G+L+L++ +K+ +  +  + F   +I       V  P  +     +  I
Sbjct: 1   MISGVLVYSSRGELILNKFFKNSLKRSISDIFRVQVINNLD---VRSPVLTLGSTTFHHI 57

Query: 61  Q--HND-LYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDE 117
           +  H D L+++T+T+S + N A ++ +L+KL  V+  Y ++  EE++K+ F+I++E+LD 
Sbjct: 58  RSKHGDNLWLVTITRS-NANSAAIWEFLYKLDAVMNAY-RLDREEALKEEFMIVHEMLDI 115

Query: 118 MMD-HGIPQITDTKMLRQYITQKSFKLIRSA----------------------------- 147
           M+  +GIP  T+   L   + + S K +R+                              
Sbjct: 116 MLGGNGIPIDTE---LNSVVARMSVKPMRNTGGLLDGADGSDILSSSSSPSSAGGELHFP 172

Query: 148 ---KKKKNVVRPPATLT------NSVSWRPEGIVYKKNEAFLDVVESINMLLTQQGQVLR 198
              KK  +        T      N ++WR  GI++KK+E FL V E +N+L+++ G +L+
Sbjct: 173 KFLKKSSSSFLGQGDSTSDFYDSNKITWRATGIIHKKDEVFLYVNERMNILVSRDGSILK 232

Query: 199 SEILGKVKVKSRLSGMPDLKLGLND---------KGIFAQXXXXXXXXXASGGTKKKS-- 247
           S + G + + + L+G P  + GLND         K   AQ          +     K+  
Sbjct: 233 SYVDGTIDIVTHLNGTPVCRFGLNDSLGMQSEDEKNWLAQQHQHSRSDFGNKNFLPKAAA 292

Query: 248 -NIELEDLKFHQCVRLTKFENEKIITFIPPDGDFELMSYRLSTPIKPLIWCDVKLQVHSR 306
            ++ LED KFH+CV + KF    II FIPPDG  ELM Y +   I  L +    +  HS 
Sbjct: 293 GSVLLEDCKFHECVSIEKFNKNHIIEFIPPDGSMELMKYHVRDNIN-LPFKITPIVSHST 351

Query: 307 SRIEIHCRA--KAQIKKKSTANNVEILIPVPEDADSPKFRYSHGTIKWVPSQNAILWKIK 364
              EI  R   K+    K +A +V + IPVP      K   S+G  K+VP +NA++W+  
Sbjct: 352 RDNEIDYRITLKSLFPGKLSAKDVILHIPVPPSTVDCKISVSNGHCKFVPEENAMIWRFN 411

Query: 365 SFPGGKDYSMAAEMGLPSVSDNSDHKLKR----PVQIKFQIPYFTTSGIQVRYLKINEPK 420
            + G  + +++A     S SD +    ++    P+ + F++  F+ SG+ VRY  I+   
Sbjct: 412 KYNGLTENTLSA--ATVSTSDTTQLSFQQWTRPPMSLDFEVMMFSNSGLVVRYFTISGKD 469

Query: 421 MQYNSYPWVRYITQSGDDYTIR 442
            ++ +  W++YI++SG  Y +R
Sbjct: 470 SKHRAVKWIKYISKSG-SYEVR 490

>Ecym_4591 Chr4 complement(1154444..1155949) [1506 bp, 501 aa] {ON}
           similar to Ashbya gossypii ABR047W
          Length = 501

 Score =  174 bits (440), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 141/527 (26%), Positives = 246/527 (46%), Gaps = 110/527 (20%)

Query: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60
           M S ++  D + +LL  R  K   P  ++ +     I   ++S +L          Y+FI
Sbjct: 1   MISCLFILDEELQLLTVRLLK---PVPSLLEPLEWFIRHPKKSPILQNM----DYDYIFI 53

Query: 61  QHNDLYVLTLTKSMS-INVAQVFSYLHKLIEVLEEYM-KVVEEESIKDNFVIIYELLDEM 118
           Q + LY L+L+  ++ +    VFSYL++L  + ++Y+ + + +  I  NF +I+EL+DE 
Sbjct: 54  QRDGLYFLSLSYQLTNVYPMVVFSYLNQLHMLFQKYLGENLNKVLITGNFHLIHELIDES 113

Query: 119 MDHGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRP---------------------- 156
           +  G PQ+TD  ++R YI  +  K       ++  V                        
Sbjct: 114 IFMGTPQLTDYNIIRDYIKVQVVKDSPEPATREATVTNTKKNKKKDSKKKEEDTEATDEN 173

Query: 157 ------PATLTNSVSWRPEGIVYKKNEAFLDVVESINMLLTQQGQVLRSE-ILGKVKVKS 209
                   T T+++SWRP+GI Y KNE +LDV+E +  L+  Q   ++S  + G ++ +S
Sbjct: 174 YMNSYIARTTTSAISWRPKGIHYNKNEFYLDVIEHLEYLVDFQCMNIKSNTVYGYIQCRS 233

Query: 210 RLSGMPDLKLGLNDKGIFAQXXXXXXXXXASGGTKKKSNIELEDLKFHQCVRLTKFENEK 269
            LSGMP L +GLN                       ++   +    FHQCV L +   +K
Sbjct: 234 YLSGMPMLTIGLN-------------------KLNSENEYFMRRANFHQCVNLDQLTTDK 274

Query: 270 IITFIPPDGDFELMSYRLST-----PIKPLIWCDVKLQVHSR----SRIEIHCRAKAQIK 320
           +I+F PPDG+F+L +Y+L+      P+  L  C VKL+         R+ +        K
Sbjct: 275 LISFTPPDGEFQLCNYKLTRNMSDPPMIKLEDCKVKLKPRKTKDGLDRLILAVTISTYFK 334

Query: 321 KKSTANNVEILIPVPE-----DAD---SPKFRYSHGTIKWVPSQNAILWKIKSFPGG--- 369
            + + + + I +P+ +     D D    P+F+   G + +  + + +LW++    GG   
Sbjct: 335 LQDSTSLLNIKVPLSKVFRDWDVDLSYQPRFKCEQGKVMFNITDDYLLWEVGKVKGGHGD 394

Query: 370 KDYSMAAEMGLPS----------VSDNSD-----------------HKLKRP------VQ 396
           K   M +E  L +          +S++ D                 H+L  P      ++
Sbjct: 395 KTLKMQSEFHLHNREHEARIKQQLSNSMDPKPIRRGPHLEKLYQQTHELNSPTSEAALLK 454

Query: 397 IKFQIPYFTTSGIQVRYLKINEPKMQYNSYPWVRYITQSGDDYTIRM 443
           ++F+IPY+T SG++V +LKI E ++Q+ S+PWVRY T + D Y  ++
Sbjct: 455 VEFEIPYYTISGLKVEFLKIEEKQLQFQSFPWVRYKTINHDIYAYQL 501

>KLLA0F25432g Chr6 complement(2365434..2366957) [1524 bp, 507 aa]
           {ON} some similarities with uniprot|P38700 Saccharomyces
           cerevisiae YHL019C APM2 homologous to the medium chain
           of mammalian clathrin-associated protein complex Similar
           to clathrin coat proteins
          Length = 507

 Score =  171 bits (433), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 132/482 (27%), Positives = 230/482 (47%), Gaps = 116/482 (24%)

Query: 48  PCFSFNGVQYLFIQHNDLY-VLTLTKSMSINVAQVFSYLHKLIEVLEEYMKV-VEEESIK 105
           P F  NG  Y  I  ++LY  + +  + S++   V  YL ++ ++  ++M + + + +++
Sbjct: 46  PIFEGNGWHYAVITRDNLYFAMIMQVNNSVSPISVLHYLDEIYQLCRKFMGMKLNKLNVR 105

Query: 106 DNFVIIYELLDEMMDHGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVR-----PPA-- 158
           DNF +I+E+++E  D+GI Q+T+  ++  +I     ++I+     +N        PP   
Sbjct: 106 DNFHLIFEVIEESSDYGIIQVTNYNIIHDFI---KVEVIKPDDDSENTASEKHELPPGDQ 162

Query: 159 -----------TLTNSVSWRPEGIVYKKNEAFLDVVESINMLLTQQGQVLRSEIL-GKVK 206
                      T+T++VSWRP+GI Y KNE FLDV+E +  ++  +  V+R+ ++ G + 
Sbjct: 163 DETFINSYILRTMTSAVSWRPKGIHYGKNEFFLDVIEKLEFIMDFEEGVVRNNVINGTII 222

Query: 207 VKSRLSGMPDLKLGLNDKGIFAQXXXXXXXXXASGGTKKKSNIELEDLKFHQCVRLTKF- 265
            +S LSGMP L +GLN                      +K+   ++ LKFH+CV L    
Sbjct: 223 CRSYLSGMPQLSIGLNK-------------------LMQKNVHFMKRLKFHECVDLHTLI 263

Query: 266 -ENEKIITFIPPDGDFELMSYRLSTPI--KPLIWCDVKLQV-----------HSRSRIEI 311
            E   +I FIPPDG+FEL +Y+L+ P+  +P+I    KLQ             ++ ++ +
Sbjct: 264 KEESPVIKFIPPDGEFELCNYKLNRPLLDEPVI----KLQSFGLSQKPRKNQETQDKLLL 319

Query: 312 HCRAKAQIKKKSTANNVEILIPVPE-------DADSPK-FRYSHGTIKWVPSQNAILWKI 363
                   K + +A  + I IP+         D + P  F+   G + +  +  +I+WKI
Sbjct: 320 KAAITTHFKAQDSAKELLIKIPIKSVIRKWNIDLEKPPLFKSDIGDVVFDITAGSIIWKI 379

Query: 364 KSFPGG---KDYSM-------------AAEMGLPSVSD----NSDHKLKR---------- 393
            +  GG   K+Y +             A E+ L +  D     +  KL+R          
Sbjct: 380 NNLKGGHGNKNYGLKCMFEIWDRQIHEALEVQLRNSMDPPPLRTGPKLERIWDQYHGKTT 439

Query: 394 ----------------PVQIKFQIPYFTTSGIQVRYLKINEPKMQYNSYPWVRYITQSGD 437
                            + + F+IPY+  SG++V Y KI EP++ Y S+PWVRY T + +
Sbjct: 440 EYDGNENQKEDVDKFALIAMSFEIPYYAVSGLKVEYFKIEEPQLNYQSFPWVRYKTVNDN 499

Query: 438 DY 439
           +Y
Sbjct: 500 EY 501

>TPHA0P00660 Chr16 (136114..137535) [1422 bp, 473 aa] {ON} Anc_3.165
           YOL062C
          Length = 473

 Score =  169 bits (428), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 134/485 (27%), Positives = 228/485 (47%), Gaps = 56/485 (11%)

Query: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60
           M +G+    S+G L++    K  +     + F   +I   +  S   P  +     +  I
Sbjct: 1   MINGVLIYSSRGDLIVCDLLKSSLKRTISDIFKIQVINSLEMKS---PILTLGSTTFHHI 57

Query: 61  QHND---LYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDE 117
           + +    L+++ +T+S + N   ++ +L+KL  +L  Y  +  EE + + F++ YE++D 
Sbjct: 58  RSSSESKLWIVAITRS-NANSGVIWEFLYKLDSMLTAY-DLNNEEKLMEKFMVYYEMIDV 115

Query: 118 MM-DHGIPQITDTKMLRQYITQKSFKLIRSA----KKKKNVVRPPATLT----------- 161
           M+  + +P  T+   +   I+ +  K I ++    K   N +  P  LT           
Sbjct: 116 MLTSNAMPINTELSSIASKISYRLPKTISNSPTNEKNNNNGLSIPKFLTRNSRSMSQEFS 175

Query: 162 ----NSVSWRPEGIVYKKNEAFLDVVESINMLLTQQGQVLRSEILGKVKVKSRLSGMPDL 217
               + + WRP GI YKKNE FL V E IN+L+++   +L++ + G + + S LSG P  
Sbjct: 176 NITQSDIPWRPTGIKYKKNEVFLYVNEKINILVSKDQTILKAYVDGSIDLVSHLSGTPIC 235

Query: 218 KLGLNDKGIFAQXXXXXX----------XXXASGGTKKKSNIELEDLKFHQCVRLTKFEN 267
           + GLND                          S G    S++++ED  FHQCV L KF +
Sbjct: 236 QFGLNDYLSMTGNNISNRGDEFRHDFMDDEDLSTGRSSSSSVKIEDCTFHQCVSLDKFND 295

Query: 268 EKIITFIPPDGDFELMSYRLSTPIKPLIWCDVKLQVHSRSRI-EIHCRAKAQIKKKS--- 323
           E++I F+PPDG FELM Y +   +      ++  +V  R  I    C  + +I  KS   
Sbjct: 296 ERLINFVPPDGSFELMRYHVRDDL------NIPFKVTPRVSISSSRCSMRYKIILKSLFP 349

Query: 324 ---TANNVEILIPVPEDADSPKFRYSHGTIKWVPSQNAILWKIKSFPGGKDYSMAAEMGL 380
              +A +  + IP+P      K   S G   +  S N  +WK   + G  +  +  E  +
Sbjct: 350 TSLSAADAMLKIPLPPGTVDCKINASSGKCNFSTSDNCAIWKFNKYKGLTENELILET-V 408

Query: 381 PSVSDN--SDHKLKR-PVQIKFQIPYFTTSGIQVRYLKINEPKMQYNSYPWVRYITQSGD 437
           PS S +  S  +  R P+ + F+I  F+ SG+ V+YLK+ E   +Y    W++Y+++SG 
Sbjct: 409 PSSSTDILSLQQWTRPPMSMNFEIIMFSNSGLVVKYLKVMERVQKYRPVKWIKYVSKSG- 467

Query: 438 DYTIR 442
            Y IR
Sbjct: 468 SYEIR 472

>TDEL0B06430 Chr2 (1137277..1138854) [1578 bp, 525 aa] {ON}
           Anc_2.555 YHL019C
          Length = 525

 Score =  167 bits (424), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 153/548 (27%), Positives = 239/548 (43%), Gaps = 136/548 (24%)

Query: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLL-IEKEQESSVLPPCFSFNGVQYLF 59
           M+S I+  D   + L+S+  K      AI     +L + K   +    P  S +   ++ 
Sbjct: 1   MSSCIFITDENLEPLISKNIK------AIPNLQGILRLFKSVYTPESQPVISASSFHFVH 54

Query: 60  IQHNDLYVLTLTKS--MSINVAQVFSYLHKLIEVLEEYMKV--VEEESIKDNFVIIYELL 115
           I+ + L  +++  +   S NV  + ++L +   +L++Y+ V  +++  + DN ++I EL+
Sbjct: 55  IKRSSLLYVSVIHAYDASANVMLIATFLDQFHSLLKKYLAVSALDKNMVLDNVLLIMELI 114

Query: 116 DEMMDHGIPQITDTKMLRQYITQKS----------------------------------- 140
           DE +D G+ QITD  ++R YI  K                                    
Sbjct: 115 DESIDFGVIQITDASIMRDYIRVKVNMPENKTIDDLSLGDSDTDEEDNKKTKRRSGKPNL 174

Query: 141 FKLIRSAKKKKNVVRPPATLT---------NS---------VSWRPEGIVYKKNEAFLDV 182
           +K +R AK   +      T           NS         VSWR +GI Y +NE FLDV
Sbjct: 175 YKFLRGAKDGTHKAEHTDTAAKEDDVEDSYNSYIAKATIMPVSWRAKGIHYARNEFFLDV 234

Query: 183 VESINMLLT-QQGQVLRSEILGKVKVKSRLSGMPDLKLGLNDKGIFAQXXXXXXXXXASG 241
           VE +  L+    G + ++ I GK+  KS LSGMP LK+  N                   
Sbjct: 235 VEQVQYLMDFNSGIIKKNLIHGKIICKSYLSGMPKLKIAFN------------------- 275

Query: 242 GTKKKSNIELEDLKFHQCVRLTKFENEKIITFIPPDGDFELMSYRL-----STPIKPLIW 296
              +K    +   KFHQCV      NEK I FIPPDGDF L  Y L       P+  L+ 
Sbjct: 276 KLSQKDEQFISHSKFHQCVTWPS-SNEKEIEFIPPDGDFVLCQYELKRHVKDQPMLKLVS 334

Query: 297 CDVKLQVHSRSRIEIHCRAKAQIKKKSTANNVEILIPVPE-------DADSP-KFRYSHG 348
             VK ++  + +I++ C  +   K +++ + + + IP+         D   P +F+   G
Sbjct: 335 FGVKPKL-KKYKIQMSCTIETHFKARNSTSTLNLKIPLARLFQEYQIDLKKPARFKSDSG 393

Query: 349 TIKWVPSQNAILWKIKSFPGGK---DYSMAAEMGL-------------------PSVSD- 385
            + +  S + +LW I+   GG      SMAAE  L                   P + D 
Sbjct: 394 KVLFNISDDFLLWDIEVMKGGHGDTQLSMAAEFSLFNKKEFEEEQEELKNSMNPPPLRDG 453

Query: 386 -------NSDHKLKRP-------VQIKFQIPYFTTSGIQVRYLKINEPKMQYNSYPWVRY 431
                  +  H  K P       + +KF+IPY T SG+QV YLKI+E ++QY S+PWVRY
Sbjct: 454 PKLEELYDQVHNEKGPSKMASRLLSMKFEIPYSTCSGLQVEYLKIDEEQLQYQSFPWVRY 513

Query: 432 ITQSGDDY 439
            T + ++Y
Sbjct: 514 KTVNDEEY 521

>TPHA0I02390 Chr9 (528997..530676) [1680 bp, 559 aa] {ON} Anc_2.555
           YHL019C
          Length = 559

 Score =  160 bits (404), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 153/569 (26%), Positives = 246/569 (43%), Gaps = 140/569 (24%)

Query: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIE-KEQESSVLPPCFSFNGVQYLF 59
           M+S ++  D   + L+S+  K       +   P ++   KE  +   PP  + +   Y++
Sbjct: 1   MSSCLFILDELLEPLISKNTK------PVRNLPDIIKSFKESWTPTSPPIITVSNWHYVY 54

Query: 60  IQHNDLYVLTLTKSMS---INVAQVFSYLHKLIEVLEEYMK--VVEEESIKDNFVIIYEL 114
           ++ + L+ +     M    +N+  +  YL +L  +L+ Y K  ++ +  I DN +++ EL
Sbjct: 55  VKRDALWFVAAIHYMDEKCMNLMMILFYLDQLYYLLKNYFKKELLTKLLIIDNALLVTEL 114

Query: 115 LDEMMDHGIPQITDTKMLRQYITQKSFKLI---------------RSAKKKKNV-----V 154
           +DE +D GI Q+TD  ++R YI  K    I                SA  KKN       
Sbjct: 115 MDESIDFGIIQMTDPSIIRDYIRVKINNSIATGNNSNDDSDDSDTESASSKKNAKSLGSY 174

Query: 155 RPPA-TLTN----------------------------------------SVSWRPEGIVY 173
            P A  LTN                                        +VSWR +GI Y
Sbjct: 175 MPSANNLTNLWKGYSTKDETLNENVNNDNFENNDDETYINSHIARTTTMAVSWRTKGIYY 234

Query: 174 KKNEAFLDVVESINMLLTQQGQVLRSEIL-GKVKVKSRLSGMPDLKLGLN-----DKGIF 227
            KNE FLDVVES+  L+  + +V+R  ++ G++K KS LSGMP L++ LN     DK   
Sbjct: 235 AKNEFFLDVVESVQYLMNFKDKVIRRNLIHGQIKCKSYLSGMPTLRIALNKILQDDKQFL 294

Query: 228 AQXXXXXXXXXASGGTKKKSNIELE-DLKFHQCVRLTKFENEKIITFIPPDGDFELMSYR 286
                       S   K     +LE DL+    +    F N+K I FIPPDG+F L  Y 
Sbjct: 295 GHAKFHQCVSLNSINIK-----DLEKDLEGPNDISNKNFVNKKEIEFIPPDGEFVLCQYE 349

Query: 287 L-----STPIKPLIWCDVKLQVHSRSRIEIHCRAKAQIKKKSTANNVEILIPVP------ 335
           L       P+  +   D+K     + R++I  + +   K++++ + + I IP+       
Sbjct: 350 LRRHVKDPPVINMTSFDIKPNF-KKFRVQISLKIETHFKRQNSTSLMTIKIPLLQLFNDY 408

Query: 336 --EDADSPKFRYSHGTIKWVPSQNAILWKIKSFPGG---KDYSMAAEMGL---------- 380
             + +  P+F+   G + +  S++ ++W+I +  GG    +  M AE  L          
Sbjct: 409 KIDLSKQPRFKSDVGKVLFNISEDFLIWEIDALKGGHGENEKGMVAEFFLFNQEEYDRLQ 468

Query: 381 ---------------PSV----------SDNSDHKLKRPVQ---IKFQIPYFTTSGIQVR 412
                          P +           D  D  LK   Q   ++F+IPY T SG++V 
Sbjct: 469 EEAKISMNPPPLRNGPKLEELYEEMHENEDAEDTALKMKTQYVFMQFEIPYSTCSGLKVE 528

Query: 413 YLKINEPKMQYNSYPWVRYITQSGDDYTI 441
           YLKI E  ++Y S+PWVRY T + D+Y  
Sbjct: 529 YLKIEEDLLKYQSFPWVRYKTLNDDEYAF 557

>Kpol_1056.13 s1056 complement(30531..32156) [1626 bp, 541 aa] {ON}
           complement(30531..32156) [1626 nt, 542 aa]
          Length = 541

 Score =  155 bits (393), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 146/563 (25%), Positives = 233/563 (41%), Gaps = 148/563 (26%)

Query: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60
           M+S ++  D   + L+S+  K       I +F  L  ++       PP F+     Y+FI
Sbjct: 1   MSSCLFILDESLEPLISKNVKSVRNLTGILEFFKLNYKENG-----PPVFTVLEWHYVFI 55

Query: 61  QHNDLYVLTL---TKSMSINVAQVFSYLHKLIEVLEEYMK--VVEEESIKDNFVIIYELL 115
           + + L+ +T    T     N+  +  YL +L  +L+ Y     ++   + DN ++I EL+
Sbjct: 56  KRDSLWFMTAIHETDDRITNLMALTFYLDQLYLLLKTYFNRSSLDRNIVLDNVLLIIELI 115

Query: 116 DEMMDHGIPQITDTKMLRQYI-------------------TQKSFKLIRSAKKKKNVVR- 155
           DE MD GI Q+TD  +++ YI                    +K   L      K ++V+ 
Sbjct: 116 DESMDFGIVQLTDPSIIKDYIRVKVNSPITHLTSDDDSDTEEKHKGLSTYIPGKTDIVKL 175

Query: 156 ---PPATLTNS-----------------------------VSWRPEGIVYKKNEAFLDVV 183
               PA   N                              VSWR +GI Y KNE FLDV+
Sbjct: 176 WKGQPAVTANEGKSNEQDNYDDDDDENFINSYIAKTTIMPVSWRTKGIYYAKNEFFLDVI 235

Query: 184 ESINMLLT-QQGQVLRSEILGKVKVKSRLSGMPDLKLGLNDKGIFAQXXXXXXXXXASGG 242
           E +  L+    G++ ++ I G++K K  LSGMP LK+ LN                    
Sbjct: 236 EKVQYLMDFSTGRIRKNLIHGEIKCKCYLSGMPTLKVALN-------------------K 276

Query: 243 TKKKSNIELEDLKFHQCVRLTKFE------------NEKIITFIPPDGDFELMSYRL--- 287
             K     + + KFHQCV +   +            + K I FIPPDG+F L  Y L   
Sbjct: 277 LIKNDEQFISNSKFHQCVSINSLKREINNEEEENTYHGKEIEFIPPDGEFVLCKYELKRH 336

Query: 288 --STPIKPLIWCDVKLQVHSRSRIEIHCRAKAQIKKKSTANNVEILIPVP--------ED 337
               P+  L   ++K ++  + +I+IH   +   KK+++ + + I IP+         + 
Sbjct: 337 VRDVPVIKLSNIEIKPKL-KKYKIQIHVTIETHFKKQNSTSVLTIKIPLRMVFSQYKIDL 395

Query: 338 ADSPKFRYSHGTIKWVPSQNAILWKIKSFPGGKDYS----------------------MA 375
              P+F+   G + +  S + ++W++ S  GG   S                      M 
Sbjct: 396 TKQPRFKSDFGEVLFNISDDFLIWEVGSMKGGNGESKNNMVAEFFIFNQEEYDRLQEEMK 455

Query: 376 AEMGLP-------------SVSDNSDHKLKRPVQ-----IKFQIPYFTTSGIQVRYLKIN 417
             M  P                DN D   K  +      +KF++PY T SG++V YLKI 
Sbjct: 456 TSMNPPPLREGPKLEEIYEQTHDNRDEHDKNGISQQLLTMKFEVPYSTCSGLKVEYLKIE 515

Query: 418 EPKMQYNSYPWVRYITQSGDDYT 440
           E ++ Y S+PWVRY T + D+Y 
Sbjct: 516 ENQVNYQSFPWVRYKTINDDEYA 538

>KNAG0K01150 Chr11 complement(225095..226519) [1425 bp, 474 aa] {ON}
           Anc_3.165 YOL062C
          Length = 474

 Score =  145 bits (365), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 123/489 (25%), Positives = 231/489 (47%), Gaps = 63/489 (12%)

Query: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60
           M + +    ++G+L++S+ +K  +  +  + F   +I       V  P  +     + ++
Sbjct: 1   MINAVLVYSARGELIVSKMFKPTLKRSVGDIFRVQVI---NSLDVRSPILTLGSTTFHYV 57

Query: 61  Q--HNDLYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDEM 118
           +     L+V++++++   N A  + +L+K   +L  Y ++  EE +K+ F++ +ELLD M
Sbjct: 58  RTPGEGLWVVSVSRNNE-NSAATWEFLYKFATMLAAY-RLDSEEVLKEEFMLAWELLDTM 115

Query: 119 MDHG-IPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPATLTNSVSW----------- 166
           ++ G IP  TD     + I+  S K   S    +   R   T T++ ++           
Sbjct: 116 VEGGGIPSETDP---HRIISAMSVKPAMSPVDVRADARQQQTTTSTGAFGHAFPQLLHRA 172

Query: 167 -RPEGIV-----------YKKNEAFLDVVESINMLLTQQGQVLRSEILGKVKVKSRLSGM 214
             P GI             K+NE  + V ESI++L+++ G +L++ + G + + ++L G 
Sbjct: 173 SNPGGISILPHATGDGAQLKRNEIVMVVQESISILVSKDGSILKAYVDGGIDLTTKLEGA 232

Query: 215 PDLKLGLNDKGIFAQXXXXXXXXXASGGTKKKSNIE----------LEDLKFHQCVRLTK 264
              + GLND                S  T+  +N+E          L D KFHQCV L +
Sbjct: 233 AVCQFGLNDSLSTDNSSNSKWDPLRSKETQG-TNLEMKNAHVGTVLLRDCKFHQCVSLER 291

Query: 265 FENEKIITFIPPDGDFELMSYR----LSTPIKPLIWCDVKLQVHSRSRIEIHCRAKAQIK 320
           F+ ++II F PP+G  ELM Y     L+ P K            +  R+ I    K+   
Sbjct: 292 FDRDRIIRFTPPEGTIELMKYHVRDNLNLPFKVTSMVIPTANNETDYRVTI----KSLFP 347

Query: 321 KKSTANNVEILIPVPEDADSPKFRYSHGTIKWVPSQNAILWKIKSFPGGKDYSMAAEMGL 380
            K +A NV + IPVP      K   S+G  K++P +NA++WK   + G  +  ++A + +
Sbjct: 348 GKLSAKNVTMRIPVPPGTLDCKINVSNGNCKFLPEENAMVWKFHKYNGLTENKLSA-ITV 406

Query: 381 PSVSDNSDHKLKR----PVQIKFQIPYFTTSGIQVRYLKI---NEPKMQYNSYPWVRYIT 433
           P+  D +   L++    P+ + F+I  ++ +G+ VRY  +   +    ++ +  W++Y++
Sbjct: 407 PT-RDTTQLALQQWSRPPISLDFEILMYSNTGLVVRYFTVLDKHNNNTKFKTVKWIKYVS 465

Query: 434 QSGDDYTIR 442
            SG  Y +R
Sbjct: 466 HSG-SYEVR 473

>ZYRO0E05874g Chr5 (452910..454559) [1650 bp, 549 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019C APM2
           homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 549

 Score =  139 bits (351), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 107/337 (31%), Positives = 157/337 (46%), Gaps = 76/337 (22%)

Query: 159 TLTNSVSWRPEGIVYKKNEAFLDVVESINMLLTQQGQVLRSEIL-GKVKVKSRLSGMPDL 217
           T T  VSWR +GI Y KNE FLDVVE +  L   + +V+R  ++ GK+  KS LSGMP L
Sbjct: 231 TTTMPVSWRAKGIHYGKNEFFLDVVEKVQYLADFKEKVVRKNLIHGKIYCKSYLSGMPKL 290

Query: 218 KLGLNDKGIFAQXXXXXXXXXASGGTKKKSNIELEDLKFHQCVRLTKFENEKIITFIPPD 277
           K+ LN                      ++    +   KFHQCV L    NEK + FIPPD
Sbjct: 291 KIALNK-------------------LLQRDAQFMSHSKFHQCVALETL-NEKELEFIPPD 330

Query: 278 GDFELMSYRL-----STPIKPLIWCDVKLQVHSRSRIEIHCRAKAQIKKKSTANNVEILI 332
           G+F L  Y L      TPI  +   ++K Q+  + ++ I    +   K +++ + + + I
Sbjct: 331 GEFILCEYELKRHVNDTPILKITSFEIKPQL-KKFKLRILLTIETHFKTRNSTSILNVKI 389

Query: 333 PVPE-------DADSP-KFRYSHGTIKWVPSQNAILWKIKSFPGGK---DYSMAAEMGL- 380
           P+ +       D   P +F+ + G + +  S + +LW+I    GG     +SM AE  L 
Sbjct: 390 PLAKLFADYNIDLSKPTRFKSAAGQVLFNLSDDFLLWEIGQMRGGHGETQFSMVAEFSLF 449

Query: 381 ------------------------PSVSD--NSDHKLKRP-----------VQIKFQIPY 403
                                   P + +     H  K P           V + F+IPY
Sbjct: 450 NKEEFEREQEERKHSMNPPPLREGPKLEELYAQTHSQKDPEVLVKSIQSQLVGMDFEIPY 509

Query: 404 FTTSGIQVRYLKINEPKMQYNSYPWVRYITQSGDDYT 440
            T SG++V YLKI E ++QY S+PWVRY T S ++Y 
Sbjct: 510 TTCSGLKVEYLKIEEEQLQYQSFPWVRYKTISDEEYA 546

>KAFR0A02060 Chr1 (428640..430262) [1623 bp, 540 aa] {ON} Anc_2.555
           YHL019C
          Length = 540

 Score =  137 bits (344), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 102/340 (30%), Positives = 156/340 (45%), Gaps = 78/340 (22%)

Query: 159 TLTNSVSWRPEGIVYKKNEAFLDVVESINMLLTQQGQVLRSEIL-GKVKVKSRLSGMPDL 217
           T   SVSWR +GI Y KNE FLDV+E +   +     +++  ++ G++  KS LSGMP L
Sbjct: 218 TTIMSVSWRAKGIQYAKNEFFLDVIEKVEYFMDFSNNIIKKNLIHGEIICKSFLSGMPTL 277

Query: 218 KLGLNDKGIFAQXXXXXXXXXASGGTKKKSNIELEDLKFHQCVRLTKFENEKIITFIPPD 277
           K+ LN K I+                       L   KFHQCV     +  K++ F+PPD
Sbjct: 278 KVSLN-KIIYQDKQF------------------LSSCKFHQCVMPDSVDEGKVLEFVPPD 318

Query: 278 GDFELMSYRL-----STPIKPLIWCDVKLQVHSRSRIEIHCRAKAQIKKKSTANNVEILI 332
           GDF L  Y L       P+  LI  +VK ++  + ++++    ++  KK ++   + I I
Sbjct: 319 GDFVLCKYELKRHVNDLPLLKLISYEVKPKL-DKYKLKLFVTIESTFKKTNSTTKLNIKI 377

Query: 333 PV-----PEDAD---SPKFRYSHGTIKWVPSQNAILWKIKSFPGGK-------DYSMAAE 377
           P+       D D   + K R   G I +  S + +LW+I +  GG        D+++  E
Sbjct: 378 PLKVLLEKYDIDLSKNIKSRCDEGKILFNVSDDFLLWEIGAMKGGNSQLKMGADFALFNE 437

Query: 378 -------------MGLPSV------------------------SDNSDHKLKRPVQIKFQ 400
                        M  P +                         ++SD      +++ F+
Sbjct: 438 EEYLRQQEELKTSMNPPPLRTGPKLEELYKQIHEEKCNNFTRKGESSDETKGNLIKMDFE 497

Query: 401 IPYFTTSGIQVRYLKINEPKMQYNSYPWVRYITQSGDDYT 440
           IPY T+SG++V YLKI EP +QY ++PWVRY T S D Y 
Sbjct: 498 IPYNTSSGLKVEYLKIEEPNLQYQAFPWVRYKTISDDGYA 537

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 71/142 (50%), Gaps = 14/142 (9%)

Query: 1   MTSGIYFCDSKGKLLLSRRYKD----DIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQ 56
           M+S +Y  +   + LLS+  K     DIP +  ++  H       +  V  P   +    
Sbjct: 1   MSSILYILNEDLESLLSKSIKALESPDIPLSLFKKQFH-------KHQVTTPVIIYEDYI 53

Query: 57  YLFIQHNDLYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKV--VEEESIKDNFVIIYEL 114
           +  IQ + LY ++ +     N+ +   YL++   +L+ Y  V  +++  I DN V I EL
Sbjct: 54  FTCIQRDTLYFVS-SIDCKTNILETLHYLNEFYILLKNYFNVKQLDKNIIMDNLVPILEL 112

Query: 115 LDEMMDHGIPQITDTKMLRQYI 136
           ++E +D GI QITD+ +++ YI
Sbjct: 113 IEESVDFGIIQITDSNLMKDYI 134

>KAFR0C01020 Chr3 (208272..209558) [1287 bp, 428 aa] {ON} Anc_3.165
           YOL062C
          Length = 428

 Score =  132 bits (332), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 114/466 (24%), Positives = 224/466 (48%), Gaps = 74/466 (15%)

Query: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60
           M S I     +G+L++S+ Y+++I  +  E F    I+     +V  P  +     +  I
Sbjct: 1   MISAILIYTPRGELIVSKLYRNNIKRSISEIFR---IQVINNFNVRSPILTLGSTTFHHI 57

Query: 61  QH-------NDLYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYE 113
           +        ++L+++ + ++ + N A ++ +L KL  +L++Y  +  E  +KD F+ ++E
Sbjct: 58  RSTANDPTDDELWLVCVNRN-NANSAAIWEFLQKLNLILQQY-GITSESKLKDEFMTVHE 115

Query: 114 LLDEMM-DHGIPQITDTKMLRQYITQKSFKLIRSAK-------KKKNVV--RPPATLTNS 163
           +LD M+   GI Q TD K +   ++ K                K++N +   P A  +  
Sbjct: 116 ILDNMLLGTGIIQNTDLKSIVDKMSVKPISRTNETTSTQTGFLKRRNTILTTPGANFSLI 175

Query: 164 VSWRPEGIVYKKNEAFLDVVESINMLLTQQGQVLRSEILGKVKVKSRLSGMPDLKLGLND 223
            + R +   +KKNE F  V ES+N+L+++ G +L++ + GK+++KS L+G P  +  L D
Sbjct: 176 PTNRHDA--HKKNEIFFFVNESMNLLVSKDGSILKNYVDGKIEIKSHLNGNPTCQFELVD 233

Query: 224 KGIFAQXXXXXXXXXASGGTKKKSNIELEDLKFHQCVRLTKFENEKIITFIPPDGDFELM 283
                                     ++ D KF QC+   +    + +     DG+ E++
Sbjct: 234 -----------------------DQTKITDFKFDQCIEKVQ---SRTVRVAATDGELEIV 267

Query: 284 SY-----RLSTPIK--PLIWCDVKLQVHSRSRIEIHCRAKAQIKKKSTANNVEILIPVPE 336
           +Y     +++ P K  P++   VK  V  R  +      K+   K  +A +V + IPVP 
Sbjct: 268 NYHVRDDKINIPFKITPIV-STVKDTVDYRISL------KSLFPKNLSATDVVLTIPVPP 320

Query: 337 DADSPKFRYSHGTIKWVPSQNAILWKIKSFPGGKDYSMAAEMGLPSVSD-----NSDHKL 391
           +    K   S+G  K+   QNA++W    F G  + +++A     +++D     N +   
Sbjct: 321 NTIDCKINVSNGHCKFKAEQNAVIWTFNKFNGSTENTLSA----ITIADGRQIMNLESWT 376

Query: 392 KRPVQIKFQIPYFTTSGIQVRYLKI-NEPKMQYNSYPWVRYITQSG 436
           +  +Q+ F+I  ++ SG+ +R L I ++ K +Y +  W++YI+++G
Sbjct: 377 RPSIQLTFEITMYSISGLLLRNLMITDKDKRRYKASRWIKYISRAG 422

>CAGL0K03223g Chr11 (296371..298167) [1797 bp, 598 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019c
           involved in clathrin-independent transport
          Length = 598

 Score =  134 bits (337), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 109/371 (29%), Positives = 164/371 (44%), Gaps = 118/371 (31%)

Query: 164 VSWRPEGIVYKKNEAFLDVVESINMLLT-QQGQVLRSEILGKVKVKSRLSGMPDLKLGL- 221
           VSWR +GI Y KNE FLDV+E +  L+  + G V RS I G++  +S LSGMP LK+ L 
Sbjct: 249 VSWRAKGIHYAKNEFFLDVIEKLQYLVDLESGMVRRSLIHGQIVCRSYLSGMPKLKMSLN 308

Query: 222 ----NDKGIFAQXXXXXXXXXASGGTKKKSNIELEDLKFHQCVRLTKFEN---------- 267
               NDK   +Q                        ++FHQCV L   E           
Sbjct: 309 KLLQNDKQFISQ------------------------VQFHQCVSLDSIEKVIKYAEEHSD 344

Query: 268 ------------EKIITFIPPDGDFELMSYRLSTPIK--PLI-WCDVKLQVH-SRSRIEI 311
                       E  I FIPPDGDF L SY L   I+  P++  C  ++     + +++I
Sbjct: 345 ELKTLKHTEHNAESEIEFIPPDGDFTLCSYELKRHIRDPPMVKLCSFEITPKWKKYKLKI 404

Query: 312 HCRAKAQIKKKSTANNVEILIPVPE-------DADSP-KFRYSHGTIKWVPSQNAILWKI 363
               +   K  ++ + +++ IP+ +       D   P KF+ S+G + +  S + +LW+I
Sbjct: 405 SAAVETHFKPTNSTSKLDVKIPISKVFKDYQIDLKKPIKFKTSNGRVVYNISDDFLLWEI 464

Query: 364 KSFPGGKDY-------------SMAAEMGL-------------------------PSV-- 383
               GGK +             +MAAE GL                         P +  
Sbjct: 465 GVIKGGKMHGSKEDISKFDNVATMAAEFGLFNEEEYERERKERETSMNPPPLRTGPKLED 524

Query: 384 --------SDNSDHKLKRP------VQIKFQIPYFTTSGIQVRYLKINEPKMQYNSYPWV 429
                   +D  +   ++P      + + F+IPY T SG++V YLKI+E ++QY S+PWV
Sbjct: 525 IYKETHEENDGYNSVGQKPKNNLNLLSMDFEIPYCTCSGLKVEYLKIDEDQLQYQSFPWV 584

Query: 430 RYITQSGDDYT 440
           RY T + D+Y 
Sbjct: 585 RYKTINDDEYA 595

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 72/141 (51%), Gaps = 10/141 (7%)

Query: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60
           M+S IY  D   + L+S+  K     N +       + + Q      P       ++++I
Sbjct: 1   MSSSIYIFDETLEPLVSKSVKGLPNVNELGDLFRYHVRQSQN-----PIIDVYNWRFVYI 55

Query: 61  QHNDLYVLTLTKSMSINVAQ---VFSYLHKLIEVLEEYM--KVVEEESIKDNFVIIYELL 115
           + + LY + +  +    +A    + +YL +L ++  +Y+  KV++   + DN +++ EL+
Sbjct: 56  KRDTLYFVAVVDAADDAIANYLAILTYLEQLYQLFRDYVGVKVLDRNLVLDNTLLVMELI 115

Query: 116 DEMMDHGIPQITDTKMLRQYI 136
           DE +D+GI Q+T+  +++ YI
Sbjct: 116 DETLDYGIVQLTEPSIMKDYI 136

>NCAS0A12650 Chr1 (2492345..2494111) [1767 bp, 588 aa] {ON}
           Anc_2.555 YHL019C
          Length = 588

 Score =  127 bits (318), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 100/356 (28%), Positives = 157/356 (44%), Gaps = 99/356 (27%)

Query: 164 VSWRPEGIVYKKNEAFLDVVESINMLLTQQGQVLRSEIL-GKVKVKSRLSGMPDLKLGLN 222
           +SWR +GI Y KNE FLDV+E +   +  +  V+R  ++ G++  +S LSGMP LK+ +N
Sbjct: 250 ISWRTKGIHYGKNEFFLDVIEKVEYFMDFKSGVIRKNLIHGEIICRSYLSGMPKLKISIN 309

Query: 223 DKGIFAQXXXXXXXXXASGGTKKKSNIELEDLKFHQCVRLTKFE---------------- 266
              I  Q                     L ++KFHQCV L                    
Sbjct: 310 --KILKQDVQF-----------------LSNVKFHQCVSLDSIRARSNPPAVEEDGKKKN 350

Query: 267 -------NEKIITFIPPDGDFELMSYRLSTPIK--PLIWC---DVKLQVHSRSRIEIHCR 314
                  N+  I FIPPDG+F L  Y L   +K  P+I     ++  ++H + +I+IH  
Sbjct: 351 EEADTLGNKGEIEFIPPDGEFLLCKYELKRHVKDQPMIKLRNFEIIPKLH-KFKIKIHVI 409

Query: 315 AKAQIKKKSTANNVEILIPVP--------EDADSPKFRYSHGTIKWVPSQNAILWKIKSF 366
            +   K  ++ + + + IP+         + +  PKF+   GT+ +  S   +LW++ + 
Sbjct: 410 IETHFKTTNSTSKLNLRIPITNLFQSYRIDLSKQPKFKCEQGTVLFNLSDKFLLWEVGTM 469

Query: 367 PGG---KDYSMAAEMGL-------------------------PSVSD---------NSDH 389
            GG      SM AE  L                         P + +         +SD 
Sbjct: 470 NGGHGENTLSMMAEFALFNEEEYKKMEEERKTSMNPPPLREGPKLEELYKKIHEEGDSDE 529

Query: 390 KLKRP-----VQIKFQIPYFTTSGIQVRYLKINEPKMQYNSYPWVRYITQSGDDYT 440
              R      + + F++PY T SG+++ YLKI E ++QY S+PWVRY T S D+Y 
Sbjct: 530 VSTRKKNESLLTMDFEVPYCTCSGLKIEYLKIEEDQLQYQSFPWVRYKTISDDEYA 585

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 81/146 (55%), Gaps = 13/146 (8%)

Query: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQ--ESSVLPPCFSFNGV--Q 56
           M+S I+  D   + ++ +  +      A+   P L+ + ++   S+ + P    N +  Q
Sbjct: 1   MSSSIFILDETLEPIICKNIR------ALPNLPSLVTKFQELYRSNGVSPLPILNDIDWQ 54

Query: 57  YLFIQHNDLYVLTLTKSMS-INVAQVFSYLHKLIEVLEEYMKV--VEEESIKDNFVIIYE 113
           +L I+ + L  L++ ++ S  N+  VF+YL +  ++L++Y+ V  +    + DNF+++ E
Sbjct: 55  FLHIKRDSLVFLSVVENNSRCNLLGVFTYLEEFYKLLKDYLHVGILNRNLLIDNFLVVIE 114

Query: 114 LLDEMMDHGIPQITDTKMLRQYITQK 139
           L+DE +D G+ Q TD+ +++ Y+  K
Sbjct: 115 LIDESLDFGVVQFTDSSLIKDYVRVK 140

>KNAG0C05550 Chr3 complement(1076437..1078185) [1749 bp, 582 aa]
           {ON} Anc_2.555 YHL019C
          Length = 582

 Score =  117 bits (293), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 93/356 (26%), Positives = 153/356 (42%), Gaps = 109/356 (30%)

Query: 164 VSWRPEGIVYKKNEAFLDVVESINMLLTQQGQVLRSEIL-GKVKVKSRLSGMPDLKLGLN 222
           +SWR +GI Y KNE FL+V+E +   +     V++  ++ G+++ K  LSGMP+LK+ +N
Sbjct: 253 ISWRTKGIHYAKNEFFLNVIEKVEYFMDFTQNVIKKNLIHGEIRCKCFLSGMPNLKVSIN 312

Query: 223 -----DKGIFAQXXXXXXXXXASGGTKKKSNIELEDLKFHQCVRLTKFE--NEKIITFIP 275
                DK   A                        + KFHQCV L   E  + K + F+P
Sbjct: 313 KIVNEDKQFLA------------------------NCKFHQCVSLASLESSDHKDVEFVP 348

Query: 276 PDGDFELMSYRL-----STPIKPLIWCDVK-----LQVHSRSRIEIHCRAKAQIKKKSTA 325
           PDG+F L  Y L       P+  L+  +VK      ++     IE H       K  +  
Sbjct: 349 PDGEFTLCRYELKRHVRDEPMVKLVNFEVKPKLKKFKLKLLLTIETH------FKTTNAT 402

Query: 326 NNVEILIPVP--------EDADSPKFRYSHGTIKWVPSQNAILWKIKSFPGGK---DYSM 374
           + + + +P+         + + + K +   G I +  S + +LW++ S  GG      SM
Sbjct: 403 SKLALRVPIKQLFREYRVDLSKNLKSKCDRGAILFNISDDFLLWEVGSMSGGHGETQLSM 462

Query: 375 AAEMGL-------------------PSVSDN------------------------SDHKL 391
             E  L                   P + +                         ++H+L
Sbjct: 463 GVEFALFNQEEYDREQEMLKTSMNPPPLREGPKLEELYKQIHEDDDDDDGNTEPVAEHRL 522

Query: 392 K-------RPVQIKFQIPYFTTSGIQVRYLKINEPKMQYNSYPWVRYITQSGDDYT 440
           +       + + + F++PY T+SG++V YLKI EP+++Y S+PWVRY T S  +Y 
Sbjct: 523 QPRTREIDKLLTMDFEVPYCTSSGLRVEYLKIEEPQLEYQSFPWVRYTTLSDAEYA 578

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 74/144 (51%), Gaps = 12/144 (8%)

Query: 1   MTSGIYFCDSKGKLLLSRRYKDDIPA--NAIEQFPHLLIEKEQESSVLPPCFSFNGV-QY 57
           M+S +Y  D   + L+S+  K  +P+    I QF  L        S  PP   ++ +  +
Sbjct: 1   MSSVLYILDENLETLISKNIKA-VPSLEYPIAQFKKLY------GSNAPPVIDYHDLFTF 53

Query: 58  LFIQHNDLYVLTLTKSMSINVAQVFSYLHKLIEVLEEYM--KVVEEESIKDNFVIIYELL 115
            +IQ + L  +++   +   + +   YL    EVL+ Y+  KV+++  + DN V+I EL+
Sbjct: 54  TYIQRDSLLFVSVVDRVDTGLVETLVYLEHFYEVLKNYLGVKVLDKNIVTDNSVLISELI 113

Query: 116 DEMMDHGIPQITDTKMLRQYITQK 139
           +E +D G  Q+TD+ +L  YI  K
Sbjct: 114 EETIDFGAIQVTDSGLLADYIKMK 137

>Skud_8.26 Chr8 complement(55759..57549) [1791 bp, 596 aa] {ON}
           YHL019C (REAL)
          Length = 596

 Score =  117 bits (293), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 93/352 (26%), Positives = 162/352 (46%), Gaps = 76/352 (21%)

Query: 159 TLTNSVSWRPEGIVYKKNEAFLDVVESINMLLTQQGQVLRSEIL-GKVKVKSRLSGMPDL 217
           T+   +SWR +GI Y KNE FLDV+E +  L+  +  ++R  ++ G++  +S LSGMP L
Sbjct: 248 TIIMPISWRTKGIHYAKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRSYLSGMPKL 307

Query: 218 KLGLN-----DKGIFAQXXXXXXXXXASGGTKKKSNIELEDLKFHQCVRLTKFENEKIIT 272
           K+ +N     D    +           S  T +K   + ++    Q        + + I 
Sbjct: 308 KISINKILNRDPQFMSNSNFHQCVSLDSINTIEKGQEKEQNTGDSQAA-----ADAREIE 362

Query: 273 FIPPDGDFELMSYRLSTPIK--PLIWC---DVKLQVHSRSRIEIHCRAKAQIKKKSTANN 327
           F+PPDG+F L  Y L   +K  P+I     ++K ++  +S+I+I  + +   K  ++ + 
Sbjct: 363 FVPPDGEFVLCQYELKRHVKDAPMIKLKDFEIKPKL-KKSKIQILTKIQTNFKPTNSTSK 421

Query: 328 VEILIPVP--------EDADSPKFRYSHGTIKWVPSQNAILWKIKSFPGGKD-------- 371
           + + IP+         + +   +F+ ++G + +  S + +LW+I++  G ++        
Sbjct: 422 LNVKIPLTRVFQDYKIDLSKQIRFKANNGKVVFNLSDDFLLWEIQTMKGHRERNASNAPQ 481

Query: 372 --------YSMAAEMGL-------------------------PSVSD--NSDHKLKRP-- 394
                    SM AE  L                         P + +  N  H    P  
Sbjct: 482 DDGDPSTCASMVAEFSLFNQEEYDRLQEEMKTSMNPPPLRTGPKLEELYNQVHDKHTPHV 541

Query: 395 ------VQIKFQIPYFTTSGIQVRYLKINEPKMQYNSYPWVRYITQSGDDYT 440
                 V I F+IPY T SG++V YLK+ EP++QY S+PWVRY T + ++Y 
Sbjct: 542 TPRDRLVSIDFEIPYCTCSGLKVEYLKVEEPQLQYQSFPWVRYKTVNDEEYA 593

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 60/98 (61%), Gaps = 5/98 (5%)

Query: 47  PPCFSFNGVQYLFIQHNDLYVLTL---TKSMSINVAQVFSYLHKLIEVLEEY--MKVVEE 101
           PP    N   ++ ++ + L+++++   T   +I++  + ++L +   +L++Y  +KV+ +
Sbjct: 42  PPILFQNDWFFIHLKRDFLHLVSVIHTTDKPNIDLMTILAFLEQFYHLLQKYFEIKVLSK 101

Query: 102 ESIKDNFVIIYELLDEMMDHGIPQITDTKMLRQYITQK 139
           + I DN +++ EL+DE +D GI Q+TD  +++ YI  K
Sbjct: 102 DLILDNVLLVLELMDECIDFGIVQVTDPSIIKDYIRVK 139

>Smik_8.23 Chr8 complement(51372..53183) [1812 bp, 603 aa] {ON}
           YHL019C (REAL)
          Length = 603

 Score =  115 bits (288), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 94/351 (26%), Positives = 158/351 (45%), Gaps = 74/351 (21%)

Query: 159 TLTNSVSWRPEGIVYKKNEAFLDVVESINMLLT-QQGQVLRSEILGKVKVKSRLSGMPDL 217
           T+   +SWR +GI Y KNE FLDV+E +  L+  ++G + ++ I G++  +  LSGMP L
Sbjct: 255 TIIMPISWRTKGIHYAKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRCYLSGMPKL 314

Query: 218 KLGLN-----DKGIFAQXXXXXXXXXASGGTKKKSNIELEDLKFHQCVRLTKFENEKIIT 272
           K+ +N     D    +           S  T     IE  + K      L    + K + 
Sbjct: 315 KISINKILNRDAQFLSNSSFHQCVSLDSIKT-----IEKREEKEDDDTGLQAAADAKELE 369

Query: 273 FIPPDGDFELMSYRLSTPIK--PLIWC-DVKLQVH-SRSRIEIHCRAKAQIKKKSTANNV 328
           F+PPDG+F L  Y L   +K  P+I   D +++    + +I+I  + +   K  ++ + +
Sbjct: 370 FVPPDGEFVLCQYELKRHVKDAPMIKLKDFQIKPKLKKFKIQIETKIQTNFKPTNSTSKL 429

Query: 329 EILIPVP--------EDADSPKFRYSHGTIKWVPSQNAILWKIKSFPGGKDY-------- 372
            + IP+         + +   +F+ + G + +  S + +LW+I++  G +++        
Sbjct: 430 NVKIPLTKVFQEYRIDLSKQIRFKSNIGKVVFNLSDDFLLWEIQAMKGHREHNTNKTSQD 489

Query: 373 --------SMAAEMGL--------------------PSVSDNSDHKLKRPVQ-------- 396
                   SM AE  L                    P  +     +L R V         
Sbjct: 490 DNDPDACASMVAEFPLFNQEEYDRLQEEKKTSMNPPPLRTGPRLEELYRQVHDQQIAHVT 549

Query: 397 -------IKFQIPYFTTSGIQVRYLKINEPKMQYNSYPWVRYITQSGDDYT 440
                  I F+IPY T SG+++ YLK+ EP++QY S+PWVRY T S D+Y 
Sbjct: 550 PRDKLVAIDFEIPYCTCSGLKIEYLKVEEPQLQYQSFPWVRYKTTSDDEYA 600

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 59/98 (60%), Gaps = 5/98 (5%)

Query: 47  PPCFSFNGVQYLFIQHNDLY---VLTLTKSMSINVAQVFSYLHKLIEVLEEY--MKVVEE 101
           PP  S N   ++ ++ + L+   V+  T   +I++  + ++L +   +L+EY  +KV+ +
Sbjct: 42  PPILSQNDWFFIHLKRDFLHFVSVIHTTDKPNIDLMTILAFLEQFYHLLQEYFEIKVLTK 101

Query: 102 ESIKDNFVIIYELLDEMMDHGIPQITDTKMLRQYITQK 139
           + I DN +++ EL+DE +D GI Q+TD  +++ YI  K
Sbjct: 102 DVILDNVLLVLELMDECIDFGIVQVTDPSIIKDYIRVK 139

>YHL019C Chr8 complement(67731..69548) [1818 bp, 605 aa] {ON}
           APM2Protein of unknown function, homologous to the
           medium chain of mammalian clathrin-associated protein
           complex; involved in vesicular transport
          Length = 605

 Score =  112 bits (281), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 93/355 (26%), Positives = 159/355 (44%), Gaps = 78/355 (21%)

Query: 159 TLTNSVSWRPEGIVYKKNEAFLDVVESINMLLTQQGQVLRSEIL-GKVKVKSRLSGMPDL 217
           T+   +SWR +GI Y KNE FLDV+E +  L+  +  V+R  ++ G++  +  LSGMP L
Sbjct: 253 TIIMPISWRTKGIHYAKNEFFLDVIERVQYLMDFEKGVIRKNLIHGEIVCRCYLSGMPKL 312

Query: 218 KLGLN-----DKGIFAQXXXXXXXXXASGGTKKKSNIELEDLKFHQCVRLTKFENEKIIT 272
           K+ +N     D    +           S  T +K     E+        L    + + I 
Sbjct: 313 KISINKILNRDPQFMSNSSFHQCVSLDSINTIEKD----EEKNSDDDAGLQAATDAREIE 368

Query: 273 FIPPDGDFELMSYRLSTPIK--PLIWC---DVKLQVHSRSRIEIHCRAKAQIKKKSTANN 327
           FIPPDG+F L  Y L   +K  P++     ++K ++  + +I+I  + +   K  ++ + 
Sbjct: 369 FIPPDGEFVLCQYELKRHVKDAPMVRLKDFEIKPKL-KKFKIQIVTKIQTNFKPTNSTSK 427

Query: 328 VEILIPVP--------EDADSPKFRYSHGTIKWVPSQNAILWKIKSFPGGKDY------- 372
           + + IP+         + +   +F+ + G + +  S + +LW+I++  G +++       
Sbjct: 428 LNVRIPLTKVFQEYKIDLSKQIRFKANIGKVVFNLSDDFLLWEIQTMKGHREHSTNKSSQ 487

Query: 373 ------------SMAAEMGL-------------------------PSVSD--------NS 387
                       SM AE  L                         P + +         +
Sbjct: 488 YNSDEDDPNTCASMVAEFPLFNQEEYDRLQEEMKTSMNPPPLRTGPRLEELYRQVHDQQT 547

Query: 388 DHKLKRP--VQIKFQIPYFTTSGIQVRYLKINEPKMQYNSYPWVRYITQSGDDYT 440
            H   R   V I F+IPY T SG++V YLK+ EP++QY S+PWVRY T S ++Y 
Sbjct: 548 SHVTPRDKLVNIDFEIPYCTCSGLKVEYLKVEEPQLQYQSFPWVRYKTVSDEEYA 602

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 58/98 (59%), Gaps = 5/98 (5%)

Query: 47  PPCFSFNGVQYLFIQHNDLY---VLTLTKSMSINVAQVFSYLHKLIEVLEEY--MKVVEE 101
           PP  S N   ++ ++ + L+   V+  T   +I++  + ++L +   +L++Y  ++V+ +
Sbjct: 42  PPILSQNDWFFIHLKRDFLHFVSVIHTTDKPNIDLMTILAFLEQFYHLLQKYFEIEVLTK 101

Query: 102 ESIKDNFVIIYELLDEMMDHGIPQITDTKMLRQYITQK 139
             I DN +++ EL+DE +D GI Q+TD  +++ YI  K
Sbjct: 102 NVILDNILLVLELIDECIDFGIVQVTDPSIIKDYIRVK 139

>Suva_8.33 Chr8 complement(69735..71525) [1791 bp, 596 aa] {ON}
           YHL019C (REAL)
          Length = 596

 Score =  112 bits (280), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 97/370 (26%), Positives = 156/370 (42%), Gaps = 111/370 (30%)

Query: 159 TLTNSVSWRPEGIVYKKNEAFLDVVESINMLLTQQGQVLRSEIL-GKVKVKSRLSGMPDL 217
           T+   +SWR +GI Y KNE FLDV+E +  L+  +  ++R  ++ G++  +  LSGMP L
Sbjct: 247 TIIMPISWRTKGIHYSKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRCYLSGMPKL 306

Query: 218 KLGLNDKGIFAQXXXXXXXXXASGGTKKKSNIELEDLKFHQCVRLTKFE----------- 266
           K+ +N                       +    + + KFHQCV L               
Sbjct: 307 KISIN-------------------KLLNRDPQFMSNSKFHQCVSLDSINIIEEEGRDTDD 347

Query: 267 -------NEKIITFIPPDGDFELMSYRLSTPIK--PLIWCDVKLQVHS------RSRIEI 311
                  + K I FIPPDG+F L  Y L   +K  P+I    KLQ         + +I+I
Sbjct: 348 AGSQTATDTKEIEFIPPDGEFVLCQYELKRHVKDAPMI----KLQGFEIKPKLKKFKIQI 403

Query: 312 HCRAKAQIKKKSTANNVEILIPVP--------EDADSPKFRYSHGTIKWVPSQNAILWKI 363
             + +   K  ++ + + + IP+         + +   +F+ + G + +  S + +LW+I
Sbjct: 404 ITKIQTNFKPTNSTSKLNVKIPLTKVFQDYKIDLSKQIRFKANLGKVVFNLSDDFLLWEI 463

Query: 364 KSFPGGKD---------------YSMAAEMGLPSVS--DNSDHKLK-------------- 392
            +  G ++                SM AE  L +    D    +LK              
Sbjct: 464 GTMKGHRERNTGTVPQEDDASTLASMVAEFPLFNQEEYDRLQEELKTSMNPPPLRTGPKL 523

Query: 393 ----------------------RPVQIKFQIPYFTTSGIQVRYLKINEPKMQYNSYPWVR 430
                                 + V + F+IPY T SG++V YLK+ EP++QY S+PWVR
Sbjct: 524 EELYKQVHEERVLHTHDVAPRDKLVSVDFEIPYCTCSGLKVEYLKVEEPQLQYQSFPWVR 583

Query: 431 YITQSGDDYT 440
           Y T S D+Y 
Sbjct: 584 YKTISDDEYA 593

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 59/98 (60%), Gaps = 5/98 (5%)

Query: 47  PPCFSFNGVQYLFIQHNDLYVLTL---TKSMSINVAQVFSYLHKLIEVLEEY--MKVVEE 101
           PP  S NG  ++ ++ + L+ +++   T   +I++  + ++L +   +L++Y  + V+ +
Sbjct: 42  PPILSQNGWFFIHLKRDFLHFISVIHATDKPNIDLMSILAFLEQFYHLLKKYFEINVLSK 101

Query: 102 ESIKDNFVIIYELLDEMMDHGIPQITDTKMLRQYITQK 139
             I DN +++ EL+DE +D GI Q+TD  +++ YI  K
Sbjct: 102 NIILDNVLLVLELVDECIDFGIVQVTDPSIIKDYIRVK 139

>TBLA0B06760 Chr2 (1594957..1596930) [1974 bp, 657 aa] {ON}
           Anc_2.555 YHL019C
          Length = 657

 Score = 97.8 bits (242), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 77/272 (28%), Positives = 135/272 (49%), Gaps = 41/272 (15%)

Query: 124 PQITDTKMLRQYIT---QKSFKLIRSAKKKKNVVRP--PATLTNSVSWRPEGIVYKKNEA 178
           P ++    LR+++    ++  KL+  A+  +N +      T    +SWR +GI Y KNE 
Sbjct: 243 PDVSKILELRKHVNILNKEDMKLV-DAENDENYINSYIAKTTIMPISWRTKGIYYAKNEF 301

Query: 179 FLDVVESINMLLTQQGQVLRSEIL-GKVKVKSRLSGMPDLKLGLNDKGIFAQXXXXXXXX 237
           FLDV+E    ++  +  ++R  ++ GK+  +  LSGMP LK+ LN               
Sbjct: 302 FLDVLEKQEYIMDFKNDLIRKNLIQGKIICRCFLSGMPKLKIALN--------------- 346

Query: 238 XASGGTKKKSNIELEDLKFHQCVRLTKFENEKIITFIPPDGDFELMSYRLSTPIKP---- 293
                  +K    L  L+FHQCV L   +N++ I FIPPDG+F L  Y L   +K     
Sbjct: 347 ----KLLQKDQQFLSQLRFHQCVSLETIQNKE-IEFIPPDGEFILCEYELKRHVKDPPNI 401

Query: 294 -LIWCDVKLQVHSRSRIEIHCRAKAQIKKKSTANNVEILIPVPEDAD--------SPKFR 344
            LI  ++K ++  + +I+I+       K +++ + + + IP+ +  +        SP+F+
Sbjct: 402 KLISFEIKPKL-KKFKIQINLSITTFFKVQNSTSILNLKIPLEKLFNDYKIDLKKSPRFK 460

Query: 345 YSHGTIKWVPSQNAILWKIKSFPGGKDYSMAA 376
            + G +K+  S + +LW+I S  GG   ++ A
Sbjct: 461 SNIGQVKFNLSDDFLLWEIGSMKGGHGENIKA 492

 Score = 56.6 bits (135), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 22/45 (48%), Positives = 32/45 (71%)

Query: 395 VQIKFQIPYFTTSGIQVRYLKINEPKMQYNSYPWVRYITQSGDDY 439
           + + F+IPY+  SG++V YLKI E ++ Y S+PWVRY T +  DY
Sbjct: 609 LTVDFEIPYYACSGLKVEYLKIEEEQLLYQSFPWVRYKTTNDKDY 653

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 41/151 (27%), Positives = 70/151 (46%), Gaps = 23/151 (15%)

Query: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHL--LIEKEQESSVLP-PCFSFNGVQY 57
           M S I+  D   + L+S+  +      AI  F  +  L  K + ++    P  S N   +
Sbjct: 1   MLSCIFILDENLEPLISKNIR------AIPNFKSIVELFRKHRSTNTTELPIVSINDWNF 54

Query: 58  LFIQHNDLYVLTLTKSMSINVAQVFS-------YLHKLIEVLEEYMKV--VEEESIKDNF 108
           + I+ + L  L      +IN+    S       YL K   +L+ ++K   +    I DN 
Sbjct: 55  IQIKRDSLIFLG-----AININDYMSDLMSMSIYLDKFYYLLKMHLKTDTLNRNIILDNI 109

Query: 109 VIIYELLDEMMDHGIPQITDTKMLRQYITQK 139
           ++I EL+DE +D GI Q+TD  +++ Y+  K
Sbjct: 110 LLIMELIDESIDFGIIQMTDPNIIKDYVRVK 140

>NDAI0B01610 Chr2 complement(384287..386305) [2019 bp, 672 aa] {ON}
           Anc_2.555 YHL019C
          Length = 672

 Score = 87.8 bits (216), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 73/257 (28%), Positives = 112/257 (43%), Gaps = 62/257 (24%)

Query: 164 VSWRPEGIVYKKNEAFLDVVESINMLLT-QQGQVLRSEILGKVKVKSRLSGMPDLKLGLN 222
           +SWR +GI Y KNE FLDV+E +   +  ++G + ++ I G++  K  LSGMP LK+ +N
Sbjct: 295 ISWRTKGIHYAKNEFFLDVIEKVEYFMDFEKGLIRKNLIHGEIVCKCYLSGMPKLKISIN 354

Query: 223 DKGIFAQXXXXXXXXXASGGTKKKSNIELEDLKFHQCVRLTKF----------------- 265
                                 +  +  L +  FHQCV L                    
Sbjct: 355 K-------------------ILQNDSQFLSNAHFHQCVSLDSLHLQSAEDDDGDDNANVN 395

Query: 266 ENE--------KIITFIPPDGDFELMSYRL-----STPIKPLIWCDVKLQVHSRSRIEIH 312
           ENE        K I FIPPDGDF L  Y L       P+  L   D+K ++ S+ +++IH
Sbjct: 396 ENENHDERDRKKEIEFIPPDGDFLLCKYELKRHVKDLPVIKLKLFDIKPKL-SKYKLKIH 454

Query: 313 CRAKAQIKKKSTANNVEILIPVP--------EDADSPKFRYSHGTIKWVPSQNAILWKIK 364
              +   K  +  + + + IP+         + +   KF+   G + +  S N ++W+I 
Sbjct: 455 VIIETHFKTTNNTSKLNLKIPIERLFQEYRIDLSKQIKFKCDQGKVLFNLSDNFLIWEIG 514

Query: 365 SFPGGKD---YSMAAEM 378
           S  GG      SM AE 
Sbjct: 515 SMKGGHGEVTMSMMAEF 531

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 37/46 (80%)

Query: 395 VQIKFQIPYFTTSGIQVRYLKINEPKMQYNSYPWVRYITQSGDDYT 440
           ++I F+IPY+T SG+++ YLKI EP++QY S+PWVRY T S ++Y 
Sbjct: 624 LKIDFEIPYYTCSGLKIEYLKIEEPQLQYQSFPWVRYKTISDEEYA 669

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 59/89 (66%), Gaps = 3/89 (3%)

Query: 54  GVQYLFIQHNDLYVLTLTKSMSIN-VAQVFSYLHKLIEVLEEYMKV--VEEESIKDNFVI 110
           G Q+L I+ + L  +++ ++ S+N +  +FSYL +  ++L+ Y+ V  +++  + DNF++
Sbjct: 75  GWQFLHIKRDSLIFVSIIENNSMNSLMIIFSYLEEFYKLLKSYLNVTKLDKGLLIDNFLL 134

Query: 111 IYELLDEMMDHGIPQITDTKMLRQYITQK 139
           + ELLDE +D GI Q TD+ +++ YI  K
Sbjct: 135 VMELLDESLDFGIVQFTDSSLIKDYIRVK 163

>AGL061W Chr7 (593647..594882) [1236 bp, 411 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR288C (APM3)
          Length = 411

 Score = 71.6 bits (174), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 59/226 (26%), Positives = 97/226 (42%), Gaps = 46/226 (20%)

Query: 84  YLHKLIEVLEEYM--KVVEEESIKDNFVIIYELLDEMMDHGIPQITDTKMLRQYI----- 136
           +L +  +VL EY   + +  + + +N   +  LL  M+D G   +TD+  LRQ +     
Sbjct: 41  FLAQYHQVLIEYFDKEALTVKKLVNNADRLALLLHAMLDAGEVAVTDSNRLRQLVPLRND 100

Query: 137 --------TQKSFKLIRSAKKKKNVVRPPAT----LTNSVSWRPEGIVYKKNEAFLDVVE 184
                   T+     ++ A  K+    P AT       +V WR     Y  NE ++D+VE
Sbjct: 101 LSTILNSATKTLANTVKYADSKQLFGAPVATGKVEAGQTVPWRTADCRYVNNEIYVDLVE 160

Query: 185 SINMLLTQQGQ---VLRSEILGKVKVKSRLSGMPDLKLGLNDKGIFAQXXXXXXXXXASG 241
           ++N  L Q+G    ++   + GK+ VK  LSG P ++L L                    
Sbjct: 161 TVNATLRQKGSSLTLINGSLSGKIDVKCYLSGNPTVQLKL-------------------- 200

Query: 242 GTKKKSNIELEDLKFHQCVRLTKFENEKIITFIPPDGDFELMSYRL 287
              + S   L++   H+CV L +      + F+PPDG F L  Y +
Sbjct: 201 ---RTSGHPLDNSALHRCVELGE-AGVATMNFVPPDGRFTLAEYAI 242

>SAKL0A09218g Chr1 complement(802348..803734,803809..803843) [1422
           bp, 473 aa] {ON} similar to uniprot|P38153 Saccharomyces
           cerevisiae YBR288C APM3 Mu3-like subunit of the yeast
           AP-3 complex which functions in transport of alkaline
           phosphatase to the vacuole via the alternate pathway
           clathrin associated protein medium chain
          Length = 473

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 64/267 (23%), Positives = 111/267 (41%), Gaps = 60/267 (22%)

Query: 53  NGVQYLFIQHNDLYVLTLTKSMSINVAQVFSYLHKLIEVLEEYM--KVVEEESIKDNFVI 110
           +G++Y  +Q  ++      +  + N  + F +L  +  +L +Y    V++   I  N+  
Sbjct: 72  DGLRYWCLQRTEI-----GEGSTPNPVEPFVFLQTVDTILNQYFGKDVLKASKITKNYDR 126

Query: 111 IYELLDEMMDHGIPQITDTKMLRQYITQKS-------------FKLIRSAKKKKNVVRPP 157
           +  L + M+D G P ITD   L++ +  K+              K I +A+  +   +  
Sbjct: 127 VTLLFNSMVDAGEPDITDLNRLKEIVPLKNNFARVINSTASSIGKTISNAEGNQMFSKHS 186

Query: 158 -----------ATLTNSVSWRPEGIVYKKNEAFLDVVESINMLLTQQGQV-----LRSEI 201
                      A    +V WR  G+ Y  NE ++D+ E++N++L +         +   I
Sbjct: 187 SNSRIGSSVSYANRDRTVPWRSAGVKYTNNELYVDMAETVNIILAKTRNSTSLVPISGSI 246

Query: 202 LGKVKVKSRLSGMPDLKLGLNDKGIFAQXXXXXXXXXASGGTKKKSNIELEDLKFHQCVR 261
            G+V  K  LS  P ++L LN  G                        +L    FH+CVR
Sbjct: 247 DGEVGFKCYLSENPLVELDLNTNGH-----------------------DLGIPAFHRCVR 283

Query: 262 LTKFE-NEKIITFIPPDGDFELMSYRL 287
               + +   + FIPPDGDF LM Y +
Sbjct: 284 TEGSDFHPGTLRFIPPDGDFCLMEYNI 310

>KLTH0D06556g Chr4 complement(570972..572342) [1371 bp, 456 aa] {ON}
           similar to uniprot|P38153 Saccharomyces cerevisiae
           YBR288C APM3 Mu3-like subunit of the yeast AP-3 complex
           which functions in transport of alkaline phosphatase to
           the vacuole via the alternate pathway clathrin
           associated protein medium chain
          Length = 456

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 91/372 (24%), Positives = 146/372 (39%), Gaps = 79/372 (21%)

Query: 111 IYELLDEMMDHGIPQITDTKMLRQYITQKS--FKLI-------------RSAKKKKNVVR 155
           I  LL+ M+D   P +TD   LR  +  +    K+I             R+  +  N+  
Sbjct: 115 IALLLNCMVDANEPAVTDFNHLRDMVPSREDLSKVINSTASSLSNRISQRNTSQVLNIGD 174

Query: 156 P---PATLTNSVSWRPEGIVYKKNEAFLDVVESINMLL-----TQQGQVLRSEILGKVKV 207
           P   PA     V WR  G+ Y  NE ++DVVE+++++L     T +   +R  + G V  
Sbjct: 175 PAKGPAAKEKLVPWRSAGVKYSNNELYVDVVETVHVILRKNEKTGELTSVRGVLDGVVDF 234

Query: 208 KSRLSGMPDLKLGLNDKGIFAQXXXXXXXXXASGGTKKKSNIELEDLKFHQCVRLTKFEN 267
           +S LSG P + L L  +G                        +L     HQC   +    
Sbjct: 235 RSHLSGNPVIALNLRLRGH-----------------------DLGMPALHQCCLDSYQGR 271

Query: 268 EKIITFIPPDGDFELMSYRL---STPIKPLIWCDVKLQVHSRSRIEI-----HCRAKAQI 319
              + F+PPDG F+LM Y +   S   K  ++ ++ L V    R E+            I
Sbjct: 272 PDQLRFVPPDGKFQLMHYSIDLDSLQSKSKLFSNIGL-VSPDYRTELGDLGDEFEVNLNI 330

Query: 320 KKKSTANNVEILI------PVPEDADSPKFRYSHGTIKWVPSQNAILWKI-KSFPGGKDY 372
                A  V+ L+      P+P +      R +HG  +   S N   W   K  P G   
Sbjct: 331 AGSQHAKVVDDLVITLSFGPLPSECKIKVLRSTHGHFENCASNNIGKWVFDKETPTGT-- 388

Query: 373 SMAAEMGLPSVSDNSDHKLKRPVQ-IKFQIPYFTT----SGIQVRYLKINEPKMQYNSYP 427
                  LP +    ++  +  V+ ++  + Y       SGI+V  + I    +  N  P
Sbjct: 389 -------LPVLRGCLENATREQVRALQLSVSYTNRGELPSGIKVDSVDI-LSGLSKNIKP 440

Query: 428 W--VRYITQSGD 437
           +  V+YI ++GD
Sbjct: 441 FKGVKYIAKTGD 452

>TPHA0C04130 Chr3 complement(886804..888405) [1602 bp, 533 aa] {ON}
           Anc_2.522 YBR288C
          Length = 533

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 86/187 (45%), Gaps = 42/187 (22%)

Query: 121 HGIPQITD-TKMLRQYITQKSFKLIRSAKKKKNVVRPPATLTNSVS--WRPEGIVYKKNE 177
           H IP   D +K++          L +S K++ N         ++V+  WR   + +  NE
Sbjct: 156 HNIPSKYDFSKVINNTAHNIQIALQKSQKQQSNFPYQDMNFDSNVAVPWRMRNVDHVNNE 215

Query: 178 AFLDVVESINMLLTQQGQ----------VLRSEILGKVKVKSRLSGMPDLKLGLNDKGIF 227
            +LD+VESI+++L  + +          ++   I+GK  VKS L+G P +++ ++  G  
Sbjct: 216 LYLDLVESIHVVLETKKRKSSYANSTMKIVTGNIIGKALVKSVLNGNPIVEMKIDMAGN- 274

Query: 228 AQXXXXXXXXXASGGTKKKSNIELEDLKFHQCVRL------TKFENEKIITFIPPDGDFE 281
                                 +LE +  H+CV+        +FEN K+I F+PPDG F+
Sbjct: 275 ----------------------DLESIFLHECVKSKDVDKDQEFENTKLIKFLPPDGSFK 312

Query: 282 LMSYRLS 288
           L  Y ++
Sbjct: 313 LFDYNIN 319

>KAFR0D03560 Chr4 complement(695693..697060) [1368 bp, 455 aa] {ON}
           Anc_2.522 YBR288C
          Length = 455

 Score = 63.2 bits (152), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 96/374 (25%), Positives = 151/374 (40%), Gaps = 61/374 (16%)

Query: 104 IKDNFVIIYELLDEMMDHGIPQITDTKM--LRQYITQK---SFKLIRSAKKKKNVVRPPA 158
           I +N+  +  L D ++D GI    +  M  LR  I  K   S  +  +AK  +    P  
Sbjct: 107 IMNNYDRMTILFDLLIDGGIIDGNNFYMNKLRNQIPLKNDFSNFINDAAKSLQKGQAPSK 166

Query: 159 TLTNSV-SWRPEGIVYKKNEAFLDVVESINMLLTQQGQ------VLRSEILGKVKVKSRL 211
           T+ N V  WR + I   +NE ++DV E++ + L +  +      +L   I G V V S +
Sbjct: 167 TVDNEVVPWRSKEIKTVRNEIYVDVKETLYVTLIKSNRASHRLKLLNGYINGSVSVDSSI 226

Query: 212 SGMPDLKLGLNDKGIFAQXXXXXXXXXASGGTKKKSNIELEDLKFHQCVRLTKF--ENEK 269
            G+P L++                     GG   K  I     KFH CV + +F   +  
Sbjct: 227 GGVPMLEVSF-------------------GGCDFKDIIP----KFHDCVEVNEFLTNDGN 263

Query: 270 IITFIPPDGDFELMSYR--LSTPIKPLIWCDVKLQV-HSRSRIEIHCRAKAQIKKKSTAN 326
           II FIPPDG F+LM Y   LS+    LI C+    + +S    EI         K    N
Sbjct: 264 IIKFIPPDGKFQLMEYSMALSSFNDNLISCNFTNGLGNSNDEFEITLNINKS-NKVPKIN 322

Query: 327 NVEILIPVPEDADSPKF--------RYSHGTIKWVPSQNAILWKIKSFPGGKDYSMAAE- 377
           N+++ +         K         R+ +G   W+     +   +    G  +     E 
Sbjct: 323 NLQVCLNFENREGQSKVKILRNTHGRFEYGKNTWIFDSELLTGTLPVLRGCVEEETKNEE 382

Query: 378 -MGLPSVSDNSDHKLK---RPVQIKF----QIPYFT-TSGIQVRYLKINEPKMQYNSYPW 428
             G+         KL+   R V + F    Q+P  T  S I +R    + P+ Q   +  
Sbjct: 383 DGGIDGEGRRILSKLRPELRSVIMSFQYEGQLPSGTRVSSINIRNDSTSNPQRQ-QLFKG 441

Query: 429 VRYITQSGDDYTIR 442
           V+Y+T++  +Y IR
Sbjct: 442 VKYVTKTS-NYEIR 454

>TDEL0A02970 Chr1 complement(532395..533885) [1491 bp, 496 aa] {ON}
           Anc_2.522 YBR288C
          Length = 496

 Score = 62.8 bits (151), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 82/315 (26%), Positives = 132/315 (41%), Gaps = 75/315 (23%)

Query: 164 VSWRPEGIVYKKNEAFLDVVESINMLLTQQGQVLR----------SEILGKVKVKSRLSG 213
           V WR  G+ Y  NE ++D+ ESI+++  + G+  R            I G+  VK  LSG
Sbjct: 211 VPWRTAGLKYSNNELYVDLTESIHVVYQKAGKRSRRTSSKLEMICGTINGQASVKCYLSG 270

Query: 214 MP--DLKLGL--NDKGIFAQXXXXXXXXXASGGTKKKSNIELEDLKFHQCVRLTKFENEK 269
            P  DL+L L  ND G+ A                           FH+CV L   +N  
Sbjct: 271 NPTVDLQLDLAGNDLGVPA---------------------------FHECVELDNHQNPS 303

Query: 270 --IITFIPPDGDFELMSYR--LSTP----------IKPLIWCDVKLQVHSRS-RIEI--- 311
              + FIPPDG F LM Y   L TP             L+  D   Q+ +++   EI   
Sbjct: 304 NCDLRFIPPDGRFNLMQYSIDLDTPRIQQTRRFNHTVGLVTIDFADQLGNKTDEFEITVN 363

Query: 312 --HCRAKAQIKKKSTANNVEILIPVPEDADSP----KFRYSHGTI--KWVPSQNAILWKI 363
             + R  A I+      +V++     ED+++       R +HG      VP Q + ++  
Sbjct: 364 ISNSREVANIEDLRI--DVQLQSNTDEDSETDFKIKVLRNTHGRFDNSVVPGQGSWIFD- 420

Query: 364 KSFPGGKDYSMAAEMGLPSVSDNSDHKLKRPVQIKFQIPYFTTSGIQVRYLKINEPKMQY 423
           K  P G   ++    G    ++    +++R V   + +     SGI+V+ + I +   + 
Sbjct: 421 KDTPTG---TLPVLRGCVESTEPRLLRVQR-VTASYSLSGQLASGIRVKAINIGQLTTKS 476

Query: 424 NS-YPWVRYITQSGD 437
           N  +  V+Y T++GD
Sbjct: 477 NRPFKGVKYATKTGD 491

>KLLA0E18789g Chr5 (1669103..1670596) [1494 bp, 497 aa] {ON} similar
           to uniprot|P38153 Saccharomyces cerevisiae YBR288C APM3
           Mu3-like subunit of the yeast AP-3 complex which
           functions in transport of alkaline phosphatase to the
           vacuole via the alternate pathway clathrin associated
           protein medium chain
          Length = 497

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 47/152 (30%), Positives = 71/152 (46%), Gaps = 39/152 (25%)

Query: 162 NSVSWRPEGIVYKKNEAFLDVVESINMLLTQQGQVLRSEILGKVKVKSRLSGMP--DLKL 219
           + V WR  GI Y  NE F+D+ E IN ++ ++G++L   I G + + + LSG P  ++KL
Sbjct: 208 SGVPWRMSGINYANNEIFIDMSEEINAIV-EKGKLLTGHIKGCIDLNNHLSGQPLVEMKL 266

Query: 220 GLNDKGIFAQXXXXXXXXXASGGTKKKSNIELEDLKFHQCVRLTKFE--NEKI------I 271
           GL D                     K S++   +  FH+C+   K    N+ I      +
Sbjct: 267 GLLD--------------------HKLSHL---NTTFHRCILEDKANSINDLIAGKFTKL 303

Query: 272 TFIPPDGDFELMSYRLSTPIKPLIWCDVKLQV 303
           TF+PPDG   L  Y L     PL+  D  L +
Sbjct: 304 TFVPPDGRTRLCQYTL-----PLVKRDSNLGI 330

>Kwal_26.7957 s26 complement(586544..587914) [1371 bp, 456 aa] {ON}
           YBR288C (APM3) - clathrin associated protein medium
           chain [contig 55] FULL
          Length = 456

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 59/129 (45%), Gaps = 28/129 (21%)

Query: 164 VSWRPEGIVYKKNEAFLDVVESINMLL---TQQGQVL--RSEILGKVKVKSRLSGMPDLK 218
           V WR  G+ Y  NE ++DVVE+I+++L    + GQ++  R  I G V  +S L+G P + 
Sbjct: 186 VPWRTAGLKYSNNELYVDVVETIHVILRKTEKSGQLVPVRGLIDGYVDFRSHLTGNPVVA 245

Query: 219 LGLNDKGIFAQXXXXXXXXXASGGTKKKSNIELEDLKFHQCVRLTKFENEKIITFIPPDG 278
           L LN  G                        +L     H C +     + + + F+PPDG
Sbjct: 246 LKLNLHGH-----------------------DLGVPALHPCCQAQYTGSPENLQFVPPDG 282

Query: 279 DFELMSYRL 287
            F LM Y +
Sbjct: 283 KFRLMQYTI 291

>TBLA0I00620 Chr9 complement(110231..112060) [1830 bp, 609 aa] {ON}
           Anc_2.522 YBR288C
          Length = 609

 Score = 53.5 bits (127), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 43/153 (28%), Positives = 72/153 (47%), Gaps = 30/153 (19%)

Query: 158 ATLTNSV-SWRPEGIVYKKNEAFLDVVESINMLLTQQG------------------QVLR 198
            T+ N V  WR   + Y  NE ++DV+E I+++  ++                   +++R
Sbjct: 249 GTINNKVVPWRSGNVKYTNNEIYIDVIEEIHVVYQRRNSKRYHKINQFNRNDNSPMKLIR 308

Query: 199 SEILGKVKVKSRLSGMPDLKLGLNDKGIFAQXXXXXXXXXASGGTKKKSNIELEDLKFHQ 258
           ++I+G++ V+S LS  P +++ L D+    Q         +     K+ N+ L    FH 
Sbjct: 309 ADIIGELNVRSYLSDNPMVEVTLVDRNYSDQ-----KTGWSENDLFKQLNLGLP--MFHD 361

Query: 259 CVRLT--KFENEKI--ITFIPPDGDFELMSYRL 287
           CV +   K  N+    I FIPPDG F LM Y +
Sbjct: 362 CVEIDYEKGINQDFRHIKFIPPDGKFSLMKYNI 394

>ZYRO0B01738g Chr2 complement(139975..141453) [1479 bp, 492 aa] {ON}
           similar to uniprot|P38153 Saccharomyces cerevisiae
           YBR288C APM3 Mu3-like subunit of the yeast AP-3 complex
           which functions in transport of alkaline phosphatase to
           the vacuole via the alternate pathway clathrin
           associated protein medium chain
          Length = 492

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 56/238 (23%), Positives = 102/238 (42%), Gaps = 47/238 (19%)

Query: 79  AQVFSYLHKLIEVLEEYMKV--VEEESIKDNFVIIYELLDEMMDHGIPQIT--DTKMLRQ 134
              F++L  L + L EY     +    I +N+  I  +    +D G P +   ++  +R+
Sbjct: 89  TDTFTFLQLLDQTLLEYFDKDKLTVTKIVNNYDRITMIFYMSIDSGEPCVGSLNSNRIRR 148

Query: 135 YITQKS--FKLIR-SAKKKKNVVRPP--ATLTNS---------VSWRPEGIVYKKNEAFL 180
            I  KS   K+I  +A   +  VR P    L  +         V WR   + Y  +E ++
Sbjct: 149 VIPVKSDLSKMINNTAHTLQRAVRQPRQGILAATPEILESEEVVPWRSGHLKYTSDEIYV 208

Query: 181 DVVESINMLLTQQG-----QVLRSEILGKVKVKSRLSGMPDLKLGLNDKGIFAQXXXXXX 235
           D++E+++++          Q++   I G+V VKS LSG P +++ ++  G          
Sbjct: 209 DIIETVHVIYQTHHRNNSVQMVSGTINGQVNVKSYLSGNPTVEMDMDLAGN--------- 259

Query: 236 XXXASGGTKKKSNIELEDLKFHQCVRLTKFENEKIITFIPPDGDFELMSYRLSTPIKP 293
                         E+     HQCV + +  +   + FIPPDG+  L++Y +   + P
Sbjct: 260 --------------EMYAPSMHQCVEMPQ-GSPSSLCFIPPDGNCNLLNYTIDLDMNP 302

>Kpol_1018.42 s1018 (137162..138889) [1728 bp, 575 aa] {ON}
           (137162..138889) [1728 nt, 576 aa]
          Length = 575

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 45/188 (23%), Positives = 85/188 (45%), Gaps = 45/188 (23%)

Query: 123 IPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPATLTNSVS--WRPEGIVYKKNEAFL 180
           +P   D   +     Q   K I+S++ +K + +  +   N  +  WR + + +  NE ++
Sbjct: 158 VPMKVDLSKVFTSTAQNIQKAIQSSQAQKPIFQDFSFQENKANAPWRSQNVKHNNNEIYI 217

Query: 181 DVVESINML----------LTQQGQVLRSEILGKVK----VKSRLSGMPDLKLGLNDKGI 226
           D+VES++++          LT+  Q ++  + G +K    V+S L+G P ++L L     
Sbjct: 218 DLVESVHVVYQTKIRRSNELTRSKQSIKKIVNGYLKGTAYVQSFLNGNPLVELQL----- 272

Query: 227 FAQXXXXXXXXXASGGTKKKSNIELEDLKFHQCVRLTKF----ENEKI--ITFIPPDGDF 280
                             + S  ++    FH+CV + ++    +N  I  + FIPPDG F
Sbjct: 273 ------------------ELSGNDIGHPSFHECVDIDEYLKNIDNSSISSLKFIPPDGKF 314

Query: 281 ELMSYRLS 288
            LM Y ++
Sbjct: 315 TLMDYTIT 322

>NCAS0A04870 Chr1 (973552..975021) [1470 bp, 489 aa] {ON} Anc_2.522
           YBR288C
          Length = 489

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 95/475 (20%), Positives = 168/475 (35%), Gaps = 105/475 (22%)

Query: 33  PHLLIEKEQESSVLPPCFSFNGVQYLFIQHNDLYVLTLTKSMSINVAQVFSYLHKLIEVL 92
           P LL+  E +S  L    +    +Y  + +N  Y   LT   S+ V     YL +LI  L
Sbjct: 39  PELLLANEMKSRSLGGGSAIMVCKYRSVVNNMNY-YCLTSDDSVEVDCFLEYLDELI--L 95

Query: 93  EEYMKVVEEESIK---DNFVIIYELLDEMMDHG---------------IPQITDTKML-- 132
           E + K  +E S+K   +NF  +  LL  +++ G               +P + D + +  
Sbjct: 96  EYFDK--DEVSVKKLVNNFDRLSLLLHSVVNGGEINVGFLYNNRIQNVVPPVHDLRKILN 153

Query: 133 --RQYITQKSFKLIRSAKKKK--NVVRPPATLTNSVSWRPEGIVYKKNEAFLDVVESINM 188
                I  +S   +RSA      N           V WR  GI   K E ++D+ E + +
Sbjct: 154 ETAHTIMNQSSGAMRSAGSGVAFNASSSSRGEDMVVPWRRNGIKDAKEELYVDLKEEVYV 213

Query: 189 LLTQQG---------------QVLRSEILGKVKVKSRLSGMPDLKLGLNDKGIFAQXXXX 233
              +                 +++   I G + V+  L+G P + L  +  G        
Sbjct: 214 TYRKSDRHHGRDGIRTSNPSMELVSGHIKGTIDVRCYLNGNPTVSLMFDTMGN------- 266

Query: 234 XXXXXASGGTKKKSNIELEDLKFHQCVRLT-------------KFENEKIITFIPPDGDF 280
                           +L    FH CV                 F+ ++++ F+PPDG F
Sbjct: 267 ----------------DLGIPSFHACVEQEDQVQEQKQEQEPESFQGKRLLRFLPPDGKF 310

Query: 281 ELMSYRLS----TPIKPLIWCDVKLQVH-------SRSRIEIHCRAKAQIKKKSTANNVE 329
            L  Y +       +   +  D  +QV        ++   E+    +  I       ++ 
Sbjct: 311 RLAQYVIDLDGQGGMSRRMDRDGLIQVSFEDGLGLNKDEFEVRLHVRESIAVVDPVEDLV 370

Query: 330 ILIPVPEDADS--PKFRYSHGTIKWVPSQNAILWKIKSFPGGKDYSMAAEMGLPSVSDNS 387
           + +      DS     R +HGT           W+  S     + S      L    D+S
Sbjct: 371 VTLQFSNGNDSNVKMLRATHGTFVGQDEDRQCSWRFDS----DEISAGTLPVLRGCIDDS 426

Query: 388 DHKLKR------PVQIKFQIPYFTTSGIQVRYLKIN--EPKMQYNSYPWVRYITQ 434
            H  ++       V +++  P    SG +V  L ++   P+++   +  VR +T+
Sbjct: 427 KHVQQKKRSCLTSVAVRYGYPGELASGCRVTRLDVDVASPRVRGKVFKGVRCVTR 481

>Suva_4.548 Chr4 complement(950244..951698) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 60/132 (45%), Gaps = 31/132 (23%)

Query: 164 VSWRPEGIV-YKKNEAFLDVVESINMLLTQQGQVLR---SEILGKVKVKSRLSGMPDLKL 219
           V WR      ++ NE ++D++E+ +++L ++   LR    +I G V V+S L+  P + +
Sbjct: 199 VPWRTSKTSKHENNELYVDLLETFHVVLEKKKTRLRLVNGDICGAVDVRSYLNDNPLVSV 258

Query: 220 GLNDKGIFAQXXXXXXXXXASGGTKKKSNIELEDLKFHQCVRLT---KFENEKIITFIPP 276
            LN  G                        E+     H+CV +    +F    I TFIPP
Sbjct: 259 KLNTMGN-----------------------EIGIPSLHECVEINDDGEFTPSNI-TFIPP 294

Query: 277 DGDFELMSYRLS 288
           DG F L+ Y ++
Sbjct: 295 DGKFRLLEYSIN 306

>Ecym_7266 Chr7 (559988..560022,560112..561630) [1554 bp, 517 aa]
           {ON} similar to Ashbya gossypii AGL061W
          Length = 517

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 60/261 (22%), Positives = 100/261 (38%), Gaps = 46/261 (17%)

Query: 40  EQESSVLPPCFSFNGVQYLFIQHNDLYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVV 99
           EQ    L P    +    L +++ D  VLT TK M+ N  ++   L+ +I+  E  M   
Sbjct: 73  EQCDDPLKPLVFLSRFDGLLMEYFDRDVLTATKLMN-NQDRLALLLNSIIDAGEIVMSDT 131

Query: 100 EEESIKDNFVIIYELLDEMMDHGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPAT 159
            +         +  LL    D      + TK L + I  +       +    N+   P  
Sbjct: 132 NK---------LRYLLPLHTDLSTVFSSATKTLTRTIKNRESSNFLGSSNSSNINGGPTI 182

Query: 160 LTNS--------VSWRPEGIVYKKNEAFLDVVESINMLLTQQG----QVLRSEILGKVKV 207
             +S        V WR   +    NE ++D+VE++ + L Q       V    I GK+ +
Sbjct: 183 NRSSDSPLDAQVVPWRIPNLSNVNNEIYVDMVETLTLNLKQSRPNSFHVFHGVISGKIDL 242

Query: 208 KSRLSGMPDLKLGLNDKGIFAQXXXXXXXXXASGGTKKKSNIELEDLKFHQCVR-LTKFE 266
           K  L G P +++ L+                ++G   K S         H+C+   +   
Sbjct: 243 KCYLRGNPTMQINLH----------------SAGHAFKPS-------ALHRCLDPSSSSF 279

Query: 267 NEKIITFIPPDGDFELMSYRL 287
           +   + FIPPDG F L+ Y +
Sbjct: 280 DSSSLRFIPPDGKFTLLEYTI 300

>Skud_2.419 Chr2 complement(746943..748397) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 62/131 (47%), Gaps = 31/131 (23%)

Query: 164 VSWR-PEGIVYKKNEAFLDVVESINMLLTQQGQVLR---SEILGKVKVKSRLSGMPDLKL 219
           V WR  +   ++ NE ++D++E+ +++   +   LR     I G V V+S L+  P + +
Sbjct: 199 VPWRTSKASKHENNELYVDLLETFHVVFETKKSRLRLVNGNIHGTVDVRSYLNNNPLVSV 258

Query: 220 GLNDKGIFAQXXXXXXXXXASGGTKKKSNIELEDLKFHQCVRLTKFENEKI---ITFIPP 276
            LN  G                     ++I +  L  H+CV + K + E +   ITFIPP
Sbjct: 259 KLNTMG---------------------NDIGVPTL--HECVEI-KDDGEFLPSNITFIPP 294

Query: 277 DGDFELMSYRL 287
           DG F L+ Y +
Sbjct: 295 DGKFRLLEYSV 305

>YBR288C Chr2 complement(778012..779463) [1452 bp, 483 aa] {ON}
           APM3Mu3-like subunit of the clathrin associated protein
           complex (AP-3); functions in transport of alkaline
           phosphatase to the vacuole via the alternate pathway
          Length = 483

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 39/140 (27%), Positives = 64/140 (45%), Gaps = 38/140 (27%)

Query: 164 VSWR-PEGIVYKKNEAFLDVVESINMLLTQQGQVLR---SEILGKVKVKSRLSGMPDLKL 219
           V WR      ++ NE ++D++E+ +++  ++   LR     I G V V+S L+  P + +
Sbjct: 199 VPWRTSRASKHENNELYVDLLETFHVVFEKKKSHLRLLTGSIHGIVDVRSYLNDNPLVAV 258

Query: 220 GLNDKGIFAQXXXXXXXXXASGGTKKKSNIELEDLKFHQCVRLTKFENEKI-----ITFI 274
            LN  G                     ++I +  L  H CV +    N+ +     ITFI
Sbjct: 259 KLNTMG---------------------NDIGIPSL--HDCVEI----NDGVFSPSNITFI 291

Query: 275 PPDGDFELMSYR--LSTPIK 292
           PPDG F L+ Y   LS+ +K
Sbjct: 292 PPDGKFRLLEYSVDLSSQVK 311

>Smik_2.430 Chr2 complement(763687..765141) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 39.3 bits (90), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 58/128 (45%), Gaps = 29/128 (22%)

Query: 164 VSWR-PEGIVYKKNEAFLDVVESINMLLTQQGQVLR---SEILGKVKVKSRLSGMPDLKL 219
           V WR      ++ NE +LD++E+ +++  ++   +R     I G + V+S L+  P + +
Sbjct: 199 VPWRTSRASKHENNELYLDLLETFHVVFEKKKSHIRLVNGNIHGTLDVRSYLNDTPLVLV 258

Query: 220 GLNDKGIFAQXXXXXXXXXASGGTKKKSNIELEDLKFHQCVRLTK--FENEKIITFIPPD 277
            LN  G                     ++I +  L  H+CV +      +   ITFIPPD
Sbjct: 259 KLNTMG---------------------NDIGIPSL--HECVEINDGGVFSPSNITFIPPD 295

Query: 278 GDFELMSY 285
           G F L+ Y
Sbjct: 296 GKFRLLEY 303

>CAGL0L02145g Chr12 (252110..253741) [1632 bp, 543 aa] {ON} similar
           to uniprot|P38153 Saccharomyces cerevisiae YBR288c APM3
           AP-3 complex subunit mu3 subunit
          Length = 543

 Score = 38.5 bits (88), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 44/97 (45%), Gaps = 26/97 (26%)

Query: 195 QVLRSEILGKVKVKSRLSGMPDLKLGLNDKGIFAQXXXXXXXXXASGGTKKKSNIELEDL 254
           + +R  I G V ++  L+G P +++ L                       K+  +++   
Sbjct: 276 EYVRGNISGSVDMRCFLTGNPLVEIAL-----------------------KQGGLDIGIP 312

Query: 255 KFHQCVRLTKF-ENEKI--ITFIPPDGDFELMSYRLS 288
            FH CV  T   + EKI  ++FIPPDG F LM Y ++
Sbjct: 313 GFHDCVDKTSLLKQEKISKLSFIPPDGRFTLMQYNIN 349

>TBLA0E00140 Chr5 (17316..18947) [1632 bp, 543 aa] {ON} Anc_3.575
           YFR051C
          Length = 543

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 33/135 (24%), Positives = 59/135 (43%), Gaps = 8/135 (5%)

Query: 11  KGKLLLSRRYKD---DIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFIQHNDLYV 67
            GK LLSR++ D   D     +  F  L+ +   E + +        V+YL+   +D Y+
Sbjct: 12  NGKPLLSRQFTDVTKDRVMELLSNFQGLVAKGSSEHTYVEDEH----VRYLYKPFDDYYL 67

Query: 68  LTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDEMMDHGIPQIT 127
           + +T   S N+ Q  S L    + +  Y+   +E  I +N   I    DE++  G  +  
Sbjct: 68  IIITNRQS-NIIQDLSTLSLFSQTMNTYLASFDETDIFENAFEILSSFDEIIVMGYKENL 126

Query: 128 DTKMLRQYITQKSFK 142
               +  Y+T +S +
Sbjct: 127 TMAQVETYLTMESHE 141

>KLLA0D11396g Chr4 complement(976408..978018) [1611 bp, 536 aa] {ON}
           similar to uniprot|P43621 Saccharomyces cerevisiae
           YFR051C RET2 Delta subunit of the coatomer complex
           (COPI) which coats Golgi-derived transport vesicles
           involved in retrograde transport between Golgi and ER
          Length = 536

 Score = 36.2 bits (82), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 29/140 (20%), Positives = 64/140 (45%), Gaps = 8/140 (5%)

Query: 4   GIYFCDSKGKLLLSRRYKD---DIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60
            +     KGK LLSR+++D   D     +  F  L+    ++ + +        V+Y++ 
Sbjct: 5   AVSITTRKGKPLLSRQFRDITKDRVMELLSNFQTLVANSSKQHTFVED----EHVRYVYK 60

Query: 61  QHNDLYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDEMMD 120
             +D Y++ +T   S N+ Q    L+  ++ ++  +K + EE + D+   I    DE++ 
Sbjct: 61  PFDDYYIILITNLHS-NIIQDMDTLNIFVQTVDSTLKGLSEEDVFDSAFDILNSFDEIIT 119

Query: 121 HGIPQITDTKMLRQYITQKS 140
            G  +      ++ ++  +S
Sbjct: 120 MGYKENLSLTQIKTFLAMES 139

>KLTH0H11770g Chr8 (1010683..1011153) [471 bp, 156 aa] {ON} highly
           similar to uniprot|P35181 Saccharomyces cerevisiae
           YLR170C APS1 Small subunit of the clathrin- associated
           adaptor complex AP-1 which is involved in protein
           sorting at the trans-Golgi network homolog of the sigma
           subunit of the mammalian clathrin AP-1 complex
          Length = 156

 Score = 34.3 bits (77), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 33/136 (24%), Positives = 60/136 (44%), Gaps = 17/136 (12%)

Query: 9   DSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFIQHNDLYVL 68
           DSKGK  +SR           E    +L  K +  ++L     +   + ++ ++  LY +
Sbjct: 26  DSKGKSKISR-----------ELATMVLARKAKMCNILE----YQDHKVVYKRYASLYFI 70

Query: 69  TLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDEMM--DHGIPQI 126
               S S N       +H+ +E ++ Y   V E  I  NF   YE+L+E++  D  + + 
Sbjct: 71  CGISSDSDNELLTLEVIHRYVEAMDSYFNNVCELDIIFNFTKAYEILNEVLVCDGSMTET 130

Query: 127 TDTKMLRQYITQKSFK 142
           +   +LR  +T  S +
Sbjct: 131 SKQAILRSVMTMDSLE 146

>Ecym_6007 Chr6 (17110..18723) [1614 bp, 537 aa] {ON} similar to
           Ashbya gossypii AFR274C
          Length = 537

 Score = 35.0 bits (79), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 29/140 (20%), Positives = 62/140 (44%), Gaps = 8/140 (5%)

Query: 4   GIYFCDSKGKLLLSRRYKD---DIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60
            +      GK LLSR+++D   D     +  F +L+    +E + +        V+Y++I
Sbjct: 5   AVSITTKSGKPLLSRQFRDITKDRVMELLSNFQNLVASSSREHTFVEE----EHVRYIYI 60

Query: 61  QHNDLYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDEMMD 120
             +D Y++ +T   S N+ Q    L+   + +   +K   EE + ++   I    DE++ 
Sbjct: 61  PFDDYYIILITNRQS-NIIQDMDTLNLFSQTVNSNLKGFSEEDMLNSAFDILGSFDEIIS 119

Query: 121 HGIPQITDTKMLRQYITQKS 140
            G  +      +  +++ +S
Sbjct: 120 LGYKESLSLSQINTFLSMES 139

>ZYRO0E09746g Chr5 complement(772264..773880) [1617 bp, 538 aa] {ON}
           similar to uniprot|P43621 Saccharomyces cerevisiae
           YFR051C RET2 Delta subunit of the coatomer complex
           (COPI) which coats Golgi-derived transport vesicles
           involved in retrograde transport between Golgi and ER
          Length = 538

 Score = 35.0 bits (79), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 61/132 (46%), Gaps = 8/132 (6%)

Query: 12  GKLLLSRRYKD---DIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFIQHNDLYVL 68
           GK LLSR++++   D     +  F  L+     E + +      N V+Y++   +D Y++
Sbjct: 13  GKPLLSRQFRELTKDRVLELLSNFQSLVTNLSSEHTFVEG----NHVRYVYRPFDDYYII 68

Query: 69  TLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDEMMDHGIPQITD 128
            +T   S N+ +  S L+ L + +   +   +E  I D+   I    DE++  G  +   
Sbjct: 69  LITNRQS-NIIEDLSTLNLLSQTVNNCLSSYDENEIYDSAFEILTAFDEVVIMGYKENLS 127

Query: 129 TKMLRQYITQKS 140
           +  +  Y+T +S
Sbjct: 128 STQVTTYLTMES 139

>Smik_15.524 Chr15 complement(923208..923357) [150 bp, 50 aa] {ON}
           YCR018C-A (REPEAT)
          Length = 50

 Score = 30.4 bits (67), Expect = 0.80,   Method: Composition-based stats.
 Identities = 17/45 (37%), Positives = 27/45 (60%), Gaps = 1/45 (2%)

Query: 78  VAQVFSYLHKLIEVLEEYMKVVEEESIK-DNFVIIYELLDEMMDH 121
           +  + SYL  +IEVL EY+ V + ESI   N ++ Y L+  ++ H
Sbjct: 1   IMAMLSYLQNIIEVLLEYIGVRQTESIVLHNNILFYSLVSYIVIH 45

>NDAI0K01930 Chr11 (437535..439373) [1839 bp, 612 aa] {ON} Anc_2.522
           YBR288C
          Length = 612

 Score = 33.9 bits (76), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 36/152 (23%), Positives = 58/152 (38%), Gaps = 53/152 (34%)

Query: 164 VSWRPEGIVYKKNEAFLDVVESI-----NMLLTQQGQ-------------------VLRS 199
           V WR   I   KNE ++D+ E I     N +  ++G+                   ++  
Sbjct: 259 VPWRNGNIKNAKNELYIDMKEDIHVNFRNQIKNRKGRTYDNNNSNGIRVNNPSCMKLMNG 318

Query: 200 EILGKVKVKSRLSGMPDLKLGLNDKGIFAQXXXXXXXXXASGGTKKKSNIELEDLKFHQC 259
            I G + V+S L+G P +++ LN  G                        ++     H C
Sbjct: 319 YITGVIDVRSYLNGNPIVEMKLNTCG-----------------------NDMGTPSLHPC 355

Query: 260 VRL---TKFENEKI---ITFIPPDGDFELMSY 285
           V L      +++K+   + FIPPDG F L  Y
Sbjct: 356 VELEGDMNGDDDKVMDSLKFIPPDGKFCLARY 387

>Suva_8.418 Chr8 complement(751125..753305) [2181 bp, 726 aa] {ON}
           YOR361C (REAL)
          Length = 726

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 35/63 (55%), Gaps = 7/63 (11%)

Query: 109 VIIYELLDEMMDHGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRP-PATLTNSVSWR 167
           + I+E++D  M++ IP  T    +R Y  +   K  ++  K+ N+V+  P T  N++SW 
Sbjct: 465 ISIHEVVD--MNYAIPANT----IRFYAPEAKEKTAKNVIKRWNLVKEVPKTFANTISWS 518

Query: 168 PEG 170
           P G
Sbjct: 519 PAG 521

>Smik_7.371 Chr7 complement(610971..612767) [1797 bp, 598 aa] {ON}
           YFR051C (REAL)
          Length = 598

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 27/115 (23%), Positives = 55/115 (47%), Gaps = 8/115 (6%)

Query: 11  KGKLLLSRRYKD---DIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFIQHNDLYV 67
           +GK LLSR++KD   D     +  F +L+ E   + + +        V+Y++   ++ Y+
Sbjct: 65  QGKPLLSRQFKDLSKDRVLELLSNFQNLVTEISSDHTFVED----KHVRYVYRPFDNYYI 120

Query: 68  LTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDEMMDHG 122
           + +T   S N+ +  S L+   + +  Y+   +++ I  N   I    DE++  G
Sbjct: 121 ILITNRQS-NIIKDLSTLNLFSQTINSYLSSFQDQEIFHNAFEILSSFDEIVSMG 174

>KNAG0A06970 Chr1 complement(1086674..1088191) [1518 bp, 505 aa]
           {ON} Anc_2.522 YBR288C
          Length = 505

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 36/98 (36%), Gaps = 27/98 (27%)

Query: 195 QVLRSEILGKVKVKSRLSGMPDLKLGLNDKGIFAQXXXXXXXXXASGGTKKKSNIELEDL 254
           Q++   I G V  +  LS  P +++  N+ G                        +L   
Sbjct: 249 QLVTGCITGVVDCRCYLSRDPIVEVTFNNHGC-----------------------DLGTP 285

Query: 255 KFHQCVRLTKF----ENEKIITFIPPDGDFELMSYRLS 288
             H CV L        +   + FIPPDG F LM Y ++
Sbjct: 286 ALHDCVELDGVPEGPADHTTLKFIPPDGKFRLMEYSVT 323

>KNAG0D03000 Chr4 complement(537905..539596) [1692 bp, 563 aa] {ON}
           Anc_3.575 YFR051C
          Length = 563

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 31/134 (23%), Positives = 59/134 (44%), Gaps = 7/134 (5%)

Query: 12  GKLLLSRRYKD---DIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFIQHNDLYVL 68
           GK LLSR++KD   D     +  F +L +     S           V++++   +D Y++
Sbjct: 13  GKALLSRQFKDLSRDRVLELLSNFSNLALAS---SGTDHTYVEDEHVRFVYKPLDDYYIV 69

Query: 69  TLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDEMMDHGIPQITD 128
            +T   S N+ +  + L+   E +  Y+  V E+ + DN   I    DE++  G  +   
Sbjct: 70  LVTNRQS-NIIRDLATLNLFAETVGVYVSGVPEDGVFDNAFEILSAFDEIVVMGHKEQLS 128

Query: 129 TKMLRQYITQKSFK 142
              +  Y+  +S +
Sbjct: 129 QTQVNTYLAMESHE 142

>NCAS0G03400 Chr7 complement(623483..623971) [489 bp, 162 aa] {ON} 
          Length = 162

 Score = 30.8 bits (68), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 28/55 (50%)

Query: 83  SYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDEMMDHGIPQITDTKMLRQYIT 137
           S++H  +EVL+ +   V E  I  NF   Y +LDEM   G  Q     ML + ++
Sbjct: 102 SHIHLFVEVLDAFFGNVCELDIVFNFYKTYMVLDEMFIGGEIQEVSKDMLLERLS 156

>KLLA0B06545g Chr2 (583095..583541) [447 bp, 148 aa] {ON} highly
           similar to uniprot|Q00381 Saccharomyces cerevisiae
           YJR058C APS2 Small subunit of the clathrin- associated
           adaptor complex AP-2 which is involved in protein
           sorting at the plasma membrane related to the sigma
           subunit of the mammalian plasma membrane clathrin-
           associated protein (AP-2) complex
          Length = 148

 Score = 30.8 bits (68), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 28/56 (50%)

Query: 83  SYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDEMMDHGIPQITDTKMLRQYITQ 138
           S +H  +EVL+ +   V E  I  NF   Y ++DEM   G  Q T  K L + I Q
Sbjct: 88  SQIHLFVEVLDSFFGNVCELDILFNFYKTYLVMDEMFIAGEIQTTSKKELLERIGQ 143

>Kwal_27.10020 s27 (161799..162242) [444 bp, 147 aa] {ON} YJR058C
           (APS2) - Clathrin-associated protein, small subunit
           [contig 43] FULL
          Length = 147

 Score = 30.8 bits (68), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 31/55 (56%)

Query: 83  SYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDEMMDHGIPQITDTKMLRQYIT 137
           S++H L+EVL+ +   V E  I  NF   Y +LDE++  G  Q T  ++L + I 
Sbjct: 87  SHIHLLVEVLDAFFGNVCELDIVFNFHKAYMILDELIIGGEIQETSKEVLLERIN 141

>Kpol_507.7 s507 (49309..50910) [1602 bp, 533 aa] {ON}
           (49309..50910) [1602 nt, 534 aa]
          Length = 533

 Score = 32.0 bits (71), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 58/131 (44%), Gaps = 6/131 (4%)

Query: 12  GKLLLSRRYKDDIPANAIEQFPHL--LIEKEQESSVLPPCFSFNGVQYLFIQHNDLYVLT 69
           GK LLSR++K+      IE   +   L+ K   SS          V+Y++   +D Y++ 
Sbjct: 13  GKPLLSRQFKELTKERVIELLSNFQGLVSK---SSSDHTYVEDEHVRYVYRPFDDYYLIL 69

Query: 70  LTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDEMMDHGIPQITDT 129
           +T   S N+ Q  S L+   + +  Y+   +EE I  N   I    DE++  G  +    
Sbjct: 70  VTNRQS-NIIQDLSTLNLFSQSVNYYLNSFDEEEIFINAFEILSSFDEIIVMGNKENLTV 128

Query: 130 KMLRQYITQKS 140
             +  Y+  +S
Sbjct: 129 SQVNTYLAMES 139

>NDAI0G05210 Chr7 (1268117..1268587) [471 bp, 156 aa] {ON} Anc_1.388
          Length = 156

 Score = 30.4 bits (67), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 32/59 (54%), Gaps = 2/59 (3%)

Query: 85  LHKLIEVLEEYMKVVEEESIKDNFVIIYELLDEMM--DHGIPQITDTKMLRQYITQKSF 141
           +HK +E +++Y   V E  I  NF   Y++L+EM+  D  + + + T +L+   T  S 
Sbjct: 87  IHKYVETMDQYFGNVCELDIIYNFTKAYDILNEMIMCDGSLAETSKTVVLKDVRTMDSM 145

>ZYRO0C18524g Chr3 (1450641..1452305) [1665 bp, 554 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 554

 Score = 31.2 bits (69), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 29/120 (24%), Positives = 52/120 (43%), Gaps = 14/120 (11%)

Query: 276 PDGDFELMSYRLSTPIKPLIWCDVKLQVHSRSRI----------EIHCRAKAQIKKKSTA 325
           PD   + M Y  STP + L +  V  +  SR  +          +I  R K   ++   A
Sbjct: 297 PDDQSQWMQYHFSTPEEVLNFDKVVREAESRPSVKGIFFNVDLADIGNREKDSRRRVMDA 356

Query: 326 NNVEILIPVPED--ADSPKFRYSHGTIKWVPSQNAILWKIKSFPGGKDYSMAAEMGLPSV 383
           +N+  L  +  +   + PKF +    ++ + S   +   +K    G+D  MAA+ G+ +V
Sbjct: 357 DNISDLNAIVNNRMGNHPKFSWK--DVEKIVSSTNLPIALKGVQRGEDVVMAAKKGVKAV 414

>YKL215C Chr11 complement(26827..30687) [3861 bp, 1286 aa] {ON}
           OXP15-oxoprolinase; enzyme is ATP-dependent and
           functions as a dimer; similar to mouse Oplah gene; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm
          Length = 1286

 Score = 31.2 bits (69), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 48/98 (48%), Gaps = 6/98 (6%)

Query: 22  DDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFIQHNDLYVLTLTKS---MSINV 78
           DD+PA  I + P +L +  Q + +LP   +     ++FI+ N     TL+KS   + I+ 
Sbjct: 689 DDLPAGTIIEGPAILADGTQTNIILPNSQATILNSHIFIKINQKAAKTLSKSGYELDIDP 748

Query: 79  AQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLD 116
             +  + H+ +++  +    + + S+  N   + E LD
Sbjct: 749 ILLSIFSHRFMDIALQMGTQLRKTSVSTN---VKERLD 783

>TDEL0D06430 Chr4 complement(1151544..1153154) [1611 bp, 536 aa]
           {ON} Anc_3.575 YFR051C
          Length = 536

 Score = 30.8 bits (68), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 19/85 (22%), Positives = 38/85 (44%)

Query: 139 KSFKLIRSAKKKKNVVRPPATLTNSVSWRPEGIVYKKNEAFLDVVESINMLLTQQGQVLR 198
           +  KL   +K+        +T T +    PE      N   + + E++N  +T+ G +  
Sbjct: 243 RGMKLTGQSKRNIGTSARSSTATRASQQEPEEEKPANNGILISIKETVNAEITRDGAISS 302

Query: 199 SEILGKVKVKSRLSGMPDLKLGLND 223
           SE+ G ++++     +   KL L+D
Sbjct: 303 SELKGVLELRVNDRSLAHAKLTLDD 327

>Skud_6.142 Chr6 complement(245137..246777) [1641 bp, 546 aa] {ON}
           YFR051C (REAL)
          Length = 546

 Score = 30.8 bits (68), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 26/115 (22%), Positives = 55/115 (47%), Gaps = 8/115 (6%)

Query: 11  KGKLLLSRRYKD---DIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFIQHNDLYV 67
           +GK LLSR++KD   D     +  F +L+ E   + + +        V+Y++   ++ Y+
Sbjct: 12  QGKPLLSRQFKDLSKDRVLELLSNFQNLVSEISSDHTFVED----KHVRYVYRPFDNYYI 67

Query: 68  LTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDEMMDHG 122
           + +T   S N+ +  + L+   + +  Y+   +++ I  N   I    DE++  G
Sbjct: 68  ILITNRQS-NIIKDLATLNLFSQTINSYLSSFQDQEIFHNAFEILSSFDEIVSMG 121

>TPHA0G03700 Chr7 complement(783421..785040) [1620 bp, 539 aa] {ON}
           Anc_3.575 YFR051C
          Length = 539

 Score = 30.8 bits (68), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 42/86 (48%), Gaps = 1/86 (1%)

Query: 55  VQYLFIQHNDLYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYEL 114
           V+Y++   +D Y++ +T   S N+ Q  S L+   + +  Y+   +E  I +N   I   
Sbjct: 55  VRYVYKPFDDYYLILMTNRQS-NIIQDLSTLNLFSQTVNYYLNSFDENEIFENAFEILSS 113

Query: 115 LDEMMDHGIPQITDTKMLRQYITQKS 140
            DE++  G  +    + +  YI+ +S
Sbjct: 114 FDEIIVMGHKENLTIQQVNNYISMES 139

>TDEL0G04640 Chr7 complement(845491..848544) [3054 bp, 1017 aa] {ON}
           Anc_6.7 YEL055C
          Length = 1017

 Score = 30.8 bits (68), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 42/73 (57%), Gaps = 6/73 (8%)

Query: 81  VFSYLHKLIEVLEEYMKVVEEESIK-DNFVIIYE--LLDEMMDHGIPQITDTKM---LRQ 134
           V ++  ++I++LE Y+K VE++S+K +N+  I    LL E M   I Q TD  +   + +
Sbjct: 850 VIAFKQRVIDMLEIYVKFVEKQSLKEENYSKISSCLLLLEPMIKCIQQTTDKSLANRIAK 909

Query: 135 YITQKSFKLIRSA 147
            +  K FKL  SA
Sbjct: 910 LLRTKVFKLKTSA 922

>YFR051C Chr6 complement(250163..251803) [1641 bp, 546 aa] {ON}
           RET2Delta subunit of the coatomer complex (COPI), which
           coats Golgi-derived transport vesicles; involved in
           retrograde transport between Golgi and ER
          Length = 546

 Score = 30.4 bits (67), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 26/115 (22%), Positives = 55/115 (47%), Gaps = 8/115 (6%)

Query: 11  KGKLLLSRRYKD---DIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFIQHNDLYV 67
           +GK LLSR++KD   D     +  F +L+ E   + + +        V+Y++   ++ Y+
Sbjct: 12  QGKPLLSRQFKDLSKDRVLELLSNFQNLVSEISSDHTFVED----KHVRYVYRPFDNYYI 67

Query: 68  LTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDEMMDHG 122
           + +T   S N+ +  + L+   + +  Y+   +++ I  N   I    DE++  G
Sbjct: 68  ILITNRQS-NIIKDLATLNLFSQTINSYLSSFQDQEIFHNAFEILSSFDEIVSMG 121

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 46,848,403
Number of extensions: 2036282
Number of successful extensions: 6170
Number of sequences better than 10.0: 126
Number of HSP's gapped: 6156
Number of HSP's successfully gapped: 171
Length of query: 443
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 330
Effective length of database: 40,524,141
Effective search space: 13372966530
Effective search space used: 13372966530
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)